HHsearch results for GI: 254780477 and protein with PDBid: 2i4a_A

>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti}
Probab=97.82  E-value=7e-05  Score=49.47  Aligned_cols=34  Identities=15%  Similarity=0.499  Sum_probs=28.3

Q ss_pred             HHHCCCCCCCEEEE--CCEE---ECCCCCHHHHHHHHHH
Q ss_conf             98618853657998--9899---6189999999999999
Q gi|254780477|r  191 SEDFAIDSTPVFFI--GGNL---YLGDMSEGVFSKIIDS  224 (232)
Q Consensus       191 ~~~~gi~gTPt~~V--nG~~---~~g~~~~~~~~~~id~  224 (232)
                      ++++||+|+||+++  ||+.   +.|..+.+++++.|++
T Consensus        67 ~~~~~V~~~PT~~~~~~G~~v~~~~G~~~~~~l~~~ie~  105 (107)
T 2i4a_A           67 PNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVES  105 (107)
T ss_dssp             HHHTTCCSSSEEEEEETTEEEEEEESCCCHHHHHHHHHH
T ss_pred             HHCCCEEECCEEEEEECCEEEEEEECCCCHHHHHHHHHH
T ss_conf             735621670689999999998999789999999999996