HHsearch results for GI: 254780477 and protein with PDBid: 1nho_A

>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1
Probab=98.30  E-value=5.3e-07  Score=62.91  Aligned_cols=37  Identities=16%  Similarity=0.360  Sum_probs=32.0

Q ss_pred             HHHCCCCCCCEEEECCE-EECCCCCHHHHHHHHHHHHH
Q ss_conf             98618853657998989-96189999999999999999
Q gi|254780477|r  191 SEDFAIDSTPVFFIGGN-LYLGDMSEGVFSKIIDSMIQ  227 (232)
Q Consensus       191 ~~~~gi~gTPt~~VnG~-~~~g~~~~~~~~~~id~ll~  227 (232)
                      .+++||.|+||+++||+ .+.|..+.+++.+.|++.|+
T Consensus        48 ~~~~~V~~~Pt~~~~~~~~~~G~~~~~~l~~~i~~~le   85 (85)
T 1nho_A           48 AIEYGLMAVPAIAINGVVRFVGAPSREELFEAINDEME   85 (85)
T ss_dssp             GGGTCSSCSSEEEETTTEEEECSSCCHHHHHHHHHHCC
T ss_pred             HHHCCCEEECEEEEECCEEEECCCCHHHHHHHHHHHHC
T ss_conf             99829827597999075799948999999999998429