HHsearch results for GI: 254780477 and protein with PDBid: 2ywm_A

>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.30A {Aquifex aeolicus VF5} PDB: 2ayt_A
Probab=97.85  E-value=8.7e-05  Score=48.89  Aligned_cols=43  Identities=21%  Similarity=0.366  Sum_probs=36.6

Q ss_pred             HHHHHCCCCCCCEEEECCE--EECCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             9998618853657998989--961899999999999999998603
Q gi|254780477|r  189 RASEDFAIDSTPVFFIGGN--LYLGDMSEGVFSKIIDSMIQDSTR  231 (232)
Q Consensus       189 ~~~~~~gi~gTPt~~VnG~--~~~g~~~~~~~~~~id~ll~~~~~  231 (232)
                      ...+++||+|.||+++||+  .+.|..+.+++.+.|...+++.++
T Consensus       180 ~~~~~~~i~~~Pti~~~~~~~~~~G~~~~~~~~~~i~~~~~~~~~  224 (229)
T 2ywm_A          180 DLAEQFQVVGVPKIVINKGVAEFVGAQPENAFLGYIMAVYEKLKR  224 (229)
T ss_dssp             HHHHHTTCCSSSEEEEGGGTEEEESCCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCCCEEEEEEECCCEEEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             579876972122699879646875789999999999999987667