HHsearch results for GI: 254780477 and protein with PDBid: 1x5d_A

>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=97.55  E-value=0.0011  Score=42.00  Aligned_cols=39  Identities=18%  Similarity=0.286  Sum_probs=29.3

Q ss_pred             HHHCCCCCCCEEEE--CCEE---ECCCCCHHHHHHHHHHHHHHH
Q ss_conf             98618853657998--9899---618999999999999999986
Q gi|254780477|r  191 SEDFAIDSTPVFFI--GGNL---YLGDMSEGVFSKIIDSMIQDS  229 (232)
Q Consensus       191 ~~~~gi~gTPt~~V--nG~~---~~g~~~~~~~~~~id~ll~~~  229 (232)
                      .+++||+++||+++  ||+.   +.|..+.+++.+.+...+.+.
T Consensus        76 ~~~~~v~~~Pt~~~~~~G~~~~~~~G~~~~~~l~~~~~~~~~~~  119 (133)
T 1x5d_A           76 ASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDN  119 (133)
T ss_dssp             HHHHTCCSSSEEEEEETTEEEEEECSCCSHHHHHHHHHHHHHHH
T ss_pred             HHHCCCCCCCEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             99859945186999989939899975899999999999976523