HHsearch results for GI: 254780477 and protein with PDBid: 1x5e_A

>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=97.30  E-value=0.00058  Score=43.67  Aligned_cols=38  Identities=24%  Similarity=0.418  Sum_probs=28.8

Q ss_pred             HHHHCCCCCCCEEEE--CCEE--ECCCCCHHHHHHHHHHHHH
Q ss_conf             998618853657998--9899--6189999999999999999
Q gi|254780477|r  190 ASEDFAIDSTPVFFI--GGNL--YLGDMSEGVFSKIIDSMIQ  227 (232)
Q Consensus       190 ~~~~~gi~gTPt~~V--nG~~--~~g~~~~~~~~~~id~ll~  227 (232)
                      ..+++||+++||+++  +|+.  +.|..+.+++...|.....
T Consensus        69 l~~~~~V~~~Pti~~~~~g~~~~y~G~~~~~~l~~fi~~~~~  110 (126)
T 1x5e_A           69 LSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEW  110 (126)
T ss_dssp             HHHHTTCCSSSEEEEEETTEEEECCSCCCHHHHHHHHHTCGG
T ss_pred             HHHHCCCCEECEEEEEECCEEEEEECCCCHHHHHHHHHCCCC
T ss_conf             999869927487999989979997689999999999981547