HHsearch results for GI: 254780477 and protein with PDBid: 1x5c_A

>1x5c_A Protein disulfide-isomerase; DSI, ERBA2L, GIT, PDI, PDIA1, PO4DB, PO4HB, prohb, thioredoxin like domain, redox, structural genomics; NMR {Homo sapiens}
Probab=96.86  E-value=0.011  Score=35.57  Aligned_cols=36  Identities=25%  Similarity=0.275  Sum_probs=26.7

Q ss_pred             HHCCCCCCCEEEE--CC-----EEECCCCCHHHHHHHHHHHHH
Q ss_conf             8618853657998--98-----996189999999999999999
Q gi|254780477|r  192 EDFAIDSTPVFFI--GG-----NLYLGDMSEGVFSKIIDSMIQ  227 (232)
Q Consensus       192 ~~~gi~gTPt~~V--nG-----~~~~g~~~~~~~~~~id~ll~  227 (232)
                      ++++|+|+||+++  +|     ..+.|..+.++|.+.|+...+
T Consensus        73 ~~~~I~~~Pti~~f~~~~~~~~~~~~g~~~~~~l~~fi~~~~~  115 (121)
T 1x5c_A           73 EAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ  115 (121)
T ss_dssp             TTBCCCSSSEEEEECSCSSCCCEECCSCCSHHHHHHHHHHTSC
T ss_pred             HHCCCEEECEEEEEECCCCCEEEEEECCCCHHHHHHHHHHCCC
T ss_conf             6549507257999989983046783189999999999996687