HHsearch results for GI: 254780477 and protein with PDBid: 1o73_A

>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10
Probab=96.31  E-value=0.019  Score=34.08  Aligned_cols=48  Identities=17%  Similarity=0.340  Sum_probs=31.6

Q ss_pred             CCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             4116898888999970588820644334211344320000203799843
Q gi|254780477|r   58 VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR  106 (232)
Q Consensus        58 ~~~G~~~A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~  106 (232)
                      +.+.+-..+++++.|+-..||+|....+.+.+..+++..+. .+.++..
T Consensus        21 vsl~~l~GK~vvl~FwatwC~~C~~e~p~l~~l~~k~~~~~-~~~vv~i   68 (144)
T 1o73_A           21 VSLGSLVGKTVFLYFSASWCPPCRGFTPVLAEFYEKHHVAK-NFEVVLI   68 (144)
T ss_dssp             BCSGGGTTCEEEEEEECTTCHHHHHHHHHHHHHHHHHTTTT-TEEEEEE
T ss_pred             EEHHHHCCCEEEEEEECCCCCCHHHCCHHHHHHHHHHCCCC-CEEEEEE
T ss_conf             96999099879999997888556654866999998740146-6489986