HHsearch results for GI: 254780477 and protein with PDBid: 1syr_A

>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum 3D7} SCOP: c.47.1.1
Probab=97.15  E-value=0.0015  Score=41.09  Aligned_cols=34  Identities=26%  Similarity=0.532  Sum_probs=26.1

Q ss_pred             HHHCCCCCCCEEEE--CCEE---ECCCCCHHHHHHHHHHH
Q ss_conf             98618853657998--9899---61899999999999999
Q gi|254780477|r  191 SEDFAIDSTPVFFI--GGNL---YLGDMSEGVFSKIIDSM  225 (232)
Q Consensus       191 ~~~~gi~gTPt~~V--nG~~---~~g~~~~~~~~~~id~l  225 (232)
                      .+.+||+++||+++  ||+.   +.| .+.+++++.|++.
T Consensus        72 ~~~~~V~~~PTi~~~k~G~~v~~~~G-~~~~~l~~~i~k~  110 (112)
T 1syr_A           72 TEKENITSMPTFKVYKNGSSVDTLLG-ANDSALKQLIEKY  110 (112)
T ss_dssp             HHHTTCCSSSEEEEEETTEEEEEEES-CCHHHHHHHHHTT
T ss_pred             HHHCCCEEECEEEEEECCEEEEEEEC-CCHHHHHHHHHHH
T ss_conf             99869918466999989999999949-2989999999984