BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780477|ref|YP_003064890.1| DSBA oxidoreductase
[Candidatus Liberibacter asiaticus str. psy62]
         (232 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780477|ref|YP_003064890.1| DSBA oxidoreductase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040154|gb|ACT56950.1| DSBA oxidoreductase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 232

 Score =  479 bits (1234), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/232 (100%), Positives = 232/232 (100%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI
Sbjct: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML
Sbjct: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL
Sbjct: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
Sbjct: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232


>gi|315122067|ref|YP_004062556.1| DSBA oxidoreductase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495469|gb|ADR52068.1| DSBA oxidoreductase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 228

 Score =  315 bits (808), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 152/225 (67%), Positives = 184/225 (81%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M T +IG L   V+  + S FFYT+  ++ N LP+P  ++D   LLAASP  M+++SIG+
Sbjct: 1   MKTAKIGALCIAVVFVVGSVFFYTKSRNSSNALPLPYSMIDVDILLAASPHAMEEISIGR 60

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           +DAP+T+VEYASMTCFHCAEFHNKTFK +EDKYIKTGK+R+I REFPLDSVST A MLAR
Sbjct: 61  QDAPLTIVEYASMTCFHCAEFHNKTFKKIEDKYIKTGKVRFIFREFPLDSVSTAASMLAR 120

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           CAE R+ GGY+GFVS+LF KQ+DWI SKNYR+++ NMAK AGFS+NDFD+CL +Q+ILDD
Sbjct: 121 CAENRVKGGYFGFVSMLFKKQNDWIESKNYRESMFNMAKIAGFSRNDFDSCLGNQSILDD 180

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           IK G K A E   I+STP FFIGGNLYLGDMSE VFSKIIDSMI+
Sbjct: 181 IKTGNKIAVEKLLINSTPSFFIGGNLYLGDMSEEVFSKIIDSMIE 225


>gi|227821137|ref|YP_002825107.1| putative disulfide bond formation protein D [Sinorhizobium fredii
           NGR234]
 gi|227340136|gb|ACP24354.1| putative disulfide bond formation protein D [Sinorhizobium fredii
           NGR234]
          Length = 268

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 133/193 (68%), Gaps = 5/193 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           ELP  +G VD + L+   P  + ++++G+ +APVT+VEY SMTC HCA FHNKTF  ++ 
Sbjct: 81  ELPQSEGSVDVQKLM--EPGALPEMALGEANAPVTIVEYMSMTCPHCANFHNKTFDAIKA 138

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           KYI +GK+R+I+REFP D  +  A MLARCA    +G Y+  VS+LF +Q+ W  ++N R
Sbjct: 139 KYIDSGKVRFIVREFPFDPRAAAAFMLARCAP---EGQYFPMVSMLFKQQEQWAAAENGR 195

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
           DALL M+K AGF++  F+ CL +Q +LDD+ A  +R +++F + STP FF+ G  Y GDM
Sbjct: 196 DALLQMSKLAGFTQESFEACLTNQKLLDDVNAVMQRGAKEFGVKSTPTFFVNGEHYSGDM 255

Query: 214 SEGVFSKIIDSMI 226
           S  V S +IDS +
Sbjct: 256 SVDVLSALIDSKL 268


>gi|150395769|ref|YP_001326236.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419]
 gi|150027284|gb|ABR59401.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419]
          Length = 269

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 131/193 (67%), Gaps = 5/193 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           ELP P+G VD   LL   P  + ++++G+  APVT+VEY SMTC HCA FHN TF  ++ 
Sbjct: 82  ELPTPEGTVDAAKLL--EPGALPEMALGEASAPVTIVEYMSMTCPHCANFHNDTFDAIKT 139

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           KY+ +GK+R+I+REFP D  +  A MLARCA    +G Y+  +S+LF +Q+ W  ++N R
Sbjct: 140 KYVDSGKVRFIVREFPFDPRAAAAFMLARCAP---EGQYFPMISMLFKQQEQWAAAQNGR 196

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
           DALL ++K AGF++  F+ CL +Q +LDD+ A  +R +++F + STP FF+ G  Y GDM
Sbjct: 197 DALLQLSKLAGFTQESFEACLTNQKLLDDVNAVMQRGAKEFGVKSTPTFFVNGEHYSGDM 256

Query: 214 SEGVFSKIIDSMI 226
           S  V S +IDS +
Sbjct: 257 SVDVMSALIDSKL 269


>gi|15888143|ref|NP_353824.1| hypothetical protein Atu0800 [Agrobacterium tumefaciens str. C58]
 gi|15155781|gb|AAK86609.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 226

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/226 (43%), Positives = 143/226 (63%), Gaps = 7/226 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASY--FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           ++ +R  +LGG+ L  IA+   F +T   +   ELP   G VD  A++   P  + + ++
Sbjct: 6   LTISRRSLLGGVALAAIATALPFAFTPGIAEAQELPESTGDVDMAAVM--KPGPLPEAAL 63

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APV +VEY SMTC HCA FHNKTF+ ++ KYI TGK+ ++LREFP D  +  A ML
Sbjct: 64  GDANAPVKIVEYMSMTCPHCANFHNKTFEEIKKKYIDTGKVYFVLREFPFDPRAAAAFML 123

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCA    +G Y+ FVS+LF +Q  W  +++ R ALL M+K AGFS+  F+ CL +Q +L
Sbjct: 124 ARCAP---EGQYFPFVSMLFKQQQSWAVAQDARAALLQMSKMAGFSQESFEACLTNQKLL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           DD+ A  +R + +F ++STP F I G  Y GDMS    S +ID ++
Sbjct: 181 DDVNATMQRGATEFGVNSTPTFIINGKKYAGDMSVETMSAVIDKLL 226


>gi|15964683|ref|NP_385036.1| hypothetical protein SMc00023 [Sinorhizobium meliloti 1021]
 gi|307304261|ref|ZP_07584013.1| DSBA oxidoreductase [Sinorhizobium meliloti BL225C]
 gi|307320566|ref|ZP_07599981.1| DSBA oxidoreductase [Sinorhizobium meliloti AK83]
 gi|15073861|emb|CAC45502.1| Hypothetical protein SMc00023 [Sinorhizobium meliloti 1021]
 gi|306893842|gb|EFN24613.1| DSBA oxidoreductase [Sinorhizobium meliloti AK83]
 gi|306902729|gb|EFN33322.1| DSBA oxidoreductase [Sinorhizobium meliloti BL225C]
          Length = 269

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 131/193 (67%), Gaps = 5/193 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           ELP  +G VD   LL   P  + ++++G+ +APVT+VEY SMTC HCA FHN TF  ++ 
Sbjct: 82  ELPKSEGSVDMAKLL--EPGALPEMALGEANAPVTIVEYMSMTCPHCANFHNDTFDAIKA 139

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           KYI +GK+R+I+REFP D  +  A MLARCA    +G Y+  VS+LF +Q+ W  ++N R
Sbjct: 140 KYIDSGKVRFIVREFPFDPRAAAAFMLARCAP---EGQYFPMVSMLFKQQEQWAAAQNGR 196

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
           DALL ++K AGF++  F+ CL +Q +LDD+ A  +R +++F + STP FF+ G  Y GDM
Sbjct: 197 DALLQLSKLAGFTQESFEACLTNQKLLDDVNAVMQRGAKEFGVKSTPTFFVNGEHYSGDM 256

Query: 214 SEGVFSKIIDSMI 226
           S  V S +IDS +
Sbjct: 257 SVDVMSALIDSKL 269


>gi|325292182|ref|YP_004278046.1| disulfide bond formation protein D [Agrobacterium sp. H13-3]
 gi|325060035|gb|ADY63726.1| putative disulfide bond formation protein D [Agrobacterium sp.
           H13-3]
          Length = 226

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/226 (42%), Positives = 141/226 (62%), Gaps = 7/226 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASY--FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           ++ +R  +LGG+ L  +A+   F +T   +   ELP   G VD  A+L   P  + + ++
Sbjct: 6   LTISRRSLLGGVALAALATALPFAFTPGVAQAQELPESTGDVDMAAVL--KPGPLPEAAL 63

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APV +VEY SMTC HCA FHNKTF  ++ KYI TGK  +++REFP D  +  A ML
Sbjct: 64  GDANAPVKIVEYMSMTCPHCANFHNKTFDEIKKKYIDTGKAYFVIREFPFDPRAAAAFML 123

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCA    +G Y+ FVS+LF +Q  W  +++ R ALL ++K AGFS+  F+ CL +Q +L
Sbjct: 124 ARCAP---EGQYFPFVSMLFKQQQSWATAQDARAALLQLSKMAGFSQESFEACLTNQKLL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           DD+ A  +R + +F ++STP F I G  Y GDMS    S +ID ++
Sbjct: 181 DDVNATMQRGATEFGVNSTPTFIINGKKYAGDMSVETMSAVIDKLL 226


>gi|110633124|ref|YP_673332.1| DSBA oxidoreductase [Mesorhizobium sp. BNC1]
 gi|110284108|gb|ABG62167.1| DSBA oxidoreductase [Chelativorans sp. BNC1]
          Length = 229

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 123/191 (64%), Gaps = 7/191 (3%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
           P P+G VD   LL   P  + + + G  DAPVT+VEYASMTC HCA FH +T+  L++KY
Sbjct: 46  PEPEGSVDMAKLL--EPGALPEQAQGPADAPVTIVEYASMTCPHCAHFHEETYPALKEKY 103

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           + TGK+R+ILREFP D  +    MLARC+E      Y+  + +LF +Q  W   ++ R A
Sbjct: 104 VDTGKVRFILREFPFDPRAEAGFMLARCSE----SNYFPMIDVLFKQQQSWAAVQDARTA 159

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           LLN+AK AGF++  F+ CL +Q +LDD++A + R +E F +DSTP FFI G  Y G +S 
Sbjct: 160 LLNIAKLAGFTQESFEACLTNQKLLDDVRAVRARGAE-FGVDSTPTFFINGKKYPGALSI 218

Query: 216 GVFSKIIDSMI 226
              S IID ++
Sbjct: 219 EQMSAIIDPLL 229


>gi|260460275|ref|ZP_05808527.1| DSBA oxidoreductase [Mesorhizobium opportunistum WSM2075]
 gi|259033920|gb|EEW35179.1| DSBA oxidoreductase [Mesorhizobium opportunistum WSM2075]
          Length = 247

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 122/193 (63%), Gaps = 6/193 (3%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           ++P   G VD   LL   P  + D  +G+ DA VT+VEYASMTC HCA F   TF  L+ 
Sbjct: 61  QVPEAQGTVDMAELL--KPGALPDKQLGKDDAKVTIVEYASMTCPHCAHFAETTFPELKT 118

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           KYI TGK RYILREFP D  +    MLARCA+      Y+  V +LF +Q +W+  +N +
Sbjct: 119 KYIDTGKARYILREFPFDPSAEAGFMLARCAKD----NYFPMVDVLFRQQANWVGVQNTK 174

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
           DALL ++K AGF++  F+ CL DQ +LDD+++ +KR + +F +DSTP FFI G  Y G M
Sbjct: 175 DALLQISKLAGFTQESFEACLTDQKLLDDVRSVQKRGANEFKVDSTPTFFINGKTYKGAM 234

Query: 214 SEGVFSKIIDSMI 226
           S    S IID ++
Sbjct: 235 SIEEISAIIDPLL 247


>gi|163760360|ref|ZP_02167442.1| hypothetical protein HPDFL43_03616 [Hoeflea phototrophica DFL-43]
 gi|162282311|gb|EDQ32600.1| hypothetical protein HPDFL43_03616 [Hoeflea phototrophica DFL-43]
          Length = 251

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/193 (44%), Positives = 126/193 (65%), Gaps = 5/193 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           E P   G VD  A+LA  P  +K++++G ++APVT+VEY SMTC HCA FH   FK L +
Sbjct: 64  EAPQAAGEVDMAAVLAPGP--LKEMALGDENAPVTIVEYMSMTCPHCASFHEDNFKPLVE 121

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           KY+ TGK+R+ILREFP D  +  A+MLARCA +     ++  V ++F +Q  W  +++ R
Sbjct: 122 KYVDTGKVRFILREFPFDPRAAAAIMLARCAPENQ---FFPLVDVMFKQQRSWATAQDGR 178

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
            ALL +A+ AGF++  F+ CL +Q +LDD+ A + +A+ +F + STP F I G  Y G+M
Sbjct: 179 AALLQIARLAGFTQESFEACLTNQKLLDDVNAVRTKAANEFGVQSTPTFIINGKRYPGNM 238

Query: 214 SEGVFSKIIDSMI 226
           S    S IID ++
Sbjct: 239 SVETMSAIIDPLL 251


>gi|86356645|ref|YP_468537.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli CFN
           42]
 gi|86280747|gb|ABC89810.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli CFN
           42]
          Length = 259

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 130/206 (63%), Gaps = 7/206 (3%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
           T   SA  ++P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN
Sbjct: 56  TAATSATTDMPQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHN 113

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA-----EKRMDGGYWGFVSLLF 140
            TF  ++ KY+ TGK+++I+REFP D  +  A MLARC+     +      Y+  VS+LF
Sbjct: 114 TTFDAIKQKYVDTGKVQFIIREFPFDPRAAAAFMLARCSAANPGQLSTPEQYFPMVSMLF 173

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
            +Q  W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++TP
Sbjct: 174 KQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATP 233

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMI 226
            F I G  Y GDM     SK+IDS+I
Sbjct: 234 TFLINGKRYSGDMPVDTMSKLIDSLI 259


>gi|218672535|ref|ZP_03522204.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           GR56]
          Length = 258

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 129/203 (63%), Gaps = 7/203 (3%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            ++  ++P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF
Sbjct: 58  ATSSTDMPQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTF 115

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA-----EKRMDGGYWGFVSLLFNKQ 143
             ++ KYI TGK+++I+REFP D  +  A MLARC+     +      Y+  VS+LF +Q
Sbjct: 116 DTIKQKYIDTGKVQFIIREFPFDPRAAAAFMLARCSAANPGQMSTPEQYFPMVSMLFKQQ 175

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
             W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +D+TP F 
Sbjct: 176 QVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVDATPTFL 235

Query: 204 IGGNLYLGDMSEGVFSKIIDSMI 226
           I G  Y GDM     SK+IDS+I
Sbjct: 236 INGKRYSGDMPVDTMSKLIDSLI 258


>gi|218660625|ref|ZP_03516555.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           IE4771]
          Length = 258

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 127/198 (64%), Gaps = 7/198 (3%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           ++P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF  ++ 
Sbjct: 63  DMPQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTFDTIKQ 120

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARC-----AEKRMDGGYWGFVSLLFNKQDDWIN 148
           KYI TGK+++I+REFP D  +  A MLARC      +      Y+  VS+LF +Q  W  
Sbjct: 121 KYIDTGKVQFIIREFPFDPRAAAAFMLARCNASNPGQLSAPEQYFPMVSMLFKQQQVWAA 180

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           +++ R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +D+TP F I G  
Sbjct: 181 AEDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVDATPTFLINGKR 240

Query: 209 YLGDMSEGVFSKIIDSMI 226
           Y GDM     SK+IDS+I
Sbjct: 241 YSGDMPVDTMSKLIDSLI 258


>gi|13476252|ref|NP_107822.1| hypothetical protein mlr7525 [Mesorhizobium loti MAFF303099]
 gi|14027013|dbj|BAB53967.1| mlr7525 [Mesorhizobium loti MAFF303099]
          Length = 250

 Score =  187 bits (476), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 120/192 (62%), Gaps = 6/192 (3%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
           +P   G VD   LL   P  + D  +G+ DA VT+VEYASMTC HCA F   TF  L+ K
Sbjct: 65  VPESQGTVDMAELL--KPGALPDKQLGKDDAKVTIVEYASMTCPHCAHFAETTFPDLKTK 122

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           YI TGK RYILREFP D  +    MLARCA+      Y+  V +LF +Q +W+   N +D
Sbjct: 123 YIDTGKARYILREFPFDPSAEAGFMLARCAKD----NYFPMVDVLFRQQPNWVGVSNTKD 178

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           ALL ++K AGF++  F+ CL DQ +LDD+++ +KR + +F +DSTP FFI G  Y G MS
Sbjct: 179 ALLQISKLAGFTQESFEACLTDQKLLDDVRSVQKRGANEFKVDSTPTFFINGKTYKGAMS 238

Query: 215 EGVFSKIIDSMI 226
               S IID ++
Sbjct: 239 IEEMSAIIDPLL 250


>gi|319784675|ref|YP_004144151.1| DSBA oxidoreductase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170563|gb|ADV14101.1| DSBA oxidoreductase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 247

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 120/187 (64%), Gaps = 6/187 (3%)

Query: 40  GVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG 99
           G VD   L+   P  + D  +G+ DA VT+VEYASMTC HCA F   TF  L+ KYI TG
Sbjct: 67  GTVDMTELM--KPGALPDKQLGKDDAKVTIVEYASMTCPHCAHFAETTFPDLKTKYIDTG 124

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           K+RYILREFP D  +    MLARCA+      Y+  V +LF +Q +W+  +N +DALL +
Sbjct: 125 KVRYILREFPFDPSAEAGFMLARCAKD----NYYPMVDVLFRQQANWVGVQNTKDALLQI 180

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           +K AGF++  F+ CL DQ +LDD+++ +KR + +F +DSTP FFI G  Y G MS    S
Sbjct: 181 SKLAGFTQESFEACLTDQKLLDDVRSVQKRGANEFKVDSTPTFFINGKTYKGAMSIEEMS 240

Query: 220 KIIDSMI 226
            IID ++
Sbjct: 241 AIIDPLL 247


>gi|222085162|ref|YP_002543692.1| thiol-disulfide oxidoreductase protein [Agrobacterium radiobacter
           K84]
 gi|221722610|gb|ACM25766.1| thiol-disulfide oxidoreductase protein [Agrobacterium radiobacter
           K84]
          Length = 245

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 129/195 (66%), Gaps = 6/195 (3%)

Query: 33  NELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLE 92
           +E+P  DG VD   +L   P ++ ++++G++DAPV +VEY S+TC HCA F   TF  ++
Sbjct: 56  DEIPTADGSVDMNEVL--KPGSLPEIALGKEDAPVKIVEYMSLTCPHCAHFAVTTFDAIK 113

Query: 93  DKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK-N 151
            KYI TGK+R+I+REFP D  +  A MLARCA +     Y   V +LF +Q  W +   +
Sbjct: 114 QKYIDTGKVRFIIREFPFDPRAAAAFMLARCAPQEQ---YMPMVEMLFKQQIAWASPDVD 170

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            R ALL M+K AGF+++ F  CL +Q +LDD+ + ++RA++DF +++TP F I G  Y G
Sbjct: 171 GRAALLQMSKLAGFTEDSFTKCLTNQKLLDDVNSVRERAAKDFGVNATPTFLINGKRYAG 230

Query: 212 DMSEGVFSKIIDSMI 226
           DMS G  SK+IDS++
Sbjct: 231 DMSVGAMSKLIDSLL 245


>gi|241203461|ref|YP_002974557.1| thiol-disulfide oxidoreductase protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857351|gb|ACS55018.1| putative thiol-disulfide oxidoreductase protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 256

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 129/203 (63%), Gaps = 7/203 (3%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            ++  E+P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF
Sbjct: 56  ATSATEMPESDGDVDMAEVL--KPGVLPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTF 113

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG-----GYWGFVSLLFNKQ 143
             ++ KY+ +GK+++I+REFP D  +  A MLARC+    +       Y+  VS+LF +Q
Sbjct: 114 DTIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSMLFKQQ 173

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
             W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++TP F 
Sbjct: 174 QIWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFL 233

Query: 204 IGGNLYLGDMSEGVFSKIIDSMI 226
           I G  Y GDM     SK+IDS++
Sbjct: 234 INGKRYSGDMPVDTLSKLIDSLL 256


>gi|218462075|ref|ZP_03502166.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli Kim
           5]
          Length = 214

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 124/193 (64%), Gaps = 7/193 (3%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF  ++ KYI T
Sbjct: 24  DGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTFDTIKQKYIDT 81

Query: 99  GKLRYILREFPLDSVSTVAVMLARC-----AEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           GK+++I+REFP D  +  A MLARC      +      Y+  VS+LF +Q  W  +++ R
Sbjct: 82  GKVQFIIREFPFDPRAAAAFMLARCNASNPGQLSAPEQYFPMVSMLFKQQQVWAAAEDGR 141

