HHsearch results for GI: 254780477 and protein with PDBid: 1un2_A

>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13
Probab=99.10  E-value=1.5e-10  Score=85.28  Aligned_cols=81  Identities=16%  Similarity=0.108  Sum_probs=53.1

Q ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHH--HHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             898888999970588820644334211--344320000203799843323430245777666666665321245588888
Q gi|254780477|r   62 QKDAPVTMVEYASMTCFHCAEFHNKTF--KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL  139 (232)
Q Consensus        62 ~~~A~v~ivef~D~~Cp~C~~~~~~~~--~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~  139 (232)
                      +...+++|+|||||.||||+.|++.+.  +.+++.+.+...+.+.+.+++.+  ..+..++...+....++.++.+++.+
T Consensus       110 p~~~~~~VvEff~y~CphC~~~e~~l~~~~~~~~~~~~~v~~~~~~~~~~~~--~~~~~~a~a~~~a~~~g~~~~~h~~l  187 (197)
T 1un2_A          110 PVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGG--DLGKDLTQAWAVAMALGVEDKVTVPL  187 (197)
T ss_dssp             CCTTCCSEEEEECTTCHHHHHHHHTSCHHHHHTTSSCTTCCEEEEECSSSSH--HHHHHHHHHHHHHHHHTCHHHHHHHH
T ss_pred             CCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC--CCHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             8999966999981699316556277524899997689973899984577788--33799999999999869888999999


Q ss_pred             HHHHH
Q ss_conf             86543
Q gi|254780477|r  140 FNKQD  144 (232)
Q Consensus       140 ~~~q~  144 (232)
                      |+.-.
T Consensus       188 F~aih  192 (197)
T 1un2_A          188 FEGVQ  192 (197)
T ss_dssp             HHHHH
T ss_pred             HHHHH
T ss_conf             99998