HHsearch results for GI: 254780477 and protein with PDBid: 1ti3_A

>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1
Probab=97.29  E-value=0.0012  Score=41.60  Aligned_cols=34  Identities=18%  Similarity=0.553  Sum_probs=25.8

Q ss_pred             HHHCCCCCCCEEEE--CCEE---ECCCCCHHHHHHHHHHH
Q ss_conf             98618853657998--9899---61899999999999999
Q gi|254780477|r  191 SEDFAIDSTPVFFI--GGNL---YLGDMSEGVFSKIIDSM  225 (232)
Q Consensus       191 ~~~~gi~gTPt~~V--nG~~---~~g~~~~~~~~~~id~l  225 (232)
                      ++++||+++||+++  ||+.   +.| .+.++|.++|++.
T Consensus        72 ~~~~~I~~~PT~~~~~~G~~~~~~~G-~~~~~l~~~i~k~  110 (113)
T 1ti3_A           72 AEEWNVEAMPTFIFLKDGKLVDKTVG-ADKDGLPTLVAKH  110 (113)
T ss_dssp             HHHHHCSSTTEEEEEETTEEEEEEEC-CCTTHHHHHHHHH
T ss_pred             HHHHCCEECCEEEEEECCEEEEEECC-CCHHHHHHHHHHH
T ss_conf             98709716178999999999999869-8999999999987