HHsearch results for GI: 254780477 and protein with PDBid: 1lu4_A

>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10
Probab=96.76  E-value=0.0038  Score=38.51  Aligned_cols=37  Identities=16%  Similarity=0.330  Sum_probs=28.1

Q ss_pred             HHHCCCCCCCEEEE---CCE--EE---CCCCCHHHHHHHHHHHHH
Q ss_conf             98618853657998---989--96---189999999999999999
Q gi|254780477|r  191 SEDFAIDSTPVFFI---GGN--LY---LGDMSEGVFSKIIDSMIQ  227 (232)
Q Consensus       191 ~~~~gi~gTPt~~V---nG~--~~---~g~~~~~~~~~~id~ll~  227 (232)
                      .+.+|+.++|++++   ||+  .+   .|..+.+++++.|++|+.
T Consensus        92 ~~~~~v~~~P~~~~id~~G~i~~v~~~~g~~~~~~l~~~l~~L~a  136 (136)
T 1lu4_A           92 WARYNVPWQPAFVFYRADGTSTFVNNPTAAMSQDELSGRVAALTS  136 (136)
T ss_dssp             HHHTTCCSSSEEEEECTTSCEEEECCSSSCCCHHHHHHHHHHC--
T ss_pred             HHHCCCCCCCEEEEECCCCEEEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             998399844579999699719998424788999999999998529