HHsearch results for GI: 254780477 and protein with PDBid: 3erw_A

>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis}
Probab=97.55  E-value=0.00029  Score=45.62  Aligned_cols=37  Identities=14%  Similarity=0.199  Sum_probs=27.2

Q ss_pred             CCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             11689888899997058882064433421134432000
Q gi|254780477|r   59 SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI   96 (232)
Q Consensus        59 ~~G~~~A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~   96 (232)
                      .+-+ ..+++|+.|+...||+|....+.+.....++..
T Consensus        29 ~l~~-~gk~vll~F~a~wC~~C~~~~~~l~~l~~~~~~   65 (145)
T 3erw_A           29 SIPN-KGQKTILHFWTSWCPPCKKELPQFQSFYDAHPS   65 (145)
T ss_dssp             EESC-TTSEEEEEEECSSCHHHHHHHHHHHHHHHHCCC
T ss_pred             EEHH-CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             7065-698899999879897099999999999864211