HHsearch results for GI: 254780477 and protein with PDBid: 3gmf_A

>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans DSM12444}
Probab=99.97  E-value=9.8e-31  Score=212.90  Aligned_cols=174  Identities=19%  Similarity=0.374  Sum_probs=146.3

Q ss_pred             CCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66784116898888999970588820644334211344320000203799843323430245777666666665321245
Q gi|254780477|r   54 TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYW  133 (232)
Q Consensus        54 ~~~~~~~G~~~A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~  133 (232)
                      ...++++|+++||++|+||+||.||||++|++++.+.+++.+.+.+...+++++.+.+..........   .+.....++
T Consensus         4 ~~~~~~~G~~~A~v~Ii~f~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~   80 (205)
T 3gmf_A            4 ADGHHLLGNPAAKLRLVEFVSYTCPHCSHFEIESEGQLKIGMVQPGKGAIEVRNFVRDPIDMTVALIT---NCVPPSRFF   80 (205)
T ss_dssp             CTTEEEESCTTCSEEEEEEECTTCHHHHHHHHHHHHHHHHHTTTTTSEEEEEEECCCSHHHHHHHHHH---HHSCHHHHH
T ss_pred             CCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHH---HHHCCHHHH
T ss_conf             78996115999998999988999862798999999999875134606999834665526778999999---961100499


Q ss_pred             HHHHHHHHHHHHHH-----------------------HHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             58888886543321-----------------------1345689987643110000688986405989999999999999
Q gi|254780477|r  134 GFVSLLFNKQDDWI-----------------------NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA  190 (232)
Q Consensus       134 ~~~~~~~~~q~~~~-----------------------~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~  190 (232)
                      .+++.++..|..+.                       ........+..++...|++..++..|+++.+....+.++...+
T Consensus        81 ~~~~~l~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~g~~~~~~~~~l~~~~~~~~v~~~~~~a  160 (205)
T 3gmf_A           81 TLHTAFMRSQAQWIGPLANSTEAQRQRWFNGTFATRTRAIASDFRFYDFMAARGMDRSTLDRCLSNEALAKKLAAETDEA  160 (205)
T ss_dssp             HHHHHHHHTHHHHCHHHHHCCHHHHHTTSSSCHHHHHHHHHHHTTHHHHHHTTTCCHHHHHHHHTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             99999998531012210014677777777665555430347889999999882476999999973889999999999999


Q ss_pred             HHHCCCCCCCEEEECCEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9861885365799898996189999999999999999860
Q gi|254780477|r  191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST  230 (232)
Q Consensus       191 ~~~~gi~gTPt~~VnG~~~~g~~~~~~~~~~id~ll~~~~  230 (232)
                      .+++||+|||||+|||++++|..++++|+++||.+|.|..
T Consensus       161 ~~~~gi~gTPt~iIng~~v~G~~~~~~l~~~I~~~l~e~~  200 (205)
T 3gmf_A          161 INQYNVSGTPSFMIDGILLAGTHDWASLRPQILARLNEGH  200 (205)
T ss_dssp             HHHHCCCSSSEEEETTEECTTCCSHHHHHHHHHHHHTC--
T ss_pred             HHHCCCCCCCEEEECCEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             9980985178899999995088999999999999995788