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
            ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +D+TP F I G  Y GDM
Sbjct: 142 AALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVDATPTFLINGKRYSGDM 201

Query: 214 SEGVFSKIIDSMI 226
                SK+IDS+I
Sbjct: 202 PVDTMSKLIDSLI 214


>gi|327191938|gb|EGE58920.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           CNPAF512]
          Length = 256

 Score =  184 bits (468), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 129/203 (63%), Gaps = 7/203 (3%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            ++  ++P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF
Sbjct: 56  ATSSTDMPQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTF 113

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG-----GYWGFVSLLFNKQ 143
             ++ KY+ +GK+++I+REFP D  +  A MLARC+    +       Y+  VS+LF +Q
Sbjct: 114 DAIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSMLFKQQ 173

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
             W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++TP F 
Sbjct: 174 QVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFL 233

Query: 204 IGGNLYLGDMSEGVFSKIIDSMI 226
           I G  Y GDM     SK+IDS+I
Sbjct: 234 INGKRYSGDMPVDTMSKLIDSLI 256


>gi|190890714|ref|YP_001977256.1| thiol-disulfide oxidoreductase [Rhizobium etli CIAT 652]
 gi|190695993|gb|ACE90078.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           CIAT 652]
          Length = 258

 Score =  184 bits (468), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 129/203 (63%), Gaps = 7/203 (3%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            ++  ++P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF
Sbjct: 58  ATSSTDMPQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTF 115

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG-----GYWGFVSLLFNKQ 143
             ++ KY+ +GK+++I+REFP D  +  A MLARC+    +       Y+  VS+LF +Q
Sbjct: 116 DAIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSMLFKQQ 175

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
             W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++TP F 
Sbjct: 176 QVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFL 235

Query: 204 IGGNLYLGDMSEGVFSKIIDSMI 226
           I G  Y GDM     SK+IDS+I
Sbjct: 236 INGKRYSGDMPVDTMSKLIDSLI 258


>gi|209548261|ref|YP_002280178.1| DSBA oxidoreductase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534017|gb|ACI53952.1| DSBA oxidoreductase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 256

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 127/203 (62%), Gaps = 7/203 (3%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            ++  E+P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF
Sbjct: 56  ATSPTEMPQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTF 113

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG-----GYWGFVSLLFNKQ 143
             ++ KY+  GK+++I+REFP D  +  A MLARC+    +       Y+  VS+LF +Q
Sbjct: 114 DAIKQKYVDAGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSMLFKQQ 173

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
             W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++TP F 
Sbjct: 174 QVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFL 233

Query: 204 IGGNLYLGDMSEGVFSKIIDSMI 226
           I G  Y GDM     S +IDS+I
Sbjct: 234 INGKRYSGDMPVETLSALIDSLI 256


>gi|306845124|ref|ZP_07477704.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. BO1]
 gi|306274539|gb|EFM56334.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. BO1]
          Length = 217

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 130/202 (64%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 23  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 78

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 79  LVTFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 135

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +LDD++A  +R S++F +++TP FFI
Sbjct: 136 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLDDVRATVERGSKEFGVNATPTFFI 195

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 196 NGKKYAGDLSFEEMSGFIDSAL 217


>gi|163842778|ref|YP_001627182.1| DSBA oxidoreductase [Brucella suis ATCC 23445]
 gi|163673501|gb|ABY37612.1| DSBA oxidoreductase [Brucella suis ATCC 23445]
          Length = 217

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 130/202 (64%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 23  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCLHCADFK 78

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 79  LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 135

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 136 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 195

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 196 NGKKYAGDLSFEEMSGFIDSAL 217


>gi|116250855|ref|YP_766693.1| disulfide bond formation protein D [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255503|emb|CAK06580.1| putative disulfide bond formation protein D [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 214

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 126/198 (63%), Gaps = 7/198 (3%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           E+P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF  ++ 
Sbjct: 19  EMPESDGDVDMAEVL--KPGVLPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTFDTIKQ 76

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG-----GYWGFVSLLFNKQDDWIN 148
           KY+ +GK+++I+REFP D  +  A MLARC     +       Y+  VS+LF +Q  W  
Sbjct: 77  KYVDSGKVQFIIREFPFDPRAAAAFMLARCNSSNPEQLSTPEQYFPMVSMLFKQQQVWAA 136

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++TP F I G  
Sbjct: 137 ADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFLINGKR 196

Query: 209 YLGDMSEGVFSKIIDSMI 226
           Y GDM     SK+IDS++
Sbjct: 197 YSGDMPVDTLSKLIDSLL 214


>gi|306842221|ref|ZP_07474885.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. BO2]
 gi|306287663|gb|EFM59107.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. BO2]
          Length = 238

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 132/211 (62%), Gaps = 11/211 (5%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A   A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 23  FTRGANAQQH--APEGIVD--ATEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 78

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 79  LVTFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDRYFPMIDLFFKQQQ 135

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +LDD++A  +R S++F +++TP FFI
Sbjct: 136 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLDDVRATVERGSKEFGVNATPTFFI 195

Query: 205 GGNLYLGDMSEGVFSKIIDSMI----QDSTR 231
            G  Y GD+S    S  IDS +    QD  R
Sbjct: 196 NGKKYAGDLSFEEMSGFIDSALCSVFQDEKR 226


>gi|297247890|ref|ZP_06931608.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus bv. 5 str.
           B3196]
 gi|297175059|gb|EFH34406.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus bv. 5 str.
           B3196]
          Length = 220

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 130/202 (64%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 26  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 81

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 82  LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 138

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 139 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 198

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 199 NGKKYAGDLSFEEMSGFIDSAL 220


>gi|237814966|ref|ZP_04593964.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus str. 2308 A]
 gi|237789803|gb|EEP64013.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus str. 2308 A]
          Length = 225

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 130/202 (64%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 31  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 86

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 87  LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 143

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 144 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 203

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 204 NGKKYAGDLSFEEMSGFIDSAL 225


>gi|17987723|ref|NP_540357.1| thiol:disulfide interchange protein DSBA [Brucella melitensis bv. 1
           str. 16M]
 gi|23501397|ref|NP_697524.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella suis 1330]
 gi|62289477|ref|YP_221270.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699402|ref|YP_413976.1| DSBA oxidoreductase [Brucella melitensis biovar Abortus 2308]
 gi|161618469|ref|YP_001592356.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
 gi|189023726|ref|YP_001934494.1| DSBA oxidoreductase [Brucella abortus S19]
 gi|225852032|ref|YP_002732265.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
 gi|254688788|ref|ZP_05152042.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|254693271|ref|ZP_05155099.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|254696918|ref|ZP_05158746.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701299|ref|ZP_05163127.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|254703844|ref|ZP_05165672.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|254707776|ref|ZP_05169604.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|254709639|ref|ZP_05171450.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|254712945|ref|ZP_05174756.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|254716701|ref|ZP_05178512.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|254729820|ref|ZP_05188398.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|256031132|ref|ZP_05444746.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|256044209|ref|ZP_05447116.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060629|ref|ZP_05450795.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|256113024|ref|ZP_05453921.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|256257034|ref|ZP_05462570.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|256368949|ref|YP_003106455.1| twin-arginine translocation signal domain protein [Brucella microti
           CCM 4915]
 gi|260168263|ref|ZP_05755074.1| twin-arginine translocation signal domain protein [Brucella sp.
           F5/99]
 gi|17983441|gb|AAL52621.1| thiol:disulfide interchange protein dsba [Brucella melitensis bv. 1
           str. 16M]
 gi|23347293|gb|AAN29439.1| twin-arginine translocation signal domain protein [Brucella suis
           1330]
 gi|62195609|gb|AAX73909.1| twin-arginine translocation signal domain protein [Brucella abortus
           bv. 1 str. 9-941]
 gi|82615503|emb|CAJ10477.1| DSBA oxidoreductase:Twin-arginine translocation pathway signal
           [Brucella melitensis biovar Abortus 2308]
 gi|161335280|gb|ABX61585.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
 gi|189019298|gb|ACD72020.1| DSBA oxidoreductase [Brucella abortus S19]
 gi|225640397|gb|ACO00311.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
 gi|255999107|gb|ACU47506.1| twin-arginine translocation signal domain protein [Brucella microti
           CCM 4915]
 gi|326408526|gb|ADZ65591.1| DSBA oxidoreductase [Brucella melitensis M28]
 gi|326538243|gb|ADZ86458.1| DSBA oxidoreductase [Brucella melitensis M5-90]
          Length = 217

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 130/202 (64%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 23  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 78

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 79  LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 135

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 136 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 195

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 196 NGKKYAGDLSFEEMSGFIDSAL 217


>gi|225627002|ref|ZP_03785041.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ceti str. Cudo]
 gi|260545771|ref|ZP_05821512.1| DSBA oxidoreductase [Brucella abortus NCTC 8038]
 gi|260563568|ref|ZP_05834054.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|260754275|ref|ZP_05866623.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260757494|ref|ZP_05869842.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260761319|ref|ZP_05873662.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883299|ref|ZP_05894913.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|261213521|ref|ZP_05927802.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|261218507|ref|ZP_05932788.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261317172|ref|ZP_05956369.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261320643|ref|ZP_05959840.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|261324626|ref|ZP_05963823.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|261751841|ref|ZP_05995550.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|261754496|ref|ZP_05998205.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|261757727|ref|ZP_06001436.1| DSBA oxidoreductase [Brucella sp. F5/99]
 gi|265988210|ref|ZP_06100767.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|265990625|ref|ZP_06103182.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994457|ref|ZP_06107014.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|265999581|ref|ZP_05466996.2| DSBA oxidoreductase [Brucella melitensis bv. 2 str. 63/9]
 gi|225618659|gb|EEH15702.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ceti str. Cudo]
 gi|260097178|gb|EEW81053.1| DSBA oxidoreductase [Brucella abortus NCTC 8038]
 gi|260153584|gb|EEW88676.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|260667812|gb|EEX54752.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260671751|gb|EEX58572.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674383|gb|EEX61204.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260872827|gb|EEX79896.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|260915128|gb|EEX81989.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|260923596|gb|EEX90164.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261293333|gb|EEX96829.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|261296395|gb|EEX99891.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261300606|gb|EEY04103.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|261737711|gb|EEY25707.1| DSBA oxidoreductase [Brucella sp. F5/99]
 gi|261741594|gb|EEY29520.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|261744249|gb|EEY32175.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|262765570|gb|EEZ11359.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|263001409|gb|EEZ13984.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094795|gb|EEZ18533.1| DSBA oxidoreductase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660407|gb|EEZ30668.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
          Length = 245

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 130/202 (64%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 51  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 106

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 107 LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 163

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 164 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 223

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 224 NGKKYAGDLSFEEMSGFIDSAL 245


>gi|261315263|ref|ZP_05954460.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|261304289|gb|EEY07786.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
          Length = 245

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 130/202 (64%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 51  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 106

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 107 LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 163

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 164 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 223

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 224 NGKKYAGDLSFEEMSGFIDSAL 245


>gi|260566902|ref|ZP_05837372.1| DSBA oxidoreductase [Brucella suis bv. 4 str. 40]
 gi|260156420|gb|EEW91500.1| DSBA oxidoreductase [Brucella suis bv. 4 str. 40]
          Length = 245

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 130/202 (64%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 51  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 106

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 107 LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 163

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 164 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 223

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 224 NGKKYAGDLSFEEMSGFIDSAL 245


>gi|294851871|ref|ZP_06792544.1| twin-arginine translocation pathway signal protein [Brucella sp.
           NVSL 07-0026]
 gi|294820460|gb|EFG37459.1| twin-arginine translocation pathway signal protein [Brucella sp.
           NVSL 07-0026]
          Length = 217

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 129/202 (63%), Gaps = 7/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA F 
Sbjct: 23  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCANFK 78

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 79  LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQ 135

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 136 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 195

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 196 NGKKYAGDLSFEEMSGFIDSAL 217


>gi|256159208|ref|ZP_05457019.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|256254535|ref|ZP_05460071.1| DSBA oxidoreductase [Brucella ceti B1/94]
          Length = 217

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 125/189 (66%), Gaps = 5/189 (2%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  +++KYI 
Sbjct: 34  PEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPKIKEKYID 91

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q  W  +++ + ALL
Sbjct: 92  TGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQQWATAEDGKAALL 148

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y GD+S   
Sbjct: 149 QIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEE 208

Query: 218 FSKIIDSMI 226
            S  IDS +
Sbjct: 209 MSGFIDSAL 217


>gi|261221714|ref|ZP_05935995.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|265997676|ref|ZP_06110233.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|260920298|gb|EEX86951.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|262552144|gb|EEZ08134.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
          Length = 245

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 125/189 (66%), Gaps = 5/189 (2%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  +++KYI 
Sbjct: 62  PEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPKIKEKYID 119

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q  W  +++ + ALL
Sbjct: 120 TGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFFRQQQQWATAEDGKAALL 176

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y GD+S   
Sbjct: 177 QIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEE 236

Query: 218 FSKIIDSMI 226
            S  IDS +
Sbjct: 237 MSGFIDSAL 245


>gi|153007957|ref|YP_001369172.1| DSBA oxidoreductase [Ochrobactrum anthropi ATCC 49188]
 gi|151559845|gb|ABS13343.1| DSBA oxidoreductase [Ochrobactrum anthropi ATCC 49188]
          Length = 220

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 119/189 (62%), Gaps = 5/189 (2%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P+G VD  A   A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  +++KYI 
Sbjct: 37  PEGTVD--AAKIAEPGKLKDMVYGKADAPVTIVEYASLTCPHCADFTINTFPKIKEKYID 94

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK R I REFP D  +T A MLARCA    +  Y+  V + F +Q  W  +++   ALL
Sbjct: 95  TGKARLIFREFPFDPRATAAFMLARCAP---EDRYFPMVDVFFKQQQQWATAEDGEAALL 151

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +AK AGF++  F  CL +Q +LDD++A  +R S+DF + +TP FFI G  Y G +S   
Sbjct: 152 QIAKLAGFTQESFKACLTNQQVLDDVRATMERGSKDFGVSATPTFFINGQKYAGALSVDE 211

Query: 218 FSKIIDSMI 226
            S IID ++
Sbjct: 212 MSAIIDKLL 220


>gi|254718669|ref|ZP_05180480.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. 83/13]
 gi|306837782|ref|ZP_07470646.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. NF 2653]
 gi|306407123|gb|EFM63338.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. NF 2653]
          Length = 216

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 129/202 (63%), Gaps = 8/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 23  FTRSANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 78

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 79  LVTFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFF-RQQ 134

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +LDD++A  +R S++F ++ TP FFI
Sbjct: 135 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLDDVRATVERGSKEFGVNETPTFFI 194

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 195 NGKKYAGDLSFEEMSGFIDSAL 216


>gi|239831368|ref|ZP_04679697.1| DSBA oxidoreductase [Ochrobactrum intermedium LMG 3301]
 gi|239823635|gb|EEQ95203.1| DSBA oxidoreductase [Ochrobactrum intermedium LMG 3301]
          Length = 225

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 120/189 (63%), Gaps = 5/189 (2%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P+G VD  A   A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  +++KYI 
Sbjct: 42  PEGTVD--AAKIAEPGKLKDMVYGKADAPVTIVEYASLTCPHCADFTINTFPKIKEKYID 99

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK R I REFP D  +T A MLARCA    +  Y+  V + F +Q  W  +++   ALL
Sbjct: 100 TGKARLIFREFPFDPRATAAFMLARCAP---EDRYFPMVDVFFKQQQQWATAEDGEAALL 156

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +AK AGF++  F  CL +Q +LDD++A  +R S+DF +++TP FFI G  Y G +S   
Sbjct: 157 QIAKLAGFTQESFKACLTNQQLLDDVRATMERGSKDFGVNATPTFFINGQKYAGALSVDE 216

Query: 218 FSKIIDSMI 226
            S IID ++
Sbjct: 217 MSAIIDKLL 225


>gi|265983650|ref|ZP_06096385.1| DSBA oxidoreductase [Brucella sp. 83/13]
 gi|264662242|gb|EEZ32503.1| DSBA oxidoreductase [Brucella sp. 83/13]
          Length = 244

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 129/202 (63%), Gaps = 8/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 51  FTRSANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 106

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 107 LVTFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFF-RQQ 162

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +LDD++A  +R S++F ++ TP FFI
Sbjct: 163 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLDDVRATVERGSKEFGVNETPTFFI 222

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 223 NGKKYAGDLSFEEMSGFIDSAL 244


>gi|148560495|ref|YP_001258509.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ovis ATCC 25840]
 gi|148371752|gb|ABQ61731.1| twin-arginine translocation signal domain protein [Brucella ovis
           ATCC 25840]
          Length = 244

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 130/202 (64%), Gaps = 8/202 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           +TR  +A      P+G+VD  A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F 
Sbjct: 51  FTRGANAQQH--APEGIVD--AIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFK 106

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             TF  +++KYI TGK R I R+FP D  +T AVMLARCA    +  Y+  + L F +Q 
Sbjct: 107 LITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAP---EDHYFPMIDLFF-RQQ 162

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  +++ + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI
Sbjct: 163 QWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFI 222

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G  Y GD+S    S  IDS +
Sbjct: 223 NGKKYAGDLSFEEMSGFIDSAL 244


>gi|222147829|ref|YP_002548786.1| hypothetical protein Avi_1093 [Agrobacterium vitis S4]
 gi|221734817|gb|ACM35780.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 227

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 118/198 (59%), Gaps = 7/198 (3%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
           A  E+P PD  VD   ++   P  + D+++G+ DAPV +VEY SMTC HCA FH  TF  
Sbjct: 35  AAAEMPKPDNDVDMAEVM--KPGPLPDMALGKPDAPVKIVEYFSMTCPHCAHFHATTFDT 92

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK+ ++ REFP D  +T A MLARCA K     Y+ F+++   +Q  W    
Sbjct: 93  IKEKYIDTGKVYFVFREFPFDPAATAAFMLARCAPKDQ---YYPFITMFLKQQRSWAAPD 149

Query: 151 N--YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           N   R A+L M+K AGF++  F  CL +  +  D+ A +   ++ F +++TP F I G  
Sbjct: 150 NGDVRGAMLQMSKMAGFTQESFQACLTNTKLAGDVTAMRDLGAKQFGVNATPTFLINGKS 209

Query: 209 YLGDMSEGVFSKIIDSMI 226
           Y GDMS    S +IDS++
Sbjct: 210 YSGDMSVESMSALIDSLL 227


>gi|240139211|ref|YP_002963686.1| hypothetical protein MexAM1_META1p2639 [Methylobacterium extorquens
           AM1]
 gi|240009183|gb|ACS40409.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 208

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 122/215 (56%), Gaps = 13/215 (6%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
           G + LL IAS     +   A N        V  R L  A P  + DV +G  DA VT+VE
Sbjct: 5   GALRLLLIASASATVKPALAQN--------VSARELAEAGP--LGDVVLGSPDARVTIVE 54

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           YAS+TC HCA FH +T+  L+ +YI TGK+R+ILREFPLD ++T   MLARC   +    
Sbjct: 55  YASLTCGHCAAFHRETYPELKRRYIDTGKVRFILREFPLDPLATAGFMLARC---KGHAS 111

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           Y+    LLF+ Q DW  +    D L  + + AGF +  F++CL DQ +   + A ++RA+
Sbjct: 112 YYPVTDLLFDHQKDWAFTAKPLDDLQAILRQAGFQQEKFESCLKDQKLYASVSAVRRRAT 171

Query: 192 EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           E F + STP FFI G  Y G++S     KII  M+
Sbjct: 172 ETFKVSSTPTFFINGQRYAGNLSMEDIEKIIAPML 206


>gi|170747150|ref|YP_001753410.1| DsbA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
 gi|170653672|gb|ACB22727.1| DsbA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
          Length = 214

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 108/176 (61%), Gaps = 3/176 (1%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P  + DV +G  DA  T++EYASMTC HCA FH  T+  L+++YI TGK+R+ LREFPL
Sbjct: 40  QPGPLGDVWLGPADAKCTIIEYASMTCSHCAAFHRNTWPTLKERYIDTGKVRFTLREFPL 99

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D ++T A MLARC   + D  Y+    LLF++Q  W  +    DAL  M + AG++K  F
Sbjct: 100 DPLATAAFMLARC---QGDSKYYPITDLLFDQQAAWAFTPKPVDALEQMLRQAGYNKQTF 156

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + CL DQ I   + A K+R  + F +DSTP FFI G  Y G+M+     K+I  +I
Sbjct: 157 EACLKDQKIYSAVNAVKQRGLDVFKVDSTPTFFINGERYTGEMTVEGMEKVIKPII 212


