HHsearch results for GI: 254780477 and protein with PDBid: 1wmj_A

>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa}
Probab=96.44  E-value=0.00049  Score=44.15  Aligned_cols=35  Identities=17%  Similarity=0.439  Sum_probs=25.9

Q ss_pred             HHCCCCCCCEEEE--CCEE---ECCCCCHHHHHHHHHHHHH
Q ss_conf             8618853657998--9899---6189999999999999999
Q gi|254780477|r  192 EDFAIDSTPVFFI--GGNL---YLGDMSEGVFSKIIDSMIQ  227 (232)
Q Consensus       192 ~~~gi~gTPt~~V--nG~~---~~g~~~~~~~~~~id~ll~  227 (232)
                      +++||+|+|||++  ||+.   +.|. ..+++++.|++.+.
T Consensus        83 ~~~~I~~~PT~~~~~~G~~v~~~~G~-~~~~l~~~i~k~~~  122 (130)
T 1wmj_A           83 EKYNVEAMPTFLFIKDGAEADKVVGA-RKDDLQNTIVKHVG  122 (130)
T ss_dssp             HHHTCCSSCCCCBCTTTTCCBCCCTT-CTTTHHHHHHHHTS
T ss_pred             HHCCCCCCCEEEEEECCEEEEEEECC-CHHHHHHHHHHHCC
T ss_conf             41241666879999899999999596-99999999999739