HHsearch alignment for GI: 254780477 and conserved domain: cd02956

>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria.
Probab=98.04  E-value=2.5e-05  Score=53.70  Aligned_cols=83  Identities=13%  Similarity=0.283  Sum_probs=55.3

Q ss_pred             CCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68988889999705888206443342113443200002037998433234302457776666666653212455888888
Q gi|254780477|r   61 GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF  140 (232)
Q Consensus        61 G~~~A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~  140 (232)
T Consensus         9 ~s~~~P-Vlv~F~A~wC~~C~~~~p~l~~~a~~~-~~--~~~~~~vd~--------------------------------   52 (96)
T cd02956           9 ESTQVP-VVVDFWAPRSPPSKELLPLLERLAEEY-QG--QFVLAKVNC--------------------------------   52 (96)
T ss_pred             HCCCCC-EEEEEECCCCHHHHHHHHHHHHHHHHC-CC--EEEEEEEEC--------------------------------
T ss_conf             759980-999998899976899899999999855-65--299999803--------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCEEEE--CCEE---ECCCCCH
Q ss_conf             6543321134568998764311000068898640598999999999999998618853657998--9899---6189999
Q gi|254780477|r  141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI--GGNL---YLGDMSE  215 (232)
Q Consensus       141 ~~q~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~gi~gTPt~~V--nG~~---~~g~~~~  215 (232)
T Consensus        53 -------------------------d------------------~-~~~la~~~~V~~~Pt~~~f~~G~~v~~~~G~~~~   88 (96)
T cd02956          53 -------------------------D------------------A-QPQIAQQFGVQALPTVYLFAAGQPVDGFQGAQPE   88 (96)
T ss_pred             -------------------------C------------------C-CHHHHHHCCCCCCCEEEEEECCEEEEEEECCCCH
T ss_conf             -------------------------3------------------4-6546876787616838889999994577189999


Q ss_pred             HHHHHHHH
Q ss_conf             99999999
Q gi|254780477|r  216 GVFSKIID  223 (232)
Q Consensus       216 ~~~~~~id  223 (232)
T Consensus        89 ~~l~~~le   96 (96)
T cd02956          89 EQLRQMLD   96 (96)
T ss_pred             HHHHHHHC
T ss_conf             99999769