>gi|328544981|ref|YP_004305090.1| Twin-arginine translocation pathway signal protein [polymorphum
           gilvum SL003B-26A1]
 gi|326414723|gb|ADZ71786.1| Twin-arginine translocation pathway signal protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 212

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/204 (40%), Positives = 123/204 (60%), Gaps = 7/204 (3%)

Query: 25  YTRKGSALNELPIPDGVVDF--RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
           +T  G+AL  +P+      +    L+ A P  + D  +G  DAPVT+VEYASMTC HCA 
Sbjct: 14  FTALGAALATVPLAALAETYGMDKLMEAGP--LGDKILGADDAPVTIVEYASMTCGHCAT 71

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
           FH  T+  L+  Y+ TGK+R+I REFPLD V+T A MLARCA +     Y+  +  LF  
Sbjct: 72  FHKTTYPVLKKDYVDTGKVRFIFREFPLDPVATAAFMLARCAPEE---KYFDIIDALFED 128

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           Q  W  S +  ++LLN AK  GF++  F+ CL +Q++LD + A + RA+ +F ++STP F
Sbjct: 129 QRSWAYSNDPYNSLLNFAKQVGFTQEAFEACLTNQDVLDGVNAVRDRAASEFKVNSTPTF 188

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMI 226
           F+ G    G ++    +++ID  +
Sbjct: 189 FVNGEKKSGALTVEQMAELIDKHL 212


>gi|254472064|ref|ZP_05085465.1| thiol:disulfide interchange protein DsbA [Pseudovibrio sp. JE062]
 gi|211959266|gb|EEA94465.1| thiol:disulfide interchange protein DsbA [Pseudovibrio sp. JE062]
          Length = 213

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/164 (47%), Positives = 105/164 (64%), Gaps = 3/164 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           IG  DAPVT++EYAS+TC HCA FHN T+K L+ KYI TGK+R+I REFPLD+V+    M
Sbjct: 50  IGSPDAPVTIIEYASLTCGHCANFHNTTYKELKKKYIDTGKVRFIFREFPLDTVAAAGFM 109

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           LARCA    +  Y+  ++L+F +Q +W  + +   ALLNM K  GF+++    CL +Q I
Sbjct: 110 LARCAP---EDKYFDIMTLMFEQQRNWAFTNDPYSALLNMGKQIGFTEDAVKACLTNQEI 166

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           LD +   +   SE   +DSTP FFI G    G +S   FSK +D
Sbjct: 167 LDGVTKVRDYGSEKLGVDSTPTFFINGEKVSGALSIEEFSKYVD 210


>gi|254502668|ref|ZP_05114819.1| hypothetical protein SADFL11_2707 [Labrenzia alexandrii DFL-11]
 gi|222438739|gb|EEE45418.1| hypothetical protein SADFL11_2707 [Labrenzia alexandrii DFL-11]
          Length = 198

 Score =  161 bits (407), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 112/173 (64%), Gaps = 3/173 (1%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P  + D  +G ++APVT+VEYASMTC HCA FH +T+  L+  YI+TGK+R+I REFPLD
Sbjct: 27  PGPLGDKILGDENAPVTIVEYASMTCGHCANFHERTWPDLKKDYIETGKVRFIFREFPLD 86

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            V++ A MLARCA +     Y+  V ++F +Q  W  + N   +LL+ +K  GF++  F+
Sbjct: 87  PVASAAFMLARCAPQEK---YFDIVDIMFEEQRAWAFTDNPYQSLLDFSKQIGFTQESFE 143

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            CL +Q +LD + A ++R + +F ++STP FFI G  + G +S     KII+ 
Sbjct: 144 ECLTNQGLLDAVNAVRERGANEFGVNSTPTFFINGEKHSGALSIDEMGKIIEE 196


>gi|118590782|ref|ZP_01548183.1| hypothetical protein SIAM614_06428 [Stappia aggregata IAM 12614]
 gi|118436758|gb|EAV43398.1| hypothetical protein SIAM614_06428 [Stappia aggregata IAM 12614]
          Length = 211

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P  + D  +G ++APVT+VEYASMTC HCA FH +T+  L+  YI TGK+R+I REFPLD
Sbjct: 40  PGPLGDKILGDENAPVTIVEYASMTCGHCANFHKRTYPELKADYIDTGKVRFIFREFPLD 99

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            V+  A MLARCA       Y+  V ++F +Q  W  + N   ++L+ +K  GF+K  F+
Sbjct: 100 PVAAGAFMLARCAPADK---YFEIVDIMFEQQRTWAFTDNPYQSMLDFSKQIGFTKESFE 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            CL +Q +LD I A K R + +F ++STP FFI G  + G +S     K+ID+
Sbjct: 157 ECLGNQGLLDAIDAVKNRGASEFGVNSTPTFFINGEKHSGALSIEEMGKLIDA 209


>gi|90420094|ref|ZP_01228002.1| possible protein disulfide isomerase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335428|gb|EAS49178.1| possible protein disulfide isomerase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 257

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 111/181 (61%), Gaps = 4/181 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           E P   G VD   L+A  P  + DV IG  DAPVT+VEYASMTC HCA+FH  ++  ++ 
Sbjct: 69  EAPESSGSVDVADLMAEGP--LPDVVIGDADAPVTIVEYASMTCSHCADFHENSYPQIKT 126

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
            ++ TGK + I+REFP D  +    MLARC     D      + +LF++QDDW  + N  
Sbjct: 127 DFLDTGKAKLIIREFPFDPRALAGFMLARCTGD--DAKRTAMIDVLFSQQDDWARADNAS 184

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
            ALL +AK AG S+++F +CLND+ + + I   +++   +F +++TP FFI G+ + G +
Sbjct: 185 AALLKIAKLAGMSQDEFTSCLNDKEMQEKIVEIQQKGQNEFGVNATPTFFINGDKFSGAL 244

Query: 214 S 214
           S
Sbjct: 245 S 245


>gi|86748193|ref|YP_484689.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris HaA2]
 gi|86571221|gb|ABD05778.1| Twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris HaA2]
          Length = 224

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 107/176 (60%), Gaps = 1/176 (0%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P ++ D+++G KDA VT+ EYASMTC HCA F+ + F  L+  YI TGK+RY+ REFPLD
Sbjct: 47  PMSLPDMALGPKDAAVTITEYASMTCSHCATFNEEVFPKLKAAYIDTGKVRYVFREFPLD 106

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             +    ML+RC  K     Y+    LLF  Q DW+  K+  + L  + K AG S  D +
Sbjct: 107 IKAAAGSMLSRCIAKDDSAKYFAVTDLLFKTQADWV-MKDTTEQLKRIGKQAGLSAADVE 165

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            CL DQ +LD I A +K A+E   ++STP FF+ G +  G+ S   F+K ID ++Q
Sbjct: 166 ACLKDQALLDKIAADQKYANEVLKVNSTPSFFVNGEMLRGETSLEEFAKRIDPLLQ 221


>gi|115526429|ref|YP_783340.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisA53]
 gi|115520376|gb|ABJ08360.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 223

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 108/178 (60%), Gaps = 1/178 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P  + D++IG+ DAPVT+VEYAS+TC HCA FH K F  ++  YI T K++Y+ REFP
Sbjct: 46  AKPGALPDMAIGKLDAPVTIVEYASLTCGHCAHFHEKVFSKIKTDYIDTNKIKYVFREFP 105

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    ML+RC      G Y+    LLF +Q+DW+  K+    L  + K AG  +  
Sbjct: 106 LDIKAAAGSMLSRCIANGDAGKYFAVTDLLFRQQEDWV-MKDTTATLKRIGKQAGLGEQA 164

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            +TCL DQ +LD I A +K A+E   ++STP FFI G +  GD S   F K I ++++
Sbjct: 165 VETCLKDQALLDKIAADQKYANEVLQVNSTPTFFINGEMLKGDNSFDEFDKRIKALLK 222


>gi|217977767|ref|YP_002361914.1| DSBA oxidoreductase [Methylocella silvestris BL2]
 gi|217503143|gb|ACK50552.1| DSBA oxidoreductase [Methylocella silvestris BL2]
          Length = 229

 Score =  158 bits (400), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 109/177 (61%), Gaps = 3/177 (1%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +P  + D+ +G  DAP+T+VEYASMTC HCA FH  TF  L+ KYI TGK+R+ILREFPL
Sbjct: 55  APGALPDLPLGSADAPITIVEYASMTCSHCAAFHTTTFPVLKSKYIDTGKVRFILREFPL 114

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D ++T   MLARCA    D      V LLF +Q +W  ++   +AL ++ K AG  +  F
Sbjct: 115 DPLATAGFMLARCAG---DDKRNAIVDLLFAQQKNWAFTEKPVEALSSLLKQAGIGQEGF 171

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           + CL +Q + +++   +  AS  F + +TP FFI G    G++S     K+++ +++
Sbjct: 172 EACLKNQELYNNVNKVRDNASAKFNVTATPTFFINGKKESGEISPETLDKLLEPLLK 228


>gi|307941615|ref|ZP_07656970.1| dsba oxidoreductase [Roseibium sp. TrichSKD4]
 gi|307775223|gb|EFO34429.1| dsba oxidoreductase [Roseibium sp. TrichSKD4]
          Length = 212

 Score =  158 bits (400), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 113/185 (61%), Gaps = 5/185 (2%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           VD   LL  +P  + D  +G +DAPVT+VEYASMTC HCA FH +T+  L+ +YI+TGK+
Sbjct: 33  VDIDELL--TPGPLGDKVLGSEDAPVTIVEYASMTCGHCANFHKRTYPELKKQYIETGKV 90

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
           ++I REFPLD V+  A MLAR A       Y+  +  +F  Q  W  S N   +LLN +K
Sbjct: 91  KFIFREFPLDPVAAAAFMLARSAPA---DKYFDIIDTMFENQSTWAFSDNPYSSLLNFSK 147

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
             GF++  F+  L +Q +LD I A ++R S +F + STP FF+ G  + G +     S++
Sbjct: 148 QIGFTQESFEEALKNQKLLDAINAVRERGSNEFKVGSTPTFFVNGEKHAGALPFDQMSEL 207

Query: 222 IDSMI 226
           ID+ +
Sbjct: 208 IDAEL 212


>gi|298294359|ref|YP_003696298.1| DSBA oxidoreductase [Starkeya novella DSM 506]
 gi|296930870|gb|ADH91679.1| DSBA oxidoreductase [Starkeya novella DSM 506]
          Length = 221

 Score =  157 bits (398), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 99/161 (61%), Gaps = 4/161 (2%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
            + D  +G+ DAPVT+VEYAS+TC HCA FH  T+  L+ KYI TGK+R+ILREFPLD V
Sbjct: 50  ALPDQVLGKADAPVTIVEYASLTCSHCAHFHETTYPVLKSKYIDTGKVRFILREFPLDIV 109

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           +  A MLARCA    DG Y+     LF  Q +W  S+N   AL+ +AK  G S+  F+ C
Sbjct: 110 AKAAFMLARCAG---DGKYYPMTDTLFETQKNWAYSQNPAQALMAIAKQGGMSEQQFNAC 166

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           LND  +   I    KR SE   +D+TP FFI G    G +S
Sbjct: 167 LNDAKLAGQIDEVAKRGSE-LGVDATPTFFINGKKVSGALS 206


>gi|146339048|ref|YP_001204096.1| hypothetical protein BRADO2001 [Bradyrhizobium sp. ORS278]
 gi|146191854|emb|CAL75859.1| conserved hypothetical protein; putative signal peptide;
           twin-arginine translocation signal domain protein
           [Bradyrhizobium sp. ORS278]
          Length = 226

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/178 (43%), Positives = 105/178 (58%), Gaps = 1/178 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P ++ D++IG  DA VT+ EYASMTC HCA F+   F  L+ +YI TGK+RYI REFP
Sbjct: 49  AKPQSLPDMAIGPTDAAVTITEYASMTCPHCAAFNATVFPKLKAEYIDTGKVRYIFREFP 108

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    ML RC  K     Y+    +LF  Q+DW+  KN  + L  + K AG S+  
Sbjct: 109 LDIKAAAGSMLTRCIAKDDAQKYFAVTDMLFRSQNDWV-VKNTTETLTRIGKQAGLSQQQ 167

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + CL DQ +LD I A +K AS+   +DSTP FFI G    G+ S   F K I+ +++
Sbjct: 168 VEACLKDQALLDKIAADQKYASDVLKVDSTPTFFINGEKIKGESSIEEFQKRINPLLK 225


>gi|182677739|ref|YP_001831885.1| DSBA oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633622|gb|ACB94396.1| DSBA oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 225

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 111/179 (62%), Gaps = 7/179 (3%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +P  + D+++G + AP+T+VEYASMTC HCA FH +T+  L+ KYI TGK+R+ILREFPL
Sbjct: 51  APQALPDIALGSEQAPITIVEYASMTCSHCAAFHAETYPVLKSKYIDTGKVRFILREFPL 110

Query: 111 DSVSTVAVMLARCA--EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           D ++T   MLARCA  +KR        V LLF +Q +W       +AL  + K  G  ++
Sbjct: 111 DPLATAGFMLARCAGPDKR-----EAMVDLLFAQQKNWAFVDKPLEALAALVKQTGIGQD 165

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            F+ CL DQ++ D +   + +A+E F +++TP FFI G    G++S      ++  +++
Sbjct: 166 RFEACLKDQDLFDKVNKVRDQAAEKFNVNATPTFFINGKKQNGEISPDALDALLQPLLK 224


>gi|158422082|ref|YP_001523374.1| putative twin-arginine translocation pathway signal protein
           [Azorhizobium caulinodans ORS 571]
 gi|158328971|dbj|BAF86456.1| putative twin-arginine translocation pathway signal protein
           [Azorhizobium caulinodans ORS 571]
          Length = 243

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 107/179 (59%), Gaps = 5/179 (2%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           AASP  +K  ++G   APVT++EYASMTC HCA F  +TF  L+ KY+ TGK+ YILREF
Sbjct: 68  AASPLPVK--ALGNPKAPVTIIEYASMTCSHCAAFATQTFPTLKTKYVDTGKVYYILREF 125

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           P D VST A MLARC     D  Y+  V  LF  Q  W    N    LL +AK AG S+ 
Sbjct: 126 PFDPVSTAAFMLARCVP---DDKYFPMVETLFETQRSWAFGNNPAAGLLTVAKQAGMSEA 182

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           DF+ CL D+++ + ++A  +  +++  +DSTP FFI G    G +S     K +  ++Q
Sbjct: 183 DFEKCLTDKDLAEKVQASAQYGNKELGVDSTPTFFINGKKIAGAISIADLDKELAPLLQ 241


>gi|188582613|ref|YP_001926058.1| DsbA oxidoreductase [Methylobacterium populi BJ001]
 gi|179346111|gb|ACB81523.1| DsbA oxidoreductase [Methylobacterium populi BJ001]
          Length = 217

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 105/179 (58%), Gaps = 6/179 (3%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P  + DV +G  DA VT++EYASMTC HCA FH  T+  L+++YI TGK+R+ LREFPL
Sbjct: 40  QPGPLGDVWLGPADAKVTIIEYASMTCSHCAHFHATTWPVLKERYIDTGKVRFTLREFPL 99

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI---NSKNYRDALLNMAKFAGFSK 167
           D ++T A MLARC     D  Y+    LLF++Q +W      ++  DAL  + + AGFSK
Sbjct: 100 DPLATAAFMLARC---DGDAKYYPITDLLFDQQPNWAFVRKPQSPVDALEQLLRQAGFSK 156

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             F+ CL DQ     I A K R  E   ++STP FFI G    G +S     KII  ++
Sbjct: 157 EKFEACLKDQKTYAAINAVKTRGLETLKVESTPTFFINGEKRAGALSIEEMEKIIKPIL 215


>gi|323136739|ref|ZP_08071820.1| DSBA oxidoreductase [Methylocystis sp. ATCC 49242]
 gi|322398056|gb|EFY00577.1| DSBA oxidoreductase [Methylocystis sp. ATCC 49242]
          Length = 274

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 107/171 (62%), Gaps = 4/171 (2%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P+ + DV  G  DAPVT+VEYASMTC HCA FH++ +  L+  YI TGK+++ILREFPLD
Sbjct: 100 PNALPDVVEGGADAPVTIVEYASMTCSHCAAFHHEVYPALKKNYIDTGKVKFILREFPLD 159

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            ++T A MLAR    + D      V LLF++Q +W  +    D L N+ K AG  +  F+
Sbjct: 160 PLATAAFMLARELGDKRDAA----VDLLFSQQKNWAFTDKPLDGLANVLKQAGLGQEKFE 215

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
             L DQ + + +   ++R SE F ++STP FF+ G+ Y G++S   F KII
Sbjct: 216 AILKDQALYEKVNKVRERGSEKFGVNSTPTFFVNGDKYTGEISVADFDKII 266


>gi|49475253|ref|YP_033294.1| hypothetical protein BH04560 [Bartonella henselae str. Houston-1]
 gi|49238058|emb|CAF27265.1| hypothetical protein BH04560 [Bartonella henselae str. Houston-1]
          Length = 218

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 115/191 (60%), Gaps = 6/191 (3%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P   VD   LL +  +  KD   G+++APVT+VEYAS+TC HCA F+N     +  KYIK
Sbjct: 34  PVSTVDMAELLKSGKA--KDRFEGEENAPVTIVEYASLTCVHCAHFYNDVLPQIRKKYIK 91

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK++ I R+F  DS +T   MLARCA    +  Y+  + +LF KQ +W+ +++    L 
Sbjct: 92  TGKVKLIFRDFAFDSRATAGFMLARCAP---EDRYFPLIEVLFQKQSEWVWARDAVTPLK 148

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +   AGF+   F+ CL +Q+ILD++ A  +R  E   +++TP FFI GN Y G MS   
Sbjct: 149 KIGLMAGFTDESFNACLKNQSILDEVNASFERGKE-LGVNATPTFFINGNKYEGAMSVEA 207

Query: 218 FSKIIDSMIQD 228
           F  +IDS +++
Sbjct: 208 FFSVIDSFLKN 218


>gi|296447825|ref|ZP_06889738.1| DSBA oxidoreductase [Methylosinus trichosporium OB3b]
 gi|296254684|gb|EFH01798.1| DSBA oxidoreductase [Methylosinus trichosporium OB3b]
          Length = 218

 Score =  154 bits (390), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 108/172 (62%), Gaps = 4/172 (2%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +P+ + DV  G+ DAPVT+VEYASMTC HCA FH + +  L+  YI +GK+++ILREFPL
Sbjct: 45  APNALPDVVEGKADAPVTIVEYASMTCSHCAAFHREVYPALKKNYIDSGKVKFILREFPL 104

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D ++T A MLAR A ++ D      V LLF +Q +W   +   D L  + KF G  +  F
Sbjct: 105 DPLATAAFMLARNAGEKRD----AVVDLLFAQQKNWAFVEKPLDGLAGVLKFTGVGQQAF 160

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           +  L D+ + +++   + RA+E F I+STP FFI G  + G++S   F KII
Sbjct: 161 EATLKDEALYENVNKVRDRAAEKFGINSTPTFFINGERFSGEISIADFDKII 212


>gi|27377608|ref|NP_769137.1| hypothetical protein bll2497 [Bradyrhizobium japonicum USDA 110]
 gi|27350753|dbj|BAC47762.1| bll2497 [Bradyrhizobium japonicum USDA 110]
          Length = 232

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 109/178 (61%), Gaps = 1/178 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P ++ D+++G KDA VT+ E+ASMTC HCA F+ + F  ++ +YI TGK+RY+ REFP
Sbjct: 55  AKPVSLPDMALGPKDAAVTITEFASMTCPHCAAFNEQVFPKIKAEYIDTGKIRYVFREFP 114

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    ML+RC        Y+    +LF +Q+DW+  KN  + L  + K AG ++  
Sbjct: 115 LDIKAAAGSMLSRCIANGDAPKYFAVTDMLFRQQNDWV-MKNTTETLTRIGKQAGLTQQQ 173

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + CL DQ +LD I A +K AS+   +DSTP FFI G    G+ S   F+K I+ +++
Sbjct: 174 VEACLKDQALLDKIAADQKYASDVLKVDSTPTFFINGEKIKGEASFEEFAKKINPLLK 231


>gi|90425844|ref|YP_534214.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB18]
 gi|90107858|gb|ABD89895.1| Twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB18]
          Length = 233

