HHsearch results for GI: 254780477 and protein with PDBid: 3fz5_A

>3fz5_A Possible 2-hydroxychromene-2-carboxylate isomerase; structural genomics, PSI-2, protein structure initiative; HET: MSE GTT PGE; 2.40A {Rhodobacter sphaeroides 2}
Probab=99.51  E-value=7.8e-13  Score=99.76  Aligned_cols=154  Identities=10%  Similarity=0.015  Sum_probs=106.8

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC---------------------------------
Q ss_conf             88899997058882064433421134432000020379984332343---------------------------------
Q gi|254780477|r   65 APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD---------------------------------  111 (232)
Q Consensus        65 A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~---------------------------------  111 (232)
                      |-..|..|+|+.||+|.-.+..+.....++..   .+.+.+..+...                                 
T Consensus         3 ~m~~Id~y~D~~cP~~yla~~~l~~l~~~~~~---~i~~~P~~l~~~~~~~g~~~~~~~~~k~~~~~~d~~r~a~~~g~~   79 (202)
T 3fz5_A            3 AMNPIEFWFDFSSGYAFFAAQRIEALAAELGR---TVLWRPYMLGAAFSVTGARGLSSTPLKRDYAQRDWARIARQRGLT   79 (202)
T ss_dssp             CCSCEEEEECTTCHHHHHHHTTHHHHHHHHTC---CEEEEECTTC----------CCSHHHHHHHHHHHHHHHHHHHTCC
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHHHHCCC---EEEEEEEECCCCCHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             88768999849998999999999999997398---599998862764021178631226068999999999999981995


Q ss_pred             --------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHH
Q ss_conf             --------024577766666666532124558888886543321134568998764311000068898640598999999
Q gi|254780477|r  112 --------SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI  183 (232)
Q Consensus       112 --------~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~i  183 (232)
                              ...........++.....+....++..++..-...+......+.+..++.+.|++...+.+.+.+++..+.+
T Consensus        80 ~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~a~~~~g~di~d~~vL~~ia~~~Gld~~~~~~~~~~~~~~~~l  159 (202)
T 3fz5_A           80 FRPPADHPHVALAATRAFYWIEAQSPDAATAFAQRVFDLYFSDRLDTASPEAVSRLGPEVGLEPEALLAGIADPALKETV  159 (202)
T ss_dssp             CCCCTTCCCCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHTTTCCCTTCHHHHHTTHHHHTCCHHHHHHHTTCHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHH
T ss_conf             66786678763899999999986414789999999999987247785607899999987499989998883599999999


Q ss_pred             HHHHHHHHHHCCCCCCCEEEECCEEECCCCCHHHHHHHH
Q ss_conf             999999998618853657998989961899999999999
Q gi|254780477|r  184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII  222 (232)
Q Consensus       184 ~~~~~~~~~~~gi~gTPt~~VnG~~~~g~~~~~~~~~~i  222 (232)
                      .++.+++. +.||.|+|||+|||+.+-|.--.+.+...|
T Consensus       160 ~~~~~~a~-~~Gv~GvPtfvv~~e~f~G~Drl~~l~~~L  197 (202)
T 3fz5_A          160 RKIGEDAV-ARGIFGSPFFLVDDEPFWGWDRMEMMAEWI  197 (202)
T ss_dssp             HHHHHHHH-HTTCCSSSEEEETTEEEESGGGHHHHHHHH
T ss_pred             HHHHHHHH-HCCCEECCEEEECCEEEECHHHHHHHHHHH
T ss_conf             99999999-879938878999998873056699999999