HHsearch alignment for GI: 254780477 and conserved domain: cd03004

>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus.
Probab=93.61  E-value=0.098  Score=30.97  Aligned_cols=33  Identities=15%  Similarity=0.249  Sum_probs=23.5

Q ss_pred             HHHHCCCCCCCEEEE---CCE---EECC-CCCHHHHHHHH
Q ss_conf             998618853657998---989---9618-99999999999
Q gi|254780477|r  190 ASEDFAIDSTPVFFI---GGN---LYLG-DMSEGVFSKII  222 (232)
Q Consensus       190 ~~~~~gi~gTPt~~V---nG~---~~~g-~~~~~~~~~~i  222 (232)
T Consensus        65 ~~~~~~V~~~PTi~lf~~~~~~~~~y~G~~R~~e~l~~fi  104 (104)
T cd03004          65 LCQQANIRAYPTIRLYPGNASKYHSYNGWHRDADSILEFI  104 (104)
T ss_pred             HHHCCCCEECCEEEEECCCCCCEEECCCCCCCHHHHHHHC
T ss_conf             7736781883789999198988545789998999999659