 Score =  154 bits (389), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 108/178 (60%), Gaps = 1/178 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P  + D+++G  +APVT++EYASMTC HCA F+   F  L+ +YI T K++Y+ REFP
Sbjct: 56  AKPGALPDMALGAPNAPVTIIEYASMTCSHCANFNETVFPKLKAEYIDTSKVKYVFREFP 115

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    MLARC  K   G Y+    +LF +Q DW+  KN  + L  + K AG S + 
Sbjct: 116 LDIKAAAGSMLARCIAKDDAGKYFAVNDMLFKQQTDWV-LKNTTETLKRIGKQAGLSGDA 174

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + CL DQ +LD I A +K A+E   ++STP FFI G +  G+ S   F K I ++++
Sbjct: 175 VEACLKDQALLDKIAADQKFANEVLKVNSTPTFFINGEMLRGEASFEEFGKKIKALLK 232


>gi|254562351|ref|YP_003069446.1| hypothetical protein METDI3965 [Methylobacterium extorquens DM4]
 gi|254269629|emb|CAX25600.1| putative protein disulfide isomerase, putative protein precursor
           (tat pathway signal) [Methylobacterium extorquens DM4]
          Length = 217

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 106/181 (58%), Gaps = 10/181 (5%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P  + DV +G  DA VT++EYASMTC HCA FH  T+  L+++YI TGK+R+ LREFPL
Sbjct: 40  QPGPLGDVWLGPADAKVTIIEYASMTCSHCAHFHATTWPVLKERYIDTGKVRFTLREFPL 99

Query: 111 DSVSTVAVMLARCAEKRMDG--GYWGFVSLLFNKQDDWI---NSKNYRDALLNMAKFAGF 165
           D ++T A MLARC     DG   Y+    LLF++Q +W      ++  DAL  + + AGF
Sbjct: 100 DPLATAAFMLARC-----DGESKYYPITDLLFDQQQNWAFVRKPQSPVDALEQLLRQAGF 154

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           SK  F+ CL DQ     I A K R  +   ++STP FFI G    G +S     KII  +
Sbjct: 155 SKEKFEACLKDQKTYAAINAVKTRGLDTLKVESTPTFFINGEKRAGALSIEEMEKIIKPI 214

Query: 226 I 226
           +
Sbjct: 215 L 215


>gi|163852592|ref|YP_001640635.1| DsbA oxidoreductase [Methylobacterium extorquens PA1]
 gi|218531433|ref|YP_002422249.1| DsbA oxidoreductase [Methylobacterium chloromethanicum CM4]
 gi|240139927|ref|YP_002964404.1| putative protein disulfide isomerase, putative protein precursor
           (tat pathway signal) [Methylobacterium extorquens AM1]
 gi|163664197|gb|ABY31564.1| DsbA oxidoreductase [Methylobacterium extorquens PA1]
 gi|218523736|gb|ACK84321.1| DsbA oxidoreductase [Methylobacterium chloromethanicum CM4]
 gi|240009901|gb|ACS41127.1| putative protein disulfide isomerase, putative protein precursor
           (tat pathway signal) [Methylobacterium extorquens AM1]
          Length = 217

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 105/179 (58%), Gaps = 6/179 (3%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P  + DV +G  DA VT++EYASMTC HCA FH  T+  L+++YI TGK+R+ LREFPL
Sbjct: 40  QPGPLGDVWLGPADAKVTIIEYASMTCSHCAHFHATTWPVLKERYIDTGKVRFTLREFPL 99

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI---NSKNYRDALLNMAKFAGFSK 167
           D ++T A MLARC     +  Y+    LLF++Q +W      ++  DAL  + + AGFSK
Sbjct: 100 DPLATAAFMLARC---DGEAKYYPITDLLFDQQQNWAFVRKPQSPVDALEQLLRQAGFSK 156

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             F+ CL DQ     I A K R  +   ++STP FFI G    G +S     KII  ++
Sbjct: 157 EKFEACLKDQKTYAAINAVKTRGLDTLKVESTPTFFINGEKRAGALSIEEMEKIIKPIL 215


>gi|148253813|ref|YP_001238398.1| twin-arginine translocation signal domain-containing protein
           [Bradyrhizobium sp. BTAi1]
 gi|146405986|gb|ABQ34492.1| putative exported protein of unknown function with twin-arginine
           translocation signal domain [Bradyrhizobium sp. BTAi1]
          Length = 218

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 104/178 (58%), Gaps = 1/178 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P ++ D+++G  DA VT+ EYASMTC HCA F+   F  L+ +YI TGK+RYI REFP
Sbjct: 41  AKPQSLPDMALGPADAAVTITEYASMTCPHCAAFNATVFPKLKAEYIDTGKVRYIFREFP 100

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    ML RC        Y+    +LF  Q+DW+  KN  + L  + K AG S+  
Sbjct: 101 LDIKAAAGSMLTRCIANGDAQKYFAVTDMLFRSQNDWV-VKNTTETLTRIGKQAGLSQQQ 159

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + CL DQ +LD I A +K AS+   +DSTP FFI G    G+ S   F K I+ +++
Sbjct: 160 VEACLKDQALLDKIAADQKYASDILKVDSTPTFFINGEKIKGESSIEEFQKRINPLLK 217


>gi|92118695|ref|YP_578424.1| twin-arginine translocation pathway signal [Nitrobacter
           hamburgensis X14]
 gi|91801589|gb|ABE63964.1| Twin-arginine translocation pathway signal [Nitrobacter
           hamburgensis X14]
          Length = 220

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 107/178 (60%), Gaps = 1/178 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P ++ D+++G KDA VT+ EYASMTC HCA F    F  ++  YI T K+RY+ REFP
Sbjct: 43  AKPVSLPDMALGPKDAAVTITEYASMTCPHCARFAEDVFPKIKAAYIDTNKIRYVFREFP 102

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    MLARC  K   G Y+  ++ LF  QD+W   K   ++L  + K AG S  +
Sbjct: 103 LDLKAAAGSMLARCIAKDDAGKYFAIINALFKSQDEWAGPKT-TESLKLIGKQAGLSGPE 161

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            +TCL DQ +LD I A +K A+E   ++STP FFI G +  G++S     K ID +++
Sbjct: 162 VETCLKDQALLDKIAADQKYANEVLKVNSTPTFFINGEMVKGEVSFEDLKKKIDPLLK 219


>gi|154245118|ref|YP_001416076.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
 gi|154159203|gb|ABS66419.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
          Length = 270

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 110/191 (57%), Gaps = 3/191 (1%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
           P     V+   L+A + S + + +IG   APVT+VEYAS TC HCA FH  TF  L+ KY
Sbjct: 80  PAAAQTVEQAKLMAPAASPLPEKAIGSATAPVTVVEYASATCSHCAAFHTTTFPELKTKY 139

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           I TGK+R+I REFP + V+T A MLARC     D  Y+  VS LF  Q  W  S++    
Sbjct: 140 IDTGKVRFIFREFPFEPVATAAFMLARCMP---DDKYFPMVSTLFETQKAWAYSQDPAAG 196

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           LL +AK AG S+ DF+ CL DQ + + ++     A+++  +++TP FFI G    G +  
Sbjct: 197 LLAVAKQAGMSQADFEKCLTDQTLGEKVQESALYANKELGVNATPTFFINGKKISGALGI 256

Query: 216 GVFSKIIDSMI 226
             + K +  ++
Sbjct: 257 AEWDKELAPLL 267


>gi|46204118|ref|ZP_00209268.1| COG1651: Protein-disulfide isomerase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 166

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (62%), Gaps = 3/160 (1%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+VEYAS+TC HCA FH +T+  L+ +YI TGK+R+ILREFPLD ++T   MLARC   
Sbjct: 8   VTIVEYASLTCGHCAAFHRETYPELKRRYIDTGKVRFILREFPLDPLATAGFMLARC--- 64

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
           +    Y+    LLF+ Q DW  +    D L  + + AGF +  F++CL DQ +   + A 
Sbjct: 65  KGHASYYPVTDLLFDHQKDWAFTAKPLDDLQAILRQAGFQQEKFESCLKDQKLYASVSAV 124

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           ++RA+E F + STP FFI G  Y G++S     KII  M+
Sbjct: 125 RRRATETFKVSSTPTFFINGQRYAGNLSMEDIEKIIAPML 164


>gi|154251156|ref|YP_001411980.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
 gi|154155106|gb|ABS62323.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
          Length = 243

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 126/226 (55%), Gaps = 7/226 (3%)

Query: 3   MSTTRIGVLGGIVLLFIA-SYFFYTRKGSALNELPIPDGVVDF-RALLAASPSTMKDVSI 60
           M+  R  ++G   ++ IA +Y  Y   GS+    P   G   F + LL A P  + D+++
Sbjct: 1   MNQNRAIIIGFAAVVLIALAYGAYLFFGSSNGATPGRAGGSAFEQELLVAGP--LGDMTL 58

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPVT+++YAS+TC HCA F   T   L++KYI+TGK+ YILR+FP D V+T   ML
Sbjct: 59  GDPDAPVTVIDYASLTCSHCAAFEINTLPQLKEKYIETGKVHYILRDFPFDPVATAGFML 118

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A CA       Y+GFV +LF +Q  W  ++   + L  +A+  G S+  FD C+ D+ + 
Sbjct: 119 AHCAGPER---YFGFVGVLFRQQAQWAFTQTPMEDLKALARQGGISEERFDACMKDEKVF 175

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + +K    R ++ F + STP FFI G    G +    F  +I+  +
Sbjct: 176 NHVKEVATRGAKTFGVRSTPTFFINGEKIEGALPWREFEPLIEKAL 221


>gi|300024387|ref|YP_003756998.1| DSBA oxidoreductase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526208|gb|ADJ24677.1| DSBA oxidoreductase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 233

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 109/178 (61%), Gaps = 8/178 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           PS + D+++G  DA VT+VEYASMTC HCA F    F+  + KYI TGK+R++ REFPLD
Sbjct: 58  PSDLADLTLGPADAKVTVVEYASMTCPHCAHFETDVFENFKKKYIDTGKVRFVYREFPLD 117

Query: 112 SVSTVAVMLARCAEKRMDGG--YWGFVSLLFNKQDDWINSK-NYRDALLNMAKFAGFSKN 168
           +++    MLARCA     GG   +  +   + KQ +W  ++ N    L ++AK AGF++ 
Sbjct: 118 NLAAAVSMLARCA-----GGDKTFPLIQTFYAKQAEWAFTQGNPVPKLFDIAKQAGFTQE 172

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            FD CL DQ +LD I A + RAS+ F +++TP FFI G       +   F K+I+ ++
Sbjct: 173 SFDKCLTDQKLLDQITAQRTRASDTFGVNATPTFFINGKKLPETPTLEAFDKVIEPLL 230


>gi|39937547|ref|NP_949823.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris CGA009]
 gi|192293339|ref|YP_001993944.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
 gi|39651406|emb|CAE29928.1| DSBA oxidoreductase:Tat pathway signal [Rhodopseudomonas palustris
           CGA009]
 gi|192287088|gb|ACF03469.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
          Length = 224

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 108/177 (61%), Gaps = 1/177 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P ++ D+++G KDA VT+ EYAS+TC HCA F+ + +  ++  YI TGK+RY+ REFP
Sbjct: 45  AKPMSLPDMALGPKDATVTITEYASLTCSHCAAFNEQVYPQIKKAYIDTGKIRYVFREFP 104

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    ML+RC  K     Y+    +LF  Q +W+  K+  + L  + K AG S  +
Sbjct: 105 LDIKAAAGSMLSRCIAKDDSAKYFAVTDVLFRSQTEWV-LKDTTEQLKRIGKQAGLSGEE 163

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            + CL DQ +LD I A +K A+E   +++TP FFI G +  G+ S   F+K ID+++
Sbjct: 164 VEACLKDQKLLDKIAADQKYANEVLKVNATPTFFINGEMLRGENSFDEFAKRIDALL 220


>gi|319408233|emb|CBI81886.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 204

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 81/189 (42%), Positives = 110/189 (58%), Gaps = 8/189 (4%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P   VD   LL       KD   G  +APVT+VEYAS+TC HCA+F+N     +  KYIK
Sbjct: 24  PVATVDMVKLLQDG----KDRVEGDINAPVTIVEYASVTCGHCADFYNNVLPKIRKKYIK 79

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK++ I REF  D  +T   MLARCA    +  Y+  + +LF KQ +W+  ++    L 
Sbjct: 80  TGKVKLIFREFAFDPRATAGFMLARCAP---EDRYFPLIEVLFQKQSEWVWVEDSLTPLK 136

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            ++  AGF+   F+ CL +Q+ILD++ A  +R  E F + +TP FFI GN Y G MSE  
Sbjct: 137 KISSLAGFTDESFEACLKNQSILDEVNASFERGKE-FGVTATPTFFINGNKYEGLMSEED 195

Query: 218 FSKIIDSMI 226
           F  IIDS +
Sbjct: 196 FFSIIDSFL 204


>gi|316935987|ref|YP_004110969.1| DSBA oxidoreductase [Rhodopseudomonas palustris DX-1]
 gi|315603701|gb|ADU46236.1| DSBA oxidoreductase [Rhodopseudomonas palustris DX-1]
          Length = 224

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 107/177 (60%), Gaps = 1/177 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P ++ D+++G KDA VT+ EYAS+TC HCA F  + F  L+  YI TGK+R++ REFP
Sbjct: 45  AKPMSLPDMALGPKDAAVTVTEYASLTCSHCATFDQQVFPQLKKAYIDTGKVRWVFREFP 104

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    ML+RC  K     Y+    +LF  Q +W+  K+  + L  + K AG S  +
Sbjct: 105 LDIKAAAGSMLSRCIAKDDSAKYFAVTDVLFKSQTEWV-LKDTTEQLKRIGKQAGLSGEE 163

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            + CL DQ +LD I A +K A+E   +++TP FFI G +  G+ S   F+K ID+++
Sbjct: 164 VEACLKDQALLDKIAADQKYANEVLKVNATPTFFINGEMLRGENSFEEFAKRIDALL 220


>gi|75676791|ref|YP_319212.1| protein-disulfide isomerase [Nitrobacter winogradskyi Nb-255]
 gi|74421661|gb|ABA05860.1| Protein-disulfide isomerase [Nitrobacter winogradskyi Nb-255]
          Length = 220

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 107/178 (60%), Gaps = 1/178 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P ++ D+++G KDA VT+ EYASMTC HCA F    F  ++ +YI T K+RY+ REFP
Sbjct: 43  AKPVSLPDMALGPKDAAVTITEYASMTCPHCARFAEDVFPKIKTEYIDTNKIRYVFREFP 102

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    MLARC  K   G Y+  +  LF  QD W  SK   ++L  + K  G ++ +
Sbjct: 103 LDIKAAAGAMLARCIAKDDAGKYFAVIDTLFKSQDTWTGSKT-TESLKLIGKQTGLTEGE 161

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + CL DQ +LD I A +K A+E   ++STP FFI G++  G+++   F   ID +++
Sbjct: 162 VENCLKDQALLDKIAADQKYANEVLKVNSTPSFFINGDMVKGEIAFEDFKNKIDPLLK 219


>gi|91975677|ref|YP_568336.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB5]
 gi|91682133|gb|ABE38435.1| Twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB5]
          Length = 222

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 105/176 (59%), Gaps = 1/176 (0%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P ++ D++IG KDA VT+ EYAS+TC HCA F+ + F  L+  YI  GK+RY+ REFPLD
Sbjct: 47  PMSLPDMAIGPKDAAVTITEYASLTCSHCATFNEQVFPKLKAAYIDPGKVRYVFREFPLD 106

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             +    ML RC  K     Y+    LLF  Q DW+  K+  + L  + K AG S  + +
Sbjct: 107 IKAAAGSMLTRCIAKDDAQKYFAVTDLLFKSQVDWV-LKDTTEQLKRIGKQAGLSGAEVE 165

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            CL DQ +LD I A +K A+E   ++STP FFI G +  G+ S   F+K ID +++
Sbjct: 166 ACLKDQALLDKIAADQKYANEVLKVNSTPSFFINGEMLKGETSLEEFAKRIDPLLK 221


>gi|85714258|ref|ZP_01045246.1| Protein-disulfide isomerase [Nitrobacter sp. Nb-311A]
 gi|85698705|gb|EAQ36574.1| Protein-disulfide isomerase [Nitrobacter sp. Nb-311A]
          Length = 220

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 105/178 (58%), Gaps = 1/178 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P ++ D+++G KDA VT+ EYASMTC HCA F    F  ++ +YI T K+RY+ REFP
Sbjct: 43  AKPVSLPDMALGPKDAAVTITEYASMTCPHCARFAEDVFPKIKAEYIDTHKIRYVFREFP 102

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD  +    MLARC  K     Y+  +  LF  QD W  SK   ++L  + K  G + ++
Sbjct: 103 LDLKAAAGAMLARCIAKDDGAKYFAVIDTLFRSQDTWTGSKT-TESLKLIGKQTGLTGDE 161

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            ++CL DQ +LD I A +K A+E   ++STP FFI G +  G+ S     K ID +++
Sbjct: 162 VESCLKDQALLDKIAADQKYANEVLKVNSTPTFFINGEMVKGETSFEELKKKIDPLLK 219


>gi|121602418|ref|YP_988736.1| DSBA-like thioredoxin domain-containing protein [Bartonella
           bacilliformis KC583]
 gi|120614595|gb|ABM45196.1| DSBA-like thioredoxin domain protein [Bartonella bacilliformis
           KC583]
          Length = 216

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 109/189 (57%), Gaps = 6/189 (3%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P  +VD   LL +    +KD   G  +APVT++EYAS+TC HCA+F+N     +  KYIK
Sbjct: 34  PVAIVDMAKLLQSG--KVKDRFEGDINAPVTIIEYASLTCAHCADFYNTVLPKIRKKYIK 91

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK++ I R+F  D  +T   MLARCA    +  Y+  + +LF KQ DW   ++    L 
Sbjct: 92  TGKVKLIFRDFAYDPRATAGFMLARCAP---EDRYFPLIEVLFEKQKDWAWVQDALTPLR 148

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +   AGF+   FD+CL +Q+ILD++ A  +R  E   + +TP FFI G+ Y G M    
Sbjct: 149 KIGAMAGFTNESFDSCLQNQSILDEVNASTERGKE-LGVTATPTFFINGHQYNGGMPTEN 207

Query: 218 FSKIIDSMI 226
           F  IIDS +
Sbjct: 208 FFSIIDSFL 216


>gi|299134657|ref|ZP_07027849.1| DSBA oxidoreductase [Afipia sp. 1NLS2]
 gi|298590467|gb|EFI50670.1| DSBA oxidoreductase [Afipia sp. 1NLS2]
          Length = 217

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 111/179 (62%), Gaps = 3/179 (1%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A PST+ D+++G KDAPVT++EYASMTC HCA F  + F  L+  YI TGK+++I REFP
Sbjct: 40  AKPSTLGDMALGSKDAPVTIIEYASMTCPHCAAFEKEVFPQLKSAYIDTGKVKFIFREFP 99

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD V+  A  LARC  K     Y+  +S+LFN+Q D + ++ + + +  + K AGFS+  
Sbjct: 100 LDQVALAASALARCVAKDDSNKYFAIISILFNQQAD-LQTQAF-ETINRVGKQAGFSEAM 157

Query: 170 FDTCLNDQ-NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              C+ D   +   I A ++ A++   IDSTP FFI G L  G+ S   F  +ID +++
Sbjct: 158 IKACVQDDLTVQKGILADREYANKTLKIDSTPSFFINGKLVKGETSFDSFKGMIDPLLK 216


>gi|220927385|ref|YP_002502687.1| DsbA oxidoreductase [Methylobacterium nodulans ORS 2060]
 gi|219951992|gb|ACL62384.1| DsbA oxidoreductase [Methylobacterium nodulans ORS 2060]
          Length = 214

 Score =  147 bits (372), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 102/176 (57%), Gaps = 3/176 (1%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P  + DV +G  DA  T++EYASMTC HCA FH  T+  L++++I T K+R+ LREFPL
Sbjct: 40  QPGPLGDVWLGPADAKCTIIEYASMTCSHCAAFHKTTWPALKERWIDTNKVRFTLREFPL 99

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D ++T A MLAR         Y+    LLF++Q  W   +   DAL  M + AGFS+  F
Sbjct: 100 DPLATAAFMLARADN---SARYYPITDLLFDQQPAWAFVQKPLDALEQMMRQAGFSREKF 156

