HHsearch results for GI: 254780477 and protein with PDBid: 2djj_A

>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A
Probab=92.45  E-value=0.17  Score=28.10  Aligned_cols=33  Identities=21%  Similarity=0.250  Sum_probs=24.4

Q ss_pred             HCCCCCCCEEEE--CCE-----EECCCCCHHHHHHHHHHH
Q ss_conf             618853657998--989-----961899999999999999
Q gi|254780477|r  193 DFAIDSTPVFFI--GGN-----LYLGDMSEGVFSKIIDSM  225 (232)
Q Consensus       193 ~~gi~gTPt~~V--nG~-----~~~g~~~~~~~~~~id~l  225 (232)
                      .++|.|+||+++  +|+     .+.|..+.++|.+.|++-
T Consensus        76 ~~~V~~~Pti~~f~~g~~~~~~~~~g~~~~~~l~~fi~~~  115 (121)
T 2djj_A           76 PDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAEN  115 (121)
T ss_dssp             SSCCSSSSEEEEECSSCTTSCCCCCCCSCHHHHHHHHHHT
T ss_pred             HCCCCCCCEEEEEECCCCCCEEEECCCCCHHHHHHHHHHC
T ss_conf             2560511569999899486578845999999999999976