HHsearch results for GI: 254780477 and protein with PDBid: 1fo5_A

>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1
Probab=98.21  E-value=2.2e-06  Score=58.93  Aligned_cols=83  Identities=16%  Similarity=0.341  Sum_probs=56.6

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88899997058882064433421134432000020379984332343024577766666666532124558888886543
Q gi|254780477|r   65 APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD  144 (232)
Q Consensus        65 A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~q~  144 (232)
                      .|++|+.|....||||+.+.+.+.....+ +.+...+..+..                                      
T Consensus         2 ~kv~v~~F~a~wC~~C~~~~p~~~~l~~~-~~~~~~~~~~~~--------------------------------------   42 (85)
T 1fo5_A            2 SKVKIELFTSPMCPHCPAAKRVVEEVANE-MPDAVEVEYINV--------------------------------------   42 (85)
T ss_dssp             CCEEEEEEECCCSSCCCTHHHHHHHHHHH-CSSSEEEEEEES--------------------------------------
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHH-CCEEEEEEEEEC--------------------------------------
T ss_conf             96399999999886269889887554220-210256777505--------------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCE-EECCCCCHHHHHHHHH
Q ss_conf             321134568998764311000068898640598999999999999998618853657998989-9618999999999999
Q gi|254780477|r  145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN-LYLGDMSEGVFSKIID  223 (232)
Q Consensus       145 ~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~gi~gTPt~~VnG~-~~~g~~~~~~~~~~id  223 (232)
                                           +        ++           .+.++++||+|+||++++++ .+.|..+.+++.+.|+
T Consensus        43 ---------------------~--------~~-----------~~l~~~~~V~~~PT~~i~~~g~~~G~~~~~~l~~~i~   82 (85)
T 1fo5_A           43 ---------------------M--------EN-----------PQKAMEYGIMAVPTIVINGDVEFIGAPTKEALVEAIK   82 (85)
T ss_dssp             ---------------------S--------SS-----------CCTTTSTTTCCSSEEEETTEEECCSSSSSHHHHHHHH
T ss_pred             ---------------------C--------CC-----------HHHHHHCCCEEECEEEEECCCEEECCCCHHHHHHHHH
T ss_conf             ---------------------4--------58-----------9999981982748899986959987999999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780477|r  224 SMI  226 (232)
Q Consensus       224 ~ll  226 (232)
                      +.|
T Consensus        83 ~~L   85 (85)
T 1fo5_A           83 KRL   85 (85)
T ss_dssp             HHC
T ss_pred             HCC
T ss_conf             539