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +  L DQ + D I A K+R    F + +TP FFI G  + G++S     K+I  ++
Sbjct: 157 EATLKDQKLYDGINAVKERGMNVFKVSATPTFFINGQKFQGELSIEGMEKVIKPIV 212


>gi|114707685|ref|ZP_01440580.1| hypothetical protein FP2506_02415 [Fulvimarina pelagi HTCC2506]
 gi|114536929|gb|EAU40058.1| hypothetical protein FP2506_02415 [Fulvimarina pelagi HTCC2506]
          Length = 270

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 110/191 (57%), Gaps = 4/191 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           E+P   G VD   L+  S   + D+  G  +APVT+VEYASMTC HCA+FH  ++  +++
Sbjct: 79  EVPESSGSVDVADLM--SEQALPDIVQGDPEAPVTIVEYASMTCGHCADFHENSYPAIKE 136

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
            Y+ TGK + I+REFP D VS  A M+ARCA    D      V +LF++Q  W  +++  
Sbjct: 137 AYLDTGKAKLIIREFPFDPVSLAAFMMARCAGD--DQRRTAMVDVLFDQQSTWATAESPS 194

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
             LL +A+  G  +++F  CL+++ +   I   +K+   +F + +TP FFI G  Y G M
Sbjct: 195 QELLKIARMTGMGQDEFVACLDNKELQQQIVDVQKKGETEFGVSATPTFFINGAKYSGSM 254

Query: 214 SEGVFSKIIDS 224
           S    +  I++
Sbjct: 255 SPENMAAAIEA 265


>gi|170744954|ref|YP_001773609.1| DSBA oxidoreductase [Methylobacterium sp. 4-46]
 gi|168199228|gb|ACA21175.1| DSBA oxidoreductase [Methylobacterium sp. 4-46]
          Length = 214

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 102/176 (57%), Gaps = 3/176 (1%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P  + DV +G  +A  T++EYASMTC HCA FH  T+  L++++I TGK+R+ LREFPL
Sbjct: 40  QPGPLGDVWLGPAEAKCTIIEYASMTCSHCAAFHKTTWPALKERWIDTGKVRFTLREFPL 99

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D ++T A MLAR  +      Y+    LLF++Q  W       DAL  M + AGFS+  F
Sbjct: 100 DPLATAAFMLARADD---SARYYPITDLLFDQQPTWAFVPKPLDALEQMMRQAGFSREKF 156

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +  L DQ + D I   K+R    F + +TP FFI G  + G++S     K+I  ++
Sbjct: 157 EATLKDQKLYDAINTVKERGMAVFKVTATPTFFINGQKFQGEVSIEGLEKVIKPIV 212


>gi|209886100|ref|YP_002289957.1| protein-disulfide isomerase [Oligotropha carboxidovorans OM5]
 gi|209874296|gb|ACI94092.1| protein-disulfide isomerase [Oligotropha carboxidovorans OM5]
          Length = 217

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 105/179 (58%), Gaps = 3/179 (1%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A PST+ D+S+G KDAPVT++EYASMTC HCA F    F  ++  YI TGK+R+I REFP
Sbjct: 40  AKPSTLGDMSLGAKDAPVTIIEYASMTCPHCAAFTKDVFPQIKSTYIDTGKVRFIFREFP 99

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           LD V+  A  LARC  K     Y+  + +LFN+Q    N     + +  + K AG ++  
Sbjct: 100 LDQVALAASALARCVAKDDSNKYFAIIDILFNQQAGLQN--QAFETINRVGKQAGLTEAM 157

Query: 170 FDTCLNDQ-NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              C+ D   +   I A ++ A++   IDSTP FFI G L  G+ S   F KIID +I+
Sbjct: 158 IKACVQDDLTVQKGILADREYANQTLKIDSTPSFFINGTLVKGETSFDGFKKIIDPLIK 216


>gi|163867896|ref|YP_001609100.1| hypothetical protein Btr_0671 [Bartonella tribocorum CIP 105476]
 gi|161017547|emb|CAK01105.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 218

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 109/191 (57%), Gaps = 6/191 (3%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P   VD   LL +    +KD   G+ DAPV +VEYAS+TC HCA F+N     +  KYIK
Sbjct: 34  PVATVDMAELLQSG--KVKDRVEGEADAPVIIVEYASLTCTHCAHFYNDILPQIRKKYIK 91

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK++ I R++  D  +T   MLARCA    +  Y+  + +LF KQ++W+  K+    L 
Sbjct: 92  TGKVKMIFRDYAFDPRATAGFMLARCAP---EDRYFPLIEVLFQKQNEWVWGKDALTPLK 148

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            ++  AGF+   F  CL +Q ILD++ A  +R  E   + +TP FFI G+ Y G M    
Sbjct: 149 KISLMAGFTDESFTACLKNQTILDEVNASFERGKE-LGVSATPTFFINGDKYEGAMKVEE 207

Query: 218 FSKIIDSMIQD 228
           F  +IDS +++
Sbjct: 208 FFSLIDSYLKN 218


>gi|319898542|ref|YP_004158635.1| hypothetical protein BARCL_0368 [Bartonella clarridgeiae 73]
 gi|319402506|emb|CBI76049.1| conserved exported protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 216

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 118/208 (56%), Gaps = 7/208 (3%)

Query: 15  VLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYAS 74
           V++FI S     R  + L     P   VD   LL +    +KD   G+++APVT++EYAS
Sbjct: 11  VVIFIWSITAQARATTTLISKTEPVATVDMAELLKSG--KVKDRVEGEENAPVTIIEYAS 68

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
           +TC  CA+F+N     L  KYIKTGK++ I R+F  D  +T   MLARCA    +  Y+ 
Sbjct: 69  LTCTFCADFYNVILPELRKKYIKTGKVKLIFRDFAYDPRATAGFMLARCAP---EDRYFP 125

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
            + +LF KQ +W  +K+  + L  +A  AGF+   F  CL +Q+ILD++ A  +R  E  
Sbjct: 126 LIEVLFQKQYEWAGAKDALEPLKKIAFMAGFTDESFSACLKNQSILDEVNASFERGKE-L 184

Query: 195 AIDSTPVFFIGGNLYLGDMS-EGVFSKI 221
            + +TP FFI G  Y G MS E +F+ I
Sbjct: 185 GVTATPTFFINGKKYEGAMSMEALFTAI 212


>gi|49474015|ref|YP_032057.1| hypothetical protein BQ03750 [Bartonella quintana str. Toulouse]
 gi|49239518|emb|CAF25875.1| hypothetical protein BQ03750 [Bartonella quintana str. Toulouse]
          Length = 218

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 109/191 (57%), Gaps = 6/191 (3%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P   VD   +L   P  +KD   G+ +APVT+VEYAS+TC  CA F+N     +  KYIK
Sbjct: 34  PVSNVDMAEVL--QPGKVKDRVEGEANAPVTIVEYASLTCAPCAHFYNDVLPQIRKKYIK 91

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK++ I R+F  D  +T   MLARCA    +  Y+  + +LF KQ +W+  ++    L 
Sbjct: 92  TGKVKLIFRDFAFDPRATAGFMLARCAP---EDRYFPLIEVLFQKQHEWVWEQDALTPLK 148

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +   AGF+   F+ CL +Q+ILD++    +R  +   + +TP FFI GN Y G MS   
Sbjct: 149 KIGLMAGFTDESFNACLKNQSILDEVNMSFERGKK-LGVTATPTFFINGNKYTGVMSVEA 207

Query: 218 FSKIIDSMIQD 228
           F  +IDS +++
Sbjct: 208 FFSVIDSFLKN 218


>gi|218512892|ref|ZP_03509732.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           8C-3]
          Length = 215

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 101/160 (63%), Gaps = 7/160 (4%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            ++  ++P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF
Sbjct: 58  ATSSTDMPQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTF 115

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG-----GYWGFVSLLFNKQ 143
             ++ KY+ +GK+++I+REFP D  +  A MLARC+    +       Y+  VS+LF +Q
Sbjct: 116 DAIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSMLFKQQ 175

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
             W  + + R ALL M+K AGF+++ F  CL +Q +LD++
Sbjct: 176 QVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEV 215


>gi|240850103|ref|YP_002971496.1| DSBA oxidoreductase [Bartonella grahamii as4aup]
 gi|240267226|gb|ACS50814.1| DSBA oxidoreductase [Bartonella grahamii as4aup]
          Length = 218

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 115/215 (53%), Gaps = 8/215 (3%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEY 72
           GI+ LFI           AL   P P   VD   +L +    +KD   G+ DAPV +VEY
Sbjct: 11  GIIFLFIT--IAQNSVTVALARDPKPVATVDMEEILQSG--KVKDRFEGEADAPVVIVEY 66

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGY 132
           AS+TC HCA F+N     +  KYIKTGK++ I R++  D  +T   MLA+CA    +  Y
Sbjct: 67  ASLTCTHCAHFYNDILPQIRKKYIKTGKVKLIFRDYAFDPRATAGFMLAQCAP---EDRY 123

Query: 133 WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASE 192
           +  + +LF KQ++W   K+    L  +   AGF+   F  CL +Q ILD++ A  +R  +
Sbjct: 124 FPLIEVLFQKQNEWAFGKDALTPLKKIGLMAGFTDESFTACLKNQAILDEVNASFERGKK 183

Query: 193 DFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              + +TP FFI G+ Y G M    F  +IDS ++
Sbjct: 184 -LGVTATPTFFINGSKYEGAMKVEDFFSVIDSFLK 217


>gi|319403864|emb|CBI77450.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 216

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 112/190 (58%), Gaps = 8/190 (4%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P   VD   LL +    +KD   G+ +APVT++EYAS+TC  CA+F+N     L  KYIK
Sbjct: 34  PVATVDMVELLKSG--KVKDKVEGEDNAPVTIIEYASLTCAFCADFYNVILPELRKKYIK 91

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
           TGK++ I R+F  D  +T   MLARCA E+R    Y+  + +LF KQ +W+ + +  + L
Sbjct: 92  TGKVKLIFRDFAYDPRATAGFMLARCAPEER----YFPLIEVLFQKQSEWVIAPDALEPL 147

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
             +A  AGF+   F+ CL +Q+IL+++ A  +R  E   + +TP FFI G  Y G MS  
Sbjct: 148 KKIAFMAGFNDESFNACLKNQSILNEVNASFERGKE-LGVTATPTFFINGKKYEGAMSTE 206

Query: 217 VFSKIIDSMI 226
            F  +IDS +
Sbjct: 207 DFFSVIDSFL 216


>gi|319406876|emb|CBI80511.1| conserved exported hypothetical protein [Bartonella sp. 1-1C]
          Length = 216

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 117/212 (55%), Gaps = 6/212 (2%)

Query: 15  VLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYAS 74
           V++FI       R  + L     P   VD   LL +    +KD   G+ +APVT++EYAS
Sbjct: 11  VVIFIWGITAQVRATTTLVSKAEPVETVDMVELLKSG--KVKDKVEGEDNAPVTIIEYAS 68

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
           +TC  CA+F+N     L  KYIKTGK++ I R+F  D  +T   MLARCA    +  Y+ 
Sbjct: 69  LTCAFCADFYNAILPELRKKYIKTGKVKLIFRDFAYDPRATAGFMLARCAP---EDRYFP 125

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
            + +LF KQ +W    +  + L  +A  AGF+  DF+ CL +Q+IL+++ A  +R  E  
Sbjct: 126 LIEVLFQKQSEWAIVPDALEPLKKIAFMAGFNDEDFNACLKNQSILNEVNASFERGKE-L 184

Query: 195 AIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            + +TP FFI G  Y G MS+  F   IDS +
Sbjct: 185 GVTATPTFFINGKKYEGAMSKENFFSAIDSFL 216


>gi|110346928|ref|YP_665746.1| DSBA oxidoreductase [Mesorhizobium sp. BNC1]
 gi|110283039|gb|ABG61099.1| DSBA oxidoreductase [Chelativorans sp. BNC1]
          Length = 210

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 108/195 (55%), Gaps = 12/195 (6%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
           L+  P P+      ALLA  P  + + S G  DA VT++EYAS+TC HC  FH   +  L
Sbjct: 23  LSAQPTPE------ALLAPGP--LPEKSFGPDDATVTIIEYASLTCPHCRTFHVNVWPEL 74

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
           + KY+ TG++R+++REFP D  ++   MLARC     D  ++  + LL+  QD+W    +
Sbjct: 75  KKKYVDTGQVRFVMREFPFDPRASAGFMLARCVS---DDKWYPTIDLLYRTQDNWARVSD 131

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
              AL ++    G    DF+ CL DQ +L+ + A        F +DSTP FFI G +  G
Sbjct: 132 GTAALKSVMGMTGMGTADFEKCLQDQALLEKVTA-VAEGGRSFGVDSTPTFFINGQMQKG 190

Query: 212 DMSEGVFSKIIDSMI 226
            +S   FS+IID ++
Sbjct: 191 ALSIERFSEIIDPLV 205


>gi|319405305|emb|CBI78919.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 216

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 117/212 (55%), Gaps = 6/212 (2%)

Query: 15  VLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYAS 74
           V++FI          + L     P   +D   LL +    +KD   G+ +APV ++EYAS
Sbjct: 11  VIIFIWGVTAQVHATTTLVSKAKPVATIDMAELLKSG--KVKDKVEGEDNAPVIIIEYAS 68

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
           ++C  CA+F+N     L  KYIKTGK++ I R+F  D  +T   MLARCA    +  Y+ 
Sbjct: 69  LSCAFCADFYNVILPQLRKKYIKTGKVKLIFRDFSYDPRATAGFMLARCAP---EDRYFP 125

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
            + +LF KQ++W+ + +  + L  +A  AGF+   F+ CL +Q+ILD++ A  +R  E  
Sbjct: 126 LIEVLFQKQNEWVMAADALEPLKKIAFMAGFTDESFNACLKNQSILDEVNASFERGKE-L 184

Query: 195 AIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            + +TP FFI G  Y G MS   F  +IDS +
Sbjct: 185 GVTATPTFFINGKKYEGAMSMQDFFSVIDSFL 216


>gi|304393525|ref|ZP_07375453.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Ahrensia sp. R2A130]
 gi|303294532|gb|EFL88904.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Ahrensia sp. R2A130]
          Length = 207

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/154 (42%), Positives = 90/154 (58%), Gaps = 5/154 (3%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS-- 112
           ++D  +GQ DAPVT+VEYASMTC HC  FH+     L+  YI+TGK +YILR FP D   
Sbjct: 38  LEDKVMGQADAPVTIVEYASMTCPHCKTFHDTILPDLKKDYIETGKAKYILRPFPFDGDR 97

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
               A MLA CA    +  Y+  V  LF  Q +W    N    LL ++K AG S+ DF  
Sbjct: 98  RGEAAFMLALCAP---NDNYYAMVDALFATQKNWGGQGNPVPELLRISKLAGMSEADFKA 154

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
           CL +Q++L  +  G+ +A ++F + +TP  FI G
Sbjct: 155 CLGNQDLLTKMVQGRNKAVKEFGVRATPTVFING 188


>gi|144900304|emb|CAM77168.1| Protein-disulfide isomerase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 200

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 94/168 (55%), Gaps = 5/168 (2%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVS 114
           D  +G+ DAP+T++EYAS TC HCA FH  T   ++  +I TGK + + R+FP     +S
Sbjct: 31  DRVLGKADAPITIIEYASTTCGHCATFHKGTLPEVKKNWIDTGKAKLVYRDFPTGPAGLS 90

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
             A M+A CA       Y+G + L+  +QD W+ SK+  DAL    + AG +  D D CL
Sbjct: 91  IGASMIAHCAGPER---YFGVLGLIMEQQDKWLGSKDPLDALKKTVRLAGLTGEDVDACL 147

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
             Q++   I+   +   E F IDSTP F + G L +G  S   F+KI+
Sbjct: 148 QRQDLFQGIQVRAEHGHEQFKIDSTPSFVVNGKLVVGAKSYEDFNKIL 195


>gi|58697221|ref|ZP_00372621.1| DSBA oxidoreductase:Tat pathway signal [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225630789|ref|YP_002727580.1| hypothetical protein WRi_010920 [Wolbachia sp. wRi]
 gi|58536450|gb|EAL59860.1| DSBA oxidoreductase:Tat pathway signal [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592770|gb|ACN95789.1| hypothetical protein WRi_010920 [Wolbachia sp. wRi]
          Length = 228

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 92/165 (55%), Gaps = 8/165 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + LL+  P    D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI
Sbjct: 34  KELLSLLPD---DKLLGNPKAPILMIEYASLTCYHCSLFHKNVFPKIKEKYIDTGKMLYI 90

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL--NMAKF 162
            R FPLD     A ML+ C EK+ D  Y+ F   +FN  D W N  N  D  L   +A  
Sbjct: 91  FRHFPLDYRGLKAAMLSHCYEKQED--YFNFNKAVFNSIDSW-NYYNLSDLTLLQRIAAL 147

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           +   ++ F+ C+ND+ I+D I   K  A     I +TP+FFI  N
Sbjct: 148 SNLKQDAFNQCINDKKIMDKIINDKSLAINKLGITATPIFFIKLN 192


>gi|329850285|ref|ZP_08265130.1| DSBA oxidoreductase [Asticcacaulis biprosthecum C19]
 gi|328840600|gb|EGF90171.1| DSBA oxidoreductase [Asticcacaulis biprosthecum C19]
          Length = 213

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 99/170 (58%), Gaps = 11/170 (6%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--PLD 111
           T  D+S G ++A +T++EYAS+TC HCA F+ +    LE+KYIKTGK++Y+ REF  P +
Sbjct: 36  TADDMSKGGENAKITLIEYASVTCVHCAAFNKEVLPQLEEKYIKTGKIKYVYREFLTPPN 95

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI---NSKNYRDALLNMAKFAGFSKN 168
            VS    +LARCA K     Y+  +  +   +D       + N R  LLN+AK AG S+ 
Sbjct: 96  DVSAAGTLLARCAGKDK---YFAVIDQVMRSRDAMFADGTAANARPVLLNIAKNAGLSEE 152

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY---LGDMSE 215
            F+ C+ D+  L+ ++A  ++   +  I +TP FFI G  +    GD +E
Sbjct: 153 QFNACITDKKALEGLQARVEKYGRENNISTTPTFFINGKKFERKTGDFAE 202


>gi|163794972|ref|ZP_02188941.1| hypothetical protein BAL199_08853 [alpha proteobacterium BAL199]
 gi|159179791|gb|EDP64318.1| hypothetical protein BAL199_08853 [alpha proteobacterium BAL199]
          Length = 176

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/166 (34%), Positives = 88/166 (53%), Gaps = 3/166 (1%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +A +TM+EY+S+TC HCA FH +T   + + YI TGKL+  +R+FPLD  +  A  +
Sbjct: 13  GDPNAKLTMIEYSSLTCPHCATFHKETLPQIRETYINTGKLKLEMRDFPLDQYALRAAAM 72

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCA    D  Y+  + +LF +Q  W  + +   A+  + + AG S    D C+ D+ ++
Sbjct: 73  ARCAP---DSRYFPLMDMLFAQQSKWTRATDPVGAIKQIGRLAGISAEQADACMTDEKLM 129

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D I   +     D  + STP F IG    +G      F K ID  +
Sbjct: 130 DGILQFRLAGQTDHDVSSTPTFVIGDQKVVGAQPFEAFQKAIDPQL 175


>gi|99034733|ref|ZP_01314664.1| hypothetical protein Wendoof_01000524 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 234

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 92/163 (56%), Gaps = 8/163 (4%)

Query: 47  LLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR 106
           LL+  P+   D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R
Sbjct: 42  LLSPLPN---DKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFR 98

Query: 107 EFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL--NMAKFAG 164
            FPLD     A ML+ C EK+ D  Y+ F   +FN  D W N  N  D  L   +A  + 
Sbjct: 99  HFPLDYRGLKAAMLSHCYEKQED--YFNFNKAVFNSIDSW-NYYNLSDLTLLQRIAALSN 155

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
             ++ F+ C+ND+ I+D I   K  A     I +TP+FFI  N
Sbjct: 156 LKQDAFNQCINDKKIMDKIVNDKSLAINKLGITATPIFFIKLN 198


>gi|23016159|ref|ZP_00055918.1| COG1651: Protein-disulfide isomerase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 200

