HHsearch alignment for GI: 254780477 and conserved domain: cd02949

>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains. The TRX domain functions as a protein disulfide reductase via the reversible oxidation of an active center dithiol present in a CXXC motif, while the NTR domain functions as a reductant to oxidized TRX. The fusion protein is bifunctional, showing both TRX and NTR activities, but it is not an independent NTR/TRX system. In plants, the protein is found exclusively in shoots and mature leaves and is localized in the chloroplast. It is involved in plant protection against oxidative stress.
Probab=97.91  E-value=6e-05  Score=51.29  Aligned_cols=79  Identities=18%  Similarity=0.281  Sum_probs=54.1

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88999970588820644334211344320000203799843323430245777666666665321245588888865433
Q gi|254780477|r   66 PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD  145 (232)
Q Consensus        66 ~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~q~~  145 (232)
T Consensus        14 k~VlV~F~A~wCgpCk~l~P~l~~la~ey-~~--~v~f~kvDv-------------------------------------   53 (97)
T cd02949          14 RLILVLYTSPTCGPCRTLKPILNKVIDEF-DG--AVHFVEIDI-------------------------------------   53 (97)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHC-CC--CEEEEEEEC-------------------------------------
T ss_conf             94999998999856564269999999983-79--719999968-------------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCEEEE--CCEE---ECCCCCHHHHHH
Q ss_conf             21134568998764311000068898640598999999999999998618853657998--9899---618999999999
Q gi|254780477|r  146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI--GGNL---YLGDMSEGVFSK  220 (232)
Q Consensus       146 ~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~gi~gTPt~~V--nG~~---~~g~~~~~~~~~  220 (232)
T Consensus        54 --------------------d------------------~~-~~la~~~~I~~~PT~~~fk~g~~v~~~~G~~~~~~l~~   94 (97)
T cd02949          54 --------------------D------------------ED-QEIAEAAGIMGTPTVQFFKDKELVKEISGVKMKSEYRE   94 (97)
T ss_pred             --------------------C------------------CC-HHHHHHCCCCCCCEEEEEECCEEEEEEECCCCHHHHHH
T ss_conf             --------------------8------------------79-88999819931778999999999688888888999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780477|r  221 IID  223 (232)
Q Consensus       221 ~id  223 (232)
T Consensus        95 ~ie   97 (97)
T cd02949          95 FIE   97 (97)
T ss_pred             HHC
T ss_conf             759