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 93/170 (54%), Gaps = 5/170 (2%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS--VS 114
           D  +G+ DAP+T++EYAS TC HCA FH  T    + ++I+TGK R I R+FP     +S
Sbjct: 31  DQVLGKADAPITVIEYASTTCPHCATFHKTTLPKFKAEWIETGKARLIYRDFPTGPRGLS 90

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
             A M+A CA       Y+G ++L+  +Q+ W++S N    L  +AK AG  ++  D CL
Sbjct: 91  VGASMIAHCAGPER---YFGLLALIMEQQEKWMSSPNPLVELKKLAKLAGMGEDKVDDCL 147

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             Q++   I    K  +E   ++STP   IGG +  G +      K++ +
Sbjct: 148 KRQDLASAINERAKEGNEKLGVESTPSLIIGGKVTPGAIPYDELDKLLKA 197


>gi|42520863|ref|NP_966778.1| hypothetical protein WD1055 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410603|gb|AAS14712.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 234

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (56%), Gaps = 5/153 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD     
Sbjct: 49  DKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLK 108

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL--NMAKFAGFSKNDFDTCL 174
           A ML+ C EK+ D  Y+ F   +FN  D W N  N  D  L   +A  +   ++ F+ C+
Sbjct: 109 AAMLSHCYEKQED--YFNFNKAVFNSIDSW-NYYNLSDLTLLQRIAALSNLKQDAFNQCI 165

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           ND+ I+D I   K  A     I +TP+FFI  N
Sbjct: 166 NDKKIMDKIVNDKSLAINKLGITATPIFFIKLN 198


>gi|225631144|ref|ZP_03787856.1| hypothetical protein WUni_003070 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225591158|gb|EEH12328.1| hypothetical protein WUni_003070 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 203

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 91/163 (55%), Gaps = 8/163 (4%)

Query: 47  LLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR 106
           LL+  P    D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R
Sbjct: 11  LLSPLPD---DKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFR 67

Query: 107 EFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL--NMAKFAG 164
            FPLD     A ML+ C EK+ D  Y+ F   +FN  D W N  N  D  L   +A  + 
Sbjct: 68  HFPLDYRGLKAAMLSHCYEKQED--YFNFNKAVFNSIDSW-NYYNLSDLTLLQRIAALSN 124

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
             ++ F+ C+ND+ I+D I   K  A     I +TP+FFI  N
Sbjct: 125 LKQDAFNQCINDKKIMDKIVNDKSLAINKLGITATPIFFIKLN 167


>gi|300024388|ref|YP_003756999.1| disulfide bond formation protein D [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526209|gb|ADJ24678.1| putative disulfide bond formation protein D [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 264

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 92/164 (56%), Gaps = 4/164 (2%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +PS + ++S G  +APVTMVEYAS+TC HC  FH   +   + ++I TGK+RYILREFP+
Sbjct: 81  APSPLPEMSWGNANAPVTMVEYASLTCPHCRNFHLTVYPDFKRRFIDTGKVRYILREFPI 140

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
              S  A +  RCA       Y         +Q  W++ +   DA+  +A+  G ++  F
Sbjct: 141 GKTSGNATIALRCAPPDK---YLDLFGKFMEQQSSWVSQEVRLDAIYAVARQVGMTRPQF 197

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           D CL +Q +++++K  K R  +   I  TP FFIG  L   +++
Sbjct: 198 DACLQNQGMIENLKWVKDRGRK-LGIVGTPNFFIGTKLIKKELT 240


>gi|225734104|pdb|3F4R|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1
          Length = 226

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (56%), Gaps = 5/153 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD     
Sbjct: 31  DKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLK 90

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL--NMAKFAGFSKNDFDTCL 174
           A ML+ C EK+ D  Y+ F   +FN  D W N  N  D  L   +A  +   ++ F+ C+
Sbjct: 91  AAMLSHCYEKQED--YFNFNKAVFNSIDSW-NYYNLSDLTLLQRIAALSNLKQDAFNQCI 147

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           ND+ I+D I   K  A     I +TP+FFI  N
Sbjct: 148 NDKKIMDKIVNDKSLAINKLGITATPIFFIKLN 180


>gi|190571339|ref|YP_001975697.1| hypothetical protein WPa_0944 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357611|emb|CAQ55052.1| hypothetical protein WP0944 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 243

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 92/165 (55%), Gaps = 8/165 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + LL+  P    D  +G   AP+ M+EYAS+TC+HC+ FH K F  +++KYI TGK+ YI
Sbjct: 49  KELLSLLPD---DKLLGDPKAPILMIEYASLTCYHCSLFHKKVFPKIKEKYIDTGKMLYI 105

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKF 162
            R FPLD     A ML+ C EK  D  Y+ F   +FN  D W N  N+ D   L  +A  
Sbjct: 106 FRHFPLDYRGLKAAMLSYCYEKEED--YFNFNKAVFNAIDSW-NYSNFSDLTILQKIAAL 162

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           +   ++ F+ C+ND+ ++D I   K  A     I +TPVF I  N
Sbjct: 163 SNLKQDVFNQCINDKKMMDKIINDKSLAINKLDITATPVFIIKIN 207


>gi|83313081|ref|YP_423345.1| protein-disulfide isomerase [Magnetospirillum magneticum AMB-1]
 gi|82947922|dbj|BAE52786.1| Protein-disulfide isomerase [Magnetospirillum magneticum AMB-1]
          Length = 201

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 98/181 (54%), Gaps = 5/181 (2%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           A  AA  S   D  +G+ DAP+T++EYAS TC HCA FH  T    + ++++TGK + I 
Sbjct: 21  AAAAADLSYSIDQVLGKPDAPITVIEYASTTCPHCATFHKTTLPKFKSEWVETGKAKLIY 80

Query: 106 REFPLDS--VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           R+FP     +S  A M+A CA       Y+G ++L+  +Q+ W+NS+N    L  +AK A
Sbjct: 81  RDFPTGPRGLSVGASMIAHCAGPDR---YFGLLALIMEQQEKWMNSQNPLVELKKLAKLA 137

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G  ++  D CL  Q++ + I    K  +E   ++STP   I G +  G +      K++ 
Sbjct: 138 GLGEDKVDDCLKRQDLANAINERAKEGNEKLGVESTPSLIIAGKVIPGAIPYDELDKLLK 197

Query: 224 S 224
           +
Sbjct: 198 A 198


>gi|312115735|ref|YP_004013331.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220864|gb|ADP72232.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
          Length = 215

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 99/174 (56%), Gaps = 4/174 (2%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           AA+   + D+++G+ DAPVT++EY+S++C HCA FH+     L+ ++I TGK+RY+ REF
Sbjct: 39  AAAQPALPDMALGKADAPVTIIEYSSLSCPHCAHFHSDVLPELKKQFIDTGKVRYVQREF 98

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           PL+       +LARC +      ++ F  LLF K DDW   ++    L   AK AG +  
Sbjct: 99  PLNDAGFAGSVLARCLDSSR---FFAFNDLLFKKMDDWAFKQDALTPLKLYAKQAGLNDA 155

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           +F+ CL D+++   I A  +   E   +  TP FFI G  + G  +   F++ +
Sbjct: 156 EFNKCLADEDLQKKILA-VRGLGEKQGVRGTPTFFINGKKFDGAPTIEAFAEAM 208


>gi|213018735|ref|ZP_03334543.1| hypothetical protein C1A_508 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995686|gb|EEB56326.1| hypothetical protein C1A_508 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 230

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 92/165 (55%), Gaps = 8/165 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + LL+  P    D  +G   AP+ M+EYAS+TC+HC+ FH K F  +++KYI TGK+ YI
Sbjct: 36  KELLSLLPD---DKLLGDPKAPILMIEYASLTCYHCSLFHKKVFPKIKEKYIDTGKMLYI 92

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKF 162
            R FPLD     A ML+ C EK  D  Y+ F   +FN  D W N  N+ D   L  +A  
Sbjct: 93  FRHFPLDYRGLKAAMLSYCYEKEED--YFNFNKAVFNAIDSW-NYSNFSDLTILQKIAAL 149

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           +   ++ F+ C+ND+ ++D I   K  A     I +TPVF I  N
Sbjct: 150 SNLKQDVFNQCINDKKMMDKIINDKSLAINKLDITATPVFIIKIN 194


>gi|159042586|ref|YP_001531380.1| putative thiol-disulfide oxidoreductase D [Dinoroseobacter shibae
           DFL 12]
 gi|157910346|gb|ABV91779.1| putative thiol-disulfide oxidoreductase D [Dinoroseobacter shibae
           DFL 12]
          Length = 223

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 118/221 (53%), Gaps = 13/221 (5%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPI-PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
           G+ +    +Y++ ++ G     + + P G V+ + +     S + ++++G  DAP+T+VE
Sbjct: 11  GVAIAAAGAYWYTSQSGVPTAGVTLNPVGSVEAQEV---DTSGIVEMTLGAADAPITVVE 67

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC-AEKRMDG 130
           YAS TC HCA FH   F  L++ YI+TGK+++I RE   D     A M+ARC  E+R   
Sbjct: 68  YASFTCPHCATFHQNVFPELKENYIETGKVQFIYREVYFDRFGLWAGMVARCGGEER--- 124

Query: 131 GYWGFVSLLFNKQDDWINS---KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
            Y+G   +L+ +Q +W  +       D L  + + AG S    D CL D      + A  
Sbjct: 125 -YFGITDMLYEQQSEWTGNGSPAEVADNLRRIGRVAGMSDEQVDACLQDGEKAQALVAWY 183

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++ +E   I+STP F I G  Y  +M+   F+ ++D ++++
Sbjct: 184 QQNAEADGINSTPSFVINGENY-SNMNFRDFAAVLDGLLEE 223


>gi|73667389|ref|YP_303405.1| hypothetical protein Ecaj_0776 [Ehrlichia canis str. Jake]
 gi|72394530|gb|AAZ68807.1| conserved hypothetical protein [Ehrlichia canis str. Jake]
          Length = 239

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 100/184 (54%), Gaps = 9/184 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + LL+  P+   D  +G   APV ++EYAS +C HCA F    F  LE KYIKTGK+ YI
Sbjct: 50  KKLLSLLPN---DRFVGNTKAPVVIIEYASFSCMHCAHFTLNVFPELERKYIKTGKVLYI 106

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKF 162
            R FPLD VS  A ML  C        ++ +   +F+  +  +   NY+D   L N+AK 
Sbjct: 107 FRNFPLDYVSLKAAMLGTCYNTA--SRFFTYTRAVFSSIEALVT--NYKDLGVLSNIAKI 162

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           +  S   F+ C+ND++I++ +   K  A+    +++TPVFFI G  Y        FS+ I
Sbjct: 163 SNISDERFEKCINDEDIMNYVIQEKFVANRKLQVNATPVFFINGKKYDKSHDIESFSETI 222

Query: 223 DSMI 226
           D +I
Sbjct: 223 DELI 226


>gi|225734105|pdb|3F4S|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1 T172v
          Length = 226

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 86/153 (56%), Gaps = 5/153 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD     
Sbjct: 31  DKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLK 90

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL--NMAKFAGFSKNDFDTCL 174
           A ML+ C EK+ D  Y+ F   +FN  D W N  N  D  L   +A  +   ++ F+ C+
Sbjct: 91  AAMLSHCYEKQED--YFNFNKAVFNSIDSW-NYYNLSDLTLLQRIAALSNLKQDAFNQCI 147

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           ND+ I+D I   K  A     I + P+FFI  N
Sbjct: 148 NDKKIMDKIVNDKSLAINKLGITAVPIFFIKLN 180


>gi|57239468|ref|YP_180604.1| hypothetical protein Erum7420 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579446|ref|YP_197658.1| hypothetical protein ERWE_CDS_07820 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161547|emb|CAH58474.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418072|emb|CAI27276.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 241

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 101/184 (54%), Gaps = 9/184 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + LL   P+   D  +G   APV ++EYAS +C HCA F    F  LE KYIK GKL YI
Sbjct: 51  KELLTLLPN---DRYLGNTKAPVVIIEYASFSCMHCAHFALNVFPVLEHKYIKEGKLLYI 107

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKF 162
            R FPLD +S  A ML  C +      ++ +   +F+  +  +   NYRD   L N+AK 
Sbjct: 108 FRNFPLDYISLKAAMLGTCYDTA--NSFFTYNKAVFSSIEALV--TNYRDLGVLSNIAKI 163

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           +  S+  F+ C+ND++I++ I   K  A++   +++TPVFFI G  Y        FS+ I
Sbjct: 164 SNISEERFNKCVNDEDIMNYIIQEKFIANKKLQVNATPVFFINGKKYDKAHDVESFSEAI 223

Query: 223 DSMI 226
           + +I
Sbjct: 224 NELI 227


>gi|58617500|ref|YP_196699.1| hypothetical protein ERGA_CDS_07730 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417112|emb|CAI28225.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 241

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 101/184 (54%), Gaps = 9/184 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + LL   P+   D  +G   APV ++EYAS +C HCA F    F  LE KYIK GKL YI
Sbjct: 51  KELLTLLPN---DRYLGNTKAPVVIIEYASFSCMHCAHFALNVFPVLEHKYIKEGKLLYI 107

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKF 162
            R FPLD +S  A ML  C +      ++ +   +F+  +  +   NYRD   L N+AK 
Sbjct: 108 FRNFPLDYISLKAAMLGTCYDTA--SSFFTYNKAVFSSIEALV--TNYRDLGVLSNIAKI 163

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           +  S+  F+ C+ND++I++ I   K  A++   +++TPVFFI G  Y        FS+ I
Sbjct: 164 SNISEERFNKCVNDEDIMNYIIQEKFIANKKLQVNATPVFFINGKKYDKAHDVESFSEAI 223

Query: 223 DSMI 226
           + +I
Sbjct: 224 NELI 227


>gi|58584695|ref|YP_198268.1| protein-disulfide isomerase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419011|gb|AAW71026.1| Protein-disulfide isomerase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 234

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 85/149 (57%), Gaps = 5/149 (3%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   AP+ M+EYAS+TC+HC+ FH + F  ++ KYI TGK+ YI R FPLD     A ML
Sbjct: 53  GDSKAPILMIEYASLTCYHCSLFHREVFPEIKKKYIDTGKMLYIFRHFPLDYRGLKAAML 112

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKFAGFSKNDFDTCLNDQN 178
           + C EK+ D  Y+ F   +FN  D W N  N  D   L  +A  +   ++ F+ C+ND+ 
Sbjct: 113 SYCYEKQED--YFNFNKAVFNSIDSW-NYSNLSDLTVLQKVAALSNLKQDTFNRCINDKE 169

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           ++D I   K  A     I +TP+FFI  N
Sbjct: 170 VMDKIINDKSLAINKLGIMATPIFFIKLN 198


>gi|68171231|ref|ZP_00544635.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657639|ref|YP_507055.1| hypothetical protein ECH_0234 [Ehrlichia chaffeensis str. Arkansas]
 gi|67999351|gb|EAM85996.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599096|gb|ABD44565.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 240

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 100/184 (54%), Gaps = 9/184 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + LL+  P+   D  IG   APV ++EYAS +C HCA F    F  LE KYIKTGK+ YI
Sbjct: 51  QELLSLLPN---DRFIGNTKAPVIIIEYASFSCMHCAHFTLNVFPELERKYIKTGKVLYI 107

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKF 162
            R FPLD +S  A ML  C        ++ +   +F+  +  +   NY+D   L N+AK 
Sbjct: 108 FRNFPLDYISLKAAMLGICYNTA--SSFFTYTKAVFSSIEALVT--NYKDLGVLSNIAKI 163

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           +  +   F+ C+ND++I++ I   K  A+    +++TPVFFI G  Y        FS+ I
Sbjct: 164 SNVTDERFEKCINDEDIMNYIVQEKFVANRKLQVNATPVFFINGRKYDKPHDIESFSETI 223

Query: 223 DSMI 226
           D +I
Sbjct: 224 DELI 227


>gi|88607835|ref|YP_504726.1| hypothetical protein APH_0098 [Anaplasma phagocytophilum HZ]
 gi|88598898|gb|ABD44368.1| conserved hypothetical protein [Anaplasma phagocytophilum HZ]
          Length = 227

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 88/156 (56%), Gaps = 2/156 (1%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D  +G +DAPV MVEYAS +C HCA+F  K F  ++ +YI TG+L YI R+FPLD +S 
Sbjct: 53  EDRYLGNEDAPVVMVEYASFSCAHCADFITKVFPRIKKEYIDTGRLLYIYRDFPLDRLSL 112

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
            A ML  C +   +  ++ +V  +F   D  I +      L+N+AK +  S  DF  C  
Sbjct: 113 SAAMLGSCYKD--NTAFFSYVRAVFGSYDTLIATYKDLGLLVNIAKISNISDEDFKRCTT 170

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           D+ ++D +   K  A     +++TP FFI G  Y G
Sbjct: 171 DEELMDRVVQQKFLAVNTLDVNATPSFFINGERYSG 206


>gi|312115734|ref|YP_004013330.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220863|gb|ADP72231.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
          Length = 263

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 93/174 (53%), Gaps = 4/174 (2%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P  + D  IG+ +APVT+VEY S+TC + A+F  +T   L+  YI  GK++ +LRE+P
Sbjct: 67  AEPGPLGDQVIGKGNAPVTVVEYLSLTCANSAKFQAETLPKLKKAYIDKGKVKLVLREYP 126

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           +   +    +L+RC  ++    Y+  V  L + Q  W+  +   D + N  KF G  ++ 
Sbjct: 127 IGKAAAATAVLSRCLPQK---DYFKVVEKLLSTQQTWVAQEVKPDDIYNAVKFTGIKRDK 183

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           FD CL +Q+I D +   K+R    F +  TP FF+ G    G +S      II+
Sbjct: 184 FDECLTNQSINDALVLVKQRG-RGFGVSGTPTFFVNGKKLAGAVSFEEMQPIIE 236


>gi|119384827|ref|YP_915883.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
 gi|119374594|gb|ABL70187.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
          Length = 223

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 100/181 (55%), Gaps = 7/181 (3%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           + D+++GQ DAPVT++EYAS TC HCA FH++    L+ +Y+ TGK+++I R+   D+V 
Sbjct: 46  LPDIALGQADAPVTIIEYASFTCSHCAAFHDQNLPKLKAEYVDTGKVKFIQRDVYFDAVG 105

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF---AGFSKNDFD 171
             A +LARC     D  Y+    L+F  Q +W+++K+  +   N+ K    AG +    D
Sbjct: 106 LWAGILARCG---GDEKYYAVSDLIFGDQKNWLSAKSGDEIAANLRKIGAKAGMTPEQMD 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           TC NDQ  + D+    +  +    I+ TP F I G   + +       KIID+ + ++  
Sbjct: 163 TCWNDQQKVADLVTTFQTHATADQIEGTPTFIIAGE-KVQNQPWDDLKKIIDAKLAEAES 221

Query: 232 R 232
           +
Sbjct: 222 K 222


>gi|111035806|emb|CAL29433.1| hypothetical protein OW1-K [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 231

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 84/153 (54%), Gaps = 5/153 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  +G   AP+ M+EYAS+TC+HC  FH + F  ++ KYI TGK+ YI R FP+D     
Sbjct: 49  DKLLGDPKAPILMIEYASLTCYHCYLFHKEVFPKIKKKYIDTGKMLYIFRHFPMDYRGLK 108

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKFAGFSKNDFDTCL 174
           A ML+ C E+  D  Y+ F   +FN  D W N  N  D   L  +A  +   ++ F+ C+
Sbjct: 109 AAMLSHCYERTED--YFNFNKAVFNLIDSW-NYSNLSDLTVLQKVAALSNLKQSTFNQCI 165

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           ND+ I+D +   K  A     +  TP+FFI  N
Sbjct: 166 NDRKIMDKVINDKSLAINKLGVTGTPIFFIKLN 198


>gi|84687977|ref|ZP_01015841.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family protein) [Maritimibacter alkaliphilus HTCC2654]
 gi|84664009|gb|EAQ10509.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family protein) [Rhodobacterales bacterium HTCC2654]
          Length = 222

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 114/224 (50%), Gaps = 16/224 (7%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLA--ASPSTMKDVSIGQKDAPV 67
            LG  VL+   +YF  T+ G      P    +    A +A  A      D+ +G++DAP+
Sbjct: 8   ALGAAVLVGGGAYF-ATQSGPT----PGTSALSPISAAVAQDADVELAPDMVLGEEDAPI 62

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC-AEK 126
           TM+EYAS TC HCA+FH + ++ L+  YI TGK++++ RE   D     A ++ARC  E 
Sbjct: 63  TMIEYASFTCPHCADFHERVWEDLKADYIDTGKVKFVNREVYFDKYGLWAGLVARCGGEM 122

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM---AKFAGFSKNDFDTCLNDQNILDDI 183
           R    Y+G + +LF  Q DWI +      L N+    K AG S+     C+ND+ +   +
Sbjct: 123 R----YFGVMDMLFETQKDWIGNGQEAAILENLTTIGKKAGLSEEQVTACVNDKEMAQSM 178

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            A  ++ +    I  TP F I G  Y  +M+     KI+D + +
Sbjct: 179 VAAYQQNAGADEITGTPTFIINGEKY-SNMTYDDLKKILDGLAE 221


>gi|294675785|ref|YP_003576400.1| DSBA family oxidoreductase [Rhodobacter capsulatus SB 1003]
 gi|294474605|gb|ADE83993.1| oxidoreductase, DSBA family [Rhodobacter capsulatus SB 1003]
          Length = 220

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 98/185 (52%), Gaps = 9/185 (4%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           A  A   + + DV++G+ DAPVT++EYAS TC HCA FH   F  L+  YI TGK+R+IL
Sbjct: 39  AEAAPGGTILPDVALGRADAPVTLIEYASFTCSHCARFHETVFGALKRDYIDTGKVRFIL 98

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--- 162
           RE   D     A  +A+C     D  Y+G   +LF++Q  WI          N+ K    
Sbjct: 99  REVYFDKFGLWAGQVAQCGG---DLKYYGIAGMLFSEQKSWIGDGTEPVIAENLRKIGIK 155

Query: 163 AGFSKNDFDTCLNDQNILDD-IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
           AG +K+  +TCLND    +  +   +K AS D AI+ TP   I G  +  +M      KI
Sbjct: 156 AGLTKDQIETCLNDTARAEAMVMTYQKNASAD-AIEGTPTLVINGEKH-DNMGYAELKKI 213

Query: 222 IDSMI 226
           +D+ +
Sbjct: 214 LDAKL 218


>gi|163733088|ref|ZP_02140532.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter litoralis
           Och 149]
 gi|161393623|gb|EDQ17948.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter litoralis
           Och 149]
          Length = 223

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 109/225 (48%), Gaps = 6/225 (2%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
           +R+ ++   V +     +F T  G+       P G  + +       ST+ D+S+G  DA
Sbjct: 2   SRMMIISAAVAVIGLGAYFVTSTGTNPVTPANPLGAANAQEAADIDTSTIVDMSLGNPDA 61

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           PVT++EYAS TC HCA FH   FK L+  YI TGK+ ++ RE   D     A M+ARCA 
Sbjct: 62  PVTVIEYASYTCPHCARFHEGPFKQLKTDYIDTGKINFVYREVYFDRYGLWASMIARCAG 121

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 ++G   L++ KQ +W  +       D L  +   AG  ++  + CL + +    
Sbjct: 122 TPES--FFGMSDLIYQKQSEWSRAGEPAAIVDELRKVGLLAGLDRDTMEACLQNGDKAQT 179

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           + A  +  +    I+STP F I G  Y  +MS    ++ ID+  +
Sbjct: 180 LVAWYQENATADGIESTPSFLINGQKY-SNMSYAEMAEAIDAAAE 223


>gi|149912474|ref|ZP_01901008.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter sp.
           AzwK-3b]
 gi|149812880|gb|EDM72706.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter sp.
           AzwK-3b]
          Length = 221

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 106/211 (50%), Gaps = 16/211 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAAS--PSTMKDVSIGQK 63
           TR+  +  + L  +A   ++   GS       PD      A  A+    ST+ ++SIG  
Sbjct: 2   TRLTAIAALCLALVAGAGWWLTSGSTTP----PDLTFAANAQEASEIDTSTITEMSIGNP 57

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           DA VT++EYAS TC HCA+FH   FK L+  YI TGK+ +I R+   D     A MLARC
Sbjct: 58  DAAVTVIEYASFTCPHCADFHGGQFKQLKSDYIDTGKINFIYRDVFFDRFGLWASMLARC 117

Query: 124 AEKRMDGG--YWGFVSLLFNKQDDWINSKN---YRDALLNMAKFAGFSKNDFDTCLNDQN 178
                DG   ++G  ++L+ KQ DW+   +     + L  + K AG  ++  + CL DQ+
Sbjct: 118 -----DGQDRFFGLTAMLYEKQKDWVGKGDPVGIANELRRIGKVAGLDEDRIEECLADQD 172

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
               + A  ++ +E   + STP   I G  Y
Sbjct: 173 KAKTLVAWYQKNAEADDVTSTPTLVINGQKY 203


>gi|310817208|ref|YP_003965172.1| periplasmic thiol-disulfide interchange protein [Ketogulonicigenium
           vulgare Y25]
 gi|308755943|gb|ADO43872.1| periplasmic thiol-disulfide interchange protein [Ketogulonicigenium
           vulgare Y25]
          Length = 215

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 94/173 (54%), Gaps = 6/173 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           ++++G +DAP+T +EYAS TC HCA FHN  ++ L++ YI TGK+R++ RE   D     
Sbjct: 42  EMAVGAEDAPITFIEYASFTCPHCANFHNNQYQQLKENYIDTGKVRFVFREVYFDRFGLW 101

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM---AKFAGFSKNDFDTC 173
           A M+ARC +      ++G   LL+  Q  WI S +  +   N+    + AG S    D C
Sbjct: 102 ASMIARCGDNNTR--FFGINDLLYENQQGWIGSGDPAEIANNLRAIGREAGMSDAAIDAC 159

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + DQ + + +       +E   + +TP  FI G  Y G+MS    + I+D+ +
Sbjct: 160 MADQALAEGLVGWFTENAERDNVTATPTLFINGQQY-GNMSYENLAAILDAEL 211


>gi|110677699|ref|YP_680706.1| thiol-disulfide oxidoreductase D, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453815|gb|ABG30020.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter
           denitrificans OCh 114]
          Length = 223

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 110/225 (48%), Gaps = 6/225 (2%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
           +R+ ++   V +     +F T  G+       P G  + +       S++ D+++G  DA
Sbjct: 2   SRMMIISAAVAVIGLGAYFVTSPGTNPVTPANPLGAANAQEAADIDTSSIMDMTLGNPDA 61

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           PVT++EYAS TC HCA FH   FK L+  YI TGK+ ++ RE   D     A M+ARCA 
Sbjct: 62  PVTVIEYASYTCPHCARFHEGPFKQLKADYIDTGKINFVYREVYFDRYGLWASMIARCAG 121

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 ++G   L++ KQ +W  + +     D L  +   AG  ++  + CL +      
Sbjct: 122 TPES--FFGMSDLIYQKQSEWSRAGDPAAIVDELRKVGLLAGLDRDTMEACLQNGEKAQT 179

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           + A  +  +    I+STP F I G  Y  +MS    +++ID+  +
Sbjct: 180 LVAWYQENATADGIESTPSFLINGQRY-SNMSYAEMAELIDAAAE 223


>gi|225734106|pdb|3F4T|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1
           C97aC146A
          Length = 226

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 85/153 (55%), Gaps = 5/153 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD     
Sbjct: 31  DKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGLK 90

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL--NMAKFAGFSKNDFDTCL 174
           A ML+   EK+ D  Y+ F   +FN  D W N  N  D  L   +A  +   ++ F+  +
Sbjct: 91  AAMLSHAYEKQED--YFNFNKAVFNSIDSW-NYYNLSDLTLLQRIAALSNLKQDAFNQAI 147

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           ND+ I+D I   K  A     I +TP+FFI  N
Sbjct: 148 NDKKIMDKIVNDKSLAINKLGITATPIFFIKLN 180


>gi|332559930|ref|ZP_08414252.1| periplasmic thiol-disulfide interchange protein [Rhodobacter
           sphaeroides WS8N]
 gi|332277642|gb|EGJ22957.1| periplasmic thiol-disulfide interchange protein [Rhodobacter
           sphaeroides WS8N]
          Length = 223

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 110/220 (50%), Gaps = 10/220 (4%)

Query: 11  LGGIVLLFIASYFFYT-RKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           L  + L  +A    +   + +   +LP P          A + + ++D+S+G +DAPVT+
Sbjct: 7   LAALALTTVAGVALWNGSRDAGQTQLP-PMAASAQETGAAQTTAAVEDMSMGAEDAPVTI 65

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC-AEKRM 128
           VEYAS TC HCA F  +    L+  YI TGK+R+  RE   D     A M+ARC  E R 
Sbjct: 66  VEYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREVYFDRYGLWAAMVARCGGEMR- 124

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
              Y+G   L+F +Q +W+ +   + A  L  + K AG      D C+NDQ   + + A 
Sbjct: 125 ---YFGIADLIFEQQKEWVTNDPAQVATNLRKIGKTAGLDDAALDACMNDQAKAEAMVAA 181

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            ++ S+   I +TP   + G  +  +MS     KIID+ +
Sbjct: 182 FQKNSQADDITATPSLIVNGTKH-SNMSYEELKKIIDAEL 220


>gi|296531857|ref|ZP_06894662.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
 gi|296267827|gb|EFH13647.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
          Length = 233

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 91/186 (48%), Gaps = 7/186 (3%)

Query: 49  AASPSTMKDVS----IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           A  P T + +     IG+ DAPV ++EY S+TC +CA FH   F  +   +I+ G +R++
Sbjct: 47  APGPDTPRPLPGERIIGRADAPVAVIEYHSLTCGNCANFHTTIFPRIRTTFIEPGLVRFV 106

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
           +R+FPLD V+  A  +  C        Y   +S L+  ++ W +S + R  L      AG
Sbjct: 107 MRDFPLDRVALDAAAMVHCGGPER---YEALISTLYANKEAWAHSPDARTWLRRAGTLAG 163

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
                 D C+ D+   D I   + +   +  +++TP F I G L+ G  S   FS ++  
Sbjct: 164 IPAARIDACMTDRGFTDPIILMRLQGERESGVNATPSFVINGQLHRGVQSFERFSALVRP 223

Query: 225 MIQDST 230
           ++   T
Sbjct: 224 LLPPGT 229


>gi|254465063|ref|ZP_05078474.1| thiol:disulfide interchange protein, DsbA family [Rhodobacterales
           bacterium Y4I]
 gi|206685971|gb|EDZ46453.1| thiol:disulfide interchange protein, DsbA family [Rhodobacterales
           bacterium Y4I]
          Length = 223

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 94/178 (52%), Gaps = 7/178 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+ ++++G +DAPVT++EYAS TC HCA FHN  FK L+  YI TGK+++I RE   D 
Sbjct: 49  STITEMTLGAEDAPVTLIEYASYTCPHCANFHNTVFKQLKKDYIDTGKVKFIYREVYFDR 108

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI---NSKNYRDALLNMAKFAGFSKND 169
               A M+ARC        ++G   L++  Q +W     +    D L  + + AG     
Sbjct: 109 YGLWASMIARC---NGPDKFFGISDLIYKGQSEWARAGGASEIVDELRKIGRLAGLENEQ 165

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + CL D      + A  +  + +  I+STP F + G   + + S   F K++D+ ++
Sbjct: 166 LEACLQDGAKAQTLVAWYQENATEHGIESTPSFILNGE-KISNQSYEEFKKLLDAELE 222


>gi|197104046|ref|YP_002129423.1| probable disulfide isomerase [Phenylobacterium zucineum HLK1]
 gi|196477466|gb|ACG76994.1| probable disulfide isomerase [Phenylobacterium zucineum HLK1]
          Length = 205

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 89/161 (55%), Gaps = 5/161 (3%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           A   ++ +D+++G  +APV +VEYAS+TC HCA F+  TF   + KYI TGK+ Y  +EF
Sbjct: 27  AGPTASAEDMTLGDANAPVKVVEYASVTCSHCAAFNETTFPQFKAKYIDTGKVHYTFKEF 86

Query: 109 --PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
             P + V+    ++ARCA K     Y+  +  LF  Q +   S + R  LL +A+ AG +
Sbjct: 87  LTPPEQVAAAGFLVARCAGKDK---YFTVIDALFRSQQEMFQSGDMRGGLLRVAQSAGMT 143

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           +  F+ C+ D+  L  +    ++A     I +TP F + G 
Sbjct: 144 EAQFNACIQDEAALKALNDRVEKAIRQDGISATPTFVVNGK 184


>gi|315498144|ref|YP_004086948.1| dsba oxidoreductase [Asticcacaulis excentricus CB 48]
 gi|315416156|gb|ADU12797.1| DSBA oxidoreductase [Asticcacaulis excentricus CB 48]
          Length = 211

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (55%), Gaps = 5/158 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--PLDSVS 114
           D+ +G+ DAP+T+VEYAS+TC HCA F+ K F  ++ KYI TGK++YI REF  P   VS
Sbjct: 38  DMVLGKADAPITLVEYASVTCTHCAAFNEKVFPTVKAKYIDTGKVKYIYREFLTPPADVS 97

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
              V++ARCA K     Y+  +  +   Q +   + + +  L  +A  AG S   F  C+
Sbjct: 98  AAGVLVARCAGKDK---YFEVIDAIMRSQKELFTTGDAKGILKRVANSAGLSDEAFAKCV 154

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
           ND   L+ I+   ++ ++   I  TP   I G  + GD
Sbjct: 155 NDPKGLERIQTNMEKYAKADNITGTPTLIINGQKFEGD 192


>gi|126460893|ref|YP_001042007.1| periplasmic thiol-disulphide interchange protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126102557|gb|ABN75235.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Rhodobacter sphaeroides ATCC 17029]
          Length = 223

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 96/177 (54%), Gaps = 8/177 (4%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           + + ++D+S+G +DAPVT+VEYAS TC HCA F  +    L+  YI TGK+R+  RE   
Sbjct: 47  TTAAVEDMSMGAEDAPVTIVEYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREVYF 106

Query: 111 DSVSTVAVMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSK 167
           D     A M+ARC  E R    Y+G   L+F +Q +W+ +   + A  L  + K AG   
Sbjct: 107 DRYGLWAAMVARCGGEMR----YFGIADLIFEQQKEWVTNDPAQVATNLRKIGKTAGLDD 162

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
              D C+NDQ   + + A  ++ S+   I +TP   I G  +  +MS     KIID+
Sbjct: 163 AALDACMNDQAKAEAMVAAFQKNSQADDITATPSLIINGTKH-SNMSYEELKKIIDA 218


>gi|89070022|ref|ZP_01157353.1| thiol:disulfide interchange protein, DsbA family protein
           [Oceanicola granulosus HTCC2516]
 gi|89044359|gb|EAR50497.1| thiol:disulfide interchange protein, DsbA family protein
           [Oceanicola granulosus HTCC2516]
          Length = 264

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 98/181 (54%), Gaps = 9/181 (4%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST++++ IG +DAPVT+ EYAS TC HCA FH   +  L+  YI TGK++ + RE   D 
Sbjct: 48  STIEEMVIGAEDAPVTLTEYASFTCPHCANFHVNHYPELKRDYIDTGKVQMVYREVYFDR 107

Query: 113 VSTVAVMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKN---YRDALLNMAKFAGFSKN 168
               A M+ARC  E+R    ++G  SL++ +Q DW +  +     + L  +A+ AG   +
Sbjct: 108 FGLWASMIARCGGEER----FFGLTSLIYEEQQDWTSGGDPAGIAENLRRLARTAGLDND 163

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             D CL+D      +    +  +E   I STP F I G  + G+ S  +F   +D+ ++ 
Sbjct: 164 QLDACLSDATTAQTLVQWFEENAEADDITSTPTFLIDGEKFEGNWSSELFPA-LDAAVEA 222

Query: 229 S 229
           S
Sbjct: 223 S 223


>gi|77462003|ref|YP_351507.1| periplasmic thiol-disulphide interchange protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|77386421|gb|ABA77606.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Rhodobacter sphaeroides 2.4.1]
          Length = 228

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 96/177 (54%), Gaps = 8/177 (4%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           + + ++D+S+G +DAPVT+VEYAS TC HCA F  +    L+  YI TGK+R+  RE   
Sbjct: 52  TTAAVEDMSMGAEDAPVTIVEYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREVYF 111

Query: 111 DSVSTVAVMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSK 167
           D     A M+ARC  E R    Y+G   L+F +Q +W+ +   + A  L  + K AG   
Sbjct: 112 DRYGLWAAMVARCGGEMR----YFGIADLIFEQQKEWVTNDPAQVATNLRKIGKTAGLDD 167

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
              D C+NDQ   + + A  ++ S+   I +TP   I G  +  +MS     KIID+
Sbjct: 168 AALDACMNDQAKAEAMVAAFQKNSQADDITATPSLIINGTKH-SNMSYEELKKIIDA 223


>gi|222474813|ref|YP_002563228.1| hypothetical protein AMF_083 [Anaplasma marginale str. Florida]
 gi|222418949|gb|ACM48972.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 272

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 88/167 (52%), Gaps = 2/167 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YILR+FPLD +S  A M
Sbjct: 89  LGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYILRDFPLDKLSLSAAM 148

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           L  C +   +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  D+ +
Sbjct: 149 LGTCYKD--NKTFFAYAKAVFNSFDALIATHKDLGLLANIAKISNISDEEFKKCTTDEAL 206

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 207 MDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 253


>gi|255003917|ref|ZP_05278718.1| hypothetical protein AmarV_00438 [Anaplasma marginale str.
           Virginia]
          Length = 253

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 88/167 (52%), Gaps = 2/167 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YILR+FPLD +S  A M
Sbjct: 70  LGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYILRDFPLDKLSLSAAM 129

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           L  C +   +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  D+ +
Sbjct: 130 LGTCYKD--NKTFFAYAKAVFNSFDALIATHKDLGLLANIAKISNISDEEFKKCTTDEAL 187

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 188 MDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 234


>gi|221640954|ref|YP_002527216.1| periplasmic thiol-disulfide interchange protein [Rhodobacter
           sphaeroides KD131]
 gi|221161735|gb|ACM02715.1| periplasmic thiol-disulphide interchange protein [Rhodobacter
           sphaeroides KD131]
          Length = 223

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 96/177 (54%), Gaps = 8/177 (4%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           + + ++D+S+G +DAPVT+VEYAS TC HCA F  +    L+  YI TGK+R+  RE   
Sbjct: 47  TTAAVEDMSMGAEDAPVTIVEYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREVYF 106

Query: 111 DSVSTVAVMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSK 167
           D     A M+ARC  E R    Y+G   L+F +Q +W+ +   + A  L  + K AG   
Sbjct: 107 DRYGLWAAMVARCGGEMR----YFGIADLIFEQQKEWVTNDPAQVATNLRKIGKTAGLDD 162

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
              D C+NDQ   + + A  ++ S+   I +TP   + G  +  +MS     KIID+
Sbjct: 163 AALDACMNDQAKAEAMVAAFQKNSQADDITATPSLIVNGTKH-SNMSYEELKKIIDA 218


>gi|255002783|ref|ZP_05277747.1| hypothetical protein AmarPR_00418 [Anaplasma marginale str. Puerto
           Rico]
          Length = 255

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 88/167 (52%), Gaps = 2/167 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YILR+FPLD +S  A M
Sbjct: 72  LGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYILRDFPLDKLSLSAAM 131

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           L  C +   +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  D+ +
Sbjct: 132 LGTCYKD--NKTFFAYAKAVFNSFDALIATHKDLGLLANIAKISNISDEEFKKCTTDEAL 189

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 190 MDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 236


>gi|254994674|ref|ZP_05276864.1| hypothetical protein AmarM_00455 [Anaplasma marginale str.
           Mississippi]
          Length = 253

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 88/167 (52%), Gaps = 2/167 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YILR+FPLD +S  A M
Sbjct: 70  LGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYILRDFPLDKLSLSAAM 129

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           L  C +   +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  D+ +
Sbjct: 130 LGACYKD--NKTFFAYAKAVFNSFDALIATHKDLGLLANIAKISNISDEEFKKCTTDEAL 187

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 188 MDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 234


>gi|163739871|ref|ZP_02147278.1| thiol:disulfide interchange protein, DsbA family [Phaeobacter
           gallaeciensis BS107]
 gi|163743384|ref|ZP_02150764.1| thiol:disulfide interchange protein, DsbA family [Phaeobacter
           gallaeciensis 2.10]
 gi|161383378|gb|EDQ07767.1| thiol:disulfide interchange protein, DsbA family [Phaeobacter
           gallaeciensis 2.10]
 gi|161386905|gb|EDQ11267.1| thiol:disulfide interchange protein, DsbA family [Phaeobacter
           gallaeciensis BS107]
          Length = 223

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 92/177 (51%), Gaps = 7/177 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+ ++  G +DAPVT++EYAS TC HCA FH  T+K L+  YI TGK+++I RE   D 
Sbjct: 49  STIVEMVQGAEDAPVTLIEYASYTCPHCANFHQGTYKQLKQDYIDTGKVKFIYREVYFDR 108

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKND 169
               A M+ARC        ++G   L++  Q DW  +       DAL  + + AG  +  
Sbjct: 109 YGLWASMIARCGGPEK---FFGISDLIYKGQSDWARAGGATEIVDALRKIGRLAGLEEEQ 165

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            + CL D      + +  +  + +  I+STP F + G   + + S   F  +ID+ +
Sbjct: 166 LEACLQDGTKAQTLVSWYQENATEHGIESTPSFILNGKK-IENQSYDAFKTLIDAEL 221


>gi|304319999|ref|YP_003853642.1| twin-arginine translocation signal domain protein [Parvularcula
           bermudensis HTCC2503]
 gi|303298902|gb|ADM08501.1| twin-arginine translocation signal domain protein [Parvularcula
           bermudensis HTCC2503]
          Length = 229

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 86/150 (57%), Gaps = 3/150 (2%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVST 115
           +++G ++AP+T++EYAS+TC  CA FH + F  +++KYI TGK+R+I REFP    +++ 
Sbjct: 53  MALGSEEAPLTIIEYASVTCPACAAFHAQYFPEIKEKYIDTGKVRFIYREFPTAPQNLAY 112

Query: 116 VAVMLARCAEK-RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                ARCA   R    Y+  +  L+ +Q +W    N  D L N+A  AG  + + +TC 
Sbjct: 113 AGFYTARCAATDRGPVAYFAMLDTLYARQREWAYGDNPGDVLENIAAQAGIDRQELETCF 172

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
             ++I   +KA      E   ++STP F +
Sbjct: 173 RREDIRSAVKANVLEGVEAHGVNSTPTFIV 202


>gi|83594579|ref|YP_428331.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
 gi|83577493|gb|ABC24044.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
          Length = 217

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 96/170 (56%), Gaps = 6/170 (3%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVA 117
           ++G  DA VT+VEY+S+ C HCA+FH +    L+ +YI TGK+R + ++  L   ++  A
Sbjct: 50  ALGSPDAKVTIVEYSSLLCPHCADFHTQILPELKKEYIDTGKVRLVFKDHSLGQPLAVGA 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            ++ARCA ++    ++  ++ LF  Q  W  +K+   AL   A  AG  K   + CL++Q
Sbjct: 110 SVIARCAPEQ---NFFPLITTLFANQRTWATAKDPLAALQGYAALAGMDKAAVEACLDNQ 166

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL-GDMSEGVFSKIIDSMI 226
           ++ + ++AG+  A     ++STP F I G   L G      F K++D ++
Sbjct: 167 DVFNGVQAGEAEAGR-IGVESTPSFVIDGKPVLVGAQPIEAFRKVLDPLV 215


>gi|56416443|ref|YP_153517.1| hypothetical protein AM116 [Anaplasma marginale str. St. Maries]
 gi|56387675|gb|AAV86262.1| hypothetical protein AM116 [Anaplasma marginale str. St. Maries]
          Length = 272

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 88/167 (52%), Gaps = 2/167 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YILR+FPLD +S  A M
Sbjct: 89  LGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYILRDFPLDKLSLSAAM 148

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           L  C +   +  ++ +   +FN  D  I +      + N+AK +  S  +F  C  D+ +
Sbjct: 149 LGTCYKD--NKTFFAYAKAVFNSFDALIATHKDLGLVANIAKISNISDEEFKKCTTDEAL 206

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 207 MDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 253


>gi|114765135|ref|ZP_01444280.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Pelagibaca bermudensis HTCC2601]
 gi|114542539|gb|EAU45565.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Roseovarius sp. HTCC2601]
          Length = 214

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 94/181 (51%), Gaps = 7/181 (3%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A  +T+ D+++GQ DAPV ++EY S TC HCA F  + F  L++ YI TGK+++  RE  
Sbjct: 35  AQEATVTDMTLGQADAPVEIIEYGSFTCPHCATFEQEVFPQLKEDYIDTGKVKFTFREAY 94

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN---YRDALLNMAKFAGFS 166
            +     A ++ARC  +     Y+G V +++  Q++W          DA+  M   AG  
Sbjct: 95  FNKYDMWASLMARCGGEMK---YFGIVDMIYETQNEWARQSTEAGVADAIRKMGLQAGIG 151

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +   D C+ D   L  +    ++  E+   +STP F I G L+  +M    F +I+D  +
Sbjct: 152 QEQLDACMQDGETLKALVGWYQQNVEEDGFNSTPSFMIDGELHT-NMPYDEFVEILDERV 210

Query: 227 Q 227
           +
Sbjct: 211 E 211


>gi|288961585|ref|YP_003451895.1| DsbA oxidoreductase [Azospirillum sp. B510]
 gi|288913865|dbj|BAI75351.1| DsbA oxidoreductase [Azospirillum sp. B510]
          Length = 220

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 90/175 (51%), Gaps = 5/175 (2%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           M +  +G   APVT+++Y+SMTC HCA FH +    +++ YI TGK++ + R+FP D  +
Sbjct: 49  MAERVLGDPKAPVTILDYSSMTCPHCAHFHAEILPKIKEAYIDTGKVKLVFRDFPFDQAA 108

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
             A MLA CA       Y+    +LF  Q  W  + +   AL    K AG S+   D C 
Sbjct: 109 LSASMLAHCAPVER---YFPLTDVLFKSQPTWSRAADPAKALAQYGKLAGMSQETIDACF 165

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIG-GNLYL-GDMSEGVFSKIIDSMIQ 227
            ++ + D I   +      + +++TP F +  G + + G      F+K ID +++
Sbjct: 166 ANKELADAILNSRLTGQNQYKVEATPTFILNDGKVRIEGAQPFEAFAKEIDKLLK 220


>gi|126724764|ref|ZP_01740607.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Rhodobacterales bacterium HTCC2150]
 gi|126705928|gb|EBA05018.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Rhodobacterales bacterium HTCC2150]
          Length = 220

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 96/178 (53%), Gaps = 8/178 (4%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           S ++D  +G  DAP+T++EYAS TC HC  FH   F+ L+  YI+TGK+++I RE   D 
Sbjct: 47  SIVEDKFLGDPDAPITVIEYASFTCPHCRRFHVDVFEKLKTNYIETGKVKFIYREVYFDR 106

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA---LLNMAKFAGFSKND 169
               A M+ARCA++     Y+G   L++  Q  W    +  +    L+N+ K AG  + +
Sbjct: 107 YGLWAGMVARCAKEN----YFGVADLIYQNQPTWTKGASETEIAGNLVNLGKVAGLGEEE 162

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              CLND      + A  ++ ++   I STP F I G  Y  +M+   FS I+D  ++
Sbjct: 163 ISACLNDGTKAQAMVAVFQKNADVDEITSTPSFLIDGEKY-SNMNYADFSAILDKKLE 219


>gi|269959141|ref|YP_003328930.1| putative isomerase [Anaplasma centrale str. Israel]
 gi|269848972|gb|ACZ49616.1| putative isomerase [Anaplasma centrale str. Israel]
          Length = 251

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 87/167 (52%), Gaps = 2/167 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV MVEYAS +C HCA+F  K    L+ +YI  GKL YILR+FPLD +S  A M
Sbjct: 66  LGNTSAPVVMVEYASFSCSHCADFATKVLPRLKSEYIDKGKLLYILRDFPLDKLSLSAAM 125

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           L  C +   +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  ++ +
Sbjct: 126 LGTCYKD--NKTFFAYAKAVFNSFDALIATHKDLGLLSNIAKISNISDEEFKKCTTNEAL 183

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 184 MDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSVSAEIEKLI 230


>gi|126738673|ref|ZP_01754378.1| thiol:disulfide interchange protein, DsbA family [Roseobacter sp.
           SK209-2-6]
 gi|126720472|gb|EBA17178.1| thiol:disulfide interchange protein, DsbA family [Roseobacter sp.
           SK209-2-6]
          Length = 223

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 92/177 (51%), Gaps = 7/177 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           S++ ++ +G +DAPVT++EYAS TC HCA FHN  FK L++ YI +GK+R+I RE   D 
Sbjct: 49  SSITEMVLGAEDAPVTLIEYASYTCPHCASFHNTVFKQLKEDYIDSGKVRFIYREVYFDR 108

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKND 169
               A M+ARC        ++G   L++  Q +W  +       D L  + + +G     
Sbjct: 109 YGLWASMIARCGGPEK---FFGVSDLIYKGQSEWARAGGATEIVDELRKIGRLSGLENET 165

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            + CL D      +    +  +    I STP F + G L +G+ S   F +++D+ +
Sbjct: 166 LEACLQDGAKAQTLVTWYQEHATKDGIQSTPSFILNGEL-IGNQSYESFKELLDAEL 221


>gi|114769699|ref|ZP_01447309.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [alpha proteobacterium HTCC2255]
 gi|114549404|gb|EAU52286.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [alpha proteobacterium HTCC2255]
          Length = 205

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 94/181 (51%), Gaps = 7/181 (3%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           A +P  + D+ +G  DAPVT++EYAS TC HCA FH   F  L   YI TGK+++I RE 
Sbjct: 28  ATNPINIPDMEMGSNDAPVTIIEYASFTCPHCASFHKNVFPSLRKNYIDTGKVKFIYREV 87

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN---YRDALLNMAKFAGF 165
             D     A +LARC + +    Y+G   LL++KQ +W            L  + + AG 
Sbjct: 88  YFDGPGLWAALLARCGDTKK---YFGISDLLYSKQREWTKGDGGAAIAQNLYKIGRIAGL 144

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            ++  + CL ++++   + A  +  ++   + STP   + G   +G+MS    + +ID  
Sbjct: 145 DQSTMEACLQNKDVATAMVARFQETTKADNVSSTPSLILNGK-NIGNMSFTDLAALIDEA 203

Query: 226 I 226
           +
Sbjct: 204 M 204


>gi|167648326|ref|YP_001685989.1| DSBA oxidoreductase [Caulobacter sp. K31]
 gi|167350756|gb|ABZ73491.1| DSBA oxidoreductase [Caulobacter sp. K31]
          Length = 211

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 89/154 (57%), Gaps = 5/154 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--PL 110
           +T  D+S+G  +A VT++EYAS +C HC  ++N+ F   + KYI TGK+ Y+ REF  P 
Sbjct: 31  ATADDMSLGNANAKVTVIEYASASCVHCGRWNNEVFPAFKAKYIDTGKVHYVYREFLTPP 90

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
             V+  + +LARCA K     Y+  +  +++ Q++  ++ +YR  LL +A+ AG ++  F
Sbjct: 91  VQVAAASFLLARCAGK---DKYFSVIDSVYHSQEEMFSTGDYRGVLLRIAQSAGLNEEQF 147

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           + C+ND+  +  +     +   D  I  TP F I
Sbjct: 148 NACVNDEKAIKALNDRVAKYEADAKITGTPTFVI 181


>gi|260426823|ref|ZP_05780802.1| dsba oxidoreductase [Citreicella sp. SE45]
 gi|260421315|gb|EEX14566.1| dsba oxidoreductase [Citreicella sp. SE45]
          Length = 223

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 96/182 (52%), Gaps = 9/182 (4%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           A  AASP    D+++GQ DAPV ++EY S TC HCA F    F  +++ YI TGK+++  
Sbjct: 42  AQEAASPVV--DMTLGQADAPVEIIEYGSFTCPHCAAFEETVFPQIKENYIDTGKVKFTF 99

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKF 162
           RE   +     A ++ARC  +     Y+G V ++++ Q++W    + +   DA+  M   
Sbjct: 100 REAYFNKYDMWASLMARCGGEMK---YFGIVDMIYSTQNEWARQSSEQGVADAIRKMGLQ 156

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           AG  + + D C+ D   L  + A  +   E    +STP F + G L+  +M    FSK++
Sbjct: 157 AGIGQEELDACMQDGEQLKALVAWYQGNVEKDGFNSTPSFIVDGELH-SNMPYDEFSKLL 215

Query: 223 DS 224
           D 
Sbjct: 216 DE 217


>gi|114328527|ref|YP_745684.1| thiol:disulfide interchange protein dsbA [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316701|gb|ABI62761.1| thiol:disulfide interchange protein dsbA [Granulibacter
           bethesdensis CGDNIH1]
          Length = 225

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 102/196 (52%), Gaps = 20/196 (10%)

Query: 30  SALNELPIPDGVVDFRALLAASPST--------MKDVSIGQKDAPVTMVEYASMTCFHCA 81
           +AL  LP+       +A  A +P+T        + + SIG+ DA VT++E+ S+TC HCA
Sbjct: 28  AALFSLPL------IQAARAEAPATSGGDLSSFLSERSIGKADAKVTVMEFFSLTCTHCA 81

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
            F   T   L  K I TG LR + R+FPLD V+  A M+AR   +     Y  F+S LF 
Sbjct: 82  AFSQNTLPELIKKQIDTGHLRIVFRDFPLDQVALSAAMVARALPQER---YEPFISALFA 138

Query: 142 KQDDWINSK--NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
            QD W  ++  N  ++L  MA  AG S+  FD  +N++ +   +   +++ S  + I+ST
Sbjct: 139 SQDRWAFNRDGNVTESLAQMALLAGLSRAKFDAVINNEALKRAMLERQQQESIKYNINST 198

Query: 200 PVF-FIGGNLYLGDMS 214
           P F    G    G +S
Sbjct: 199 PTFALTNGKTQSGALS 214


>gi|146276120|ref|YP_001166279.1| DSBA oxidoreductase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554361|gb|ABP68974.1| DSBA oxidoreductase [Rhodobacter sphaeroides ATCC 17025]
          Length = 223

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 106/217 (48%), Gaps = 8/217 (3%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           L  + L  +A +  +         L  P       A  + +   ++D+ +G +DAPVT+V
Sbjct: 7   LAALALTTVAGFALWNGGREPAQTLLPPMAASAQEAGSSETAPVIEDMVMGAEDAPVTIV 66

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC-AEKRMD 129
           EY+S TC HCA F  +    L+  YI TGK+R++ RE   D     A M+ARC  E R  
Sbjct: 67  EYSSFTCPHCATFEKEVLTPLKRDYIDTGKVRFVYREVYFDRYGLWAAMVARCGGEMR-- 124

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
             Y+G   L+F++Q +W+ +   + A  L  + K AG      D C+NDQ   + + A  
Sbjct: 125 --YFGIADLIFDQQQEWVTNDPAQVAENLRRIGKTAGLDDAALDACMNDQAKAEAMVAAF 182

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           ++ ++   I +TP   I G  +  +M      KII++
Sbjct: 183 QKNTQADDITATPSLIINGTKH-SNMGYDELRKIIEA 218


>gi|163745416|ref|ZP_02152776.1| thiol:disulfide interchange protein, DsbA family [Oceanibulbus
           indolifex HEL-45]
 gi|161382234|gb|EDQ06643.1| thiol:disulfide interchange protein, DsbA family [Oceanibulbus
           indolifex HEL-45]
          Length = 228

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 88/170 (51%), Gaps = 10/170 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           S + ++ +G ++APVTM+EYAS TC HCA FHN+TFK L+  YI +GK+++I RE   D 
Sbjct: 54  SGITEMVMGDENAPVTMIEYASFTCPHCATFHNETFKKLKADYIDSGKVKFIYREVFFDR 113

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKND 169
               A M+ARC  +     ++G   L++  Q +W  +       + L  + + AG     
Sbjct: 114 YGLWASMVARCGGQEK---FFGIADLIYKSQSEWTRAGEPAAIVEELRKIGRLAGLDNET 170

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG----NLYLGDMSE 215
            D CL D    + + A     SE   I STP F I G    N+   DM +
Sbjct: 171 LDECLKDGEKAEALVAWYTENSEKDDISSTPSFVIDGKKHSNMSYADMKD 220


>gi|254477202|ref|ZP_05090588.1| thiol:disulfide interchange protein, DsbA family [Ruegeria sp. R11]
 gi|214031445|gb|EEB72280.1| thiol:disulfide interchange protein, DsbA family [Ruegeria sp. R11]
          Length = 223

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 90/177 (50%), Gaps = 7/177 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+ ++  G +DAPVT++EYAS TC HCA FH   +K L++ YI TGK+++I RE   D 
Sbjct: 49  STIIEMVQGAEDAPVTLIEYASYTCPHCANFHQGAYKQLKEDYIDTGKVKFIYREVYFDR 108

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKND 169
               A M+ARC        ++G   L++  Q DW  +       DAL  +   AG  +  
Sbjct: 109 YGLWASMIARCGGPEK---FFGISDLIYKGQSDWARAGGATEIVDALRKIGLLAGLEEEQ 165

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            + CL D      +    +  + +  I+STP F + G   + + S   F  +ID+ +
Sbjct: 166 LEACLQDGAKAQTLVNWYQENATEHGIESTPSFILNGK-KISNQSYADFKALIDAEL 221


>gi|86136905|ref|ZP_01055483.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseobacter sp. MED193]
 gi|85826229|gb|EAQ46426.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseobacter sp. MED193]
          Length = 223

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 92/178 (51%), Gaps = 7/178 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+ ++ +G +DAPVT++EYAS TC HCA FH    K L+++YI TGK++ I RE   D 
Sbjct: 49  STITEMVMGAEDAPVTLIEYASYTCPHCANFHTGVLKQLKEEYIDTGKMKLIYREVYFDR 108

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKND 169
               A M+ARC        ++G   L++  Q DW  +       DAL  +   AG  K+ 
Sbjct: 109 YGLWASMIARCGGPEK---FFGISDLIYKGQSDWSRAGGASEIIDALRKIGGIAGLDKDT 165

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + CL D      + A  +  +    +++TP F + G   + + S   F  +ID+ ++
Sbjct: 166 VEACLQDGTKAQTLVAWYQENATADGVEATPSFVLNGT-RISNQSYEDFKALIDAELE 222


>gi|114570747|ref|YP_757427.1| protein-disulfide isomerase-like protein [Maricaulis maris MCS10]
 gi|114341209|gb|ABI66489.1| Protein-disulfide isomerase-like protein [Maricaulis maris MCS10]
          Length = 257

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 85/159 (53%), Gaps = 12/159 (7%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--S 114
           D  +G  DAPVTM+EYAS+ C HCA +HN+ +  LE  YI+TG++R++LRE    S   +
Sbjct: 40  DRGLGSPDAPVTMIEYASVACGHCATWHNEVYPMLESDYIETGQVRFVLREMITGSAQFA 99

Query: 115 TVAVMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSK----NYRDALLNMAKFAGFSKND 169
                LA C  E R    Y+  V LLF +Q+    +     + R+  L +A+  G S+ D
Sbjct: 100 IAGFSLAHCVPEDR----YYDMVDLLFQQQNAIFQAAQTQGSARNQYLAIARSMGMSEAD 155

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           F  CL+D+ I  DI     RA  +  I  TP F   G +
Sbjct: 156 FTQCLSDETITQDILDANDRAGAE-GITGTPRFIFNGEM 193


>gi|260432301|ref|ZP_05786272.1| thiol:disulfide interchange protein, DsbA family [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416129|gb|EEX09388.1| thiol:disulfide interchange protein, DsbA family [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 221

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 82/157 (52%), Gaps = 6/157 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+ ++  G +DAPV ++EYAS TC HCA FH   +K L+ +YI TGK+R+I RE   D 
Sbjct: 47  STIVEMVQGAEDAPVEIIEYASYTCPHCANFHQGPYKQLKKEYIDTGKVRFIYREVYFDR 106

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS---KNYRDALLNMAKFAGFSKND 169
               A M+ARC        ++G   L++  Q +W  +       + L  + + AG S + 
Sbjct: 107 YGIWASMVARCGGPEK---FFGITDLIYKGQSEWTRAGGPAEIVEELRKIGRLAGLSNDQ 163

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            + CL D      + A  ++ +E   I +TP F + G
Sbjct: 164 LEACLQDGTKAQTLVAWYQKNAEKDGIQATPSFIVNG 200


>gi|295687794|ref|YP_003591487.1| DSBA oxidoreductase [Caulobacter segnis ATCC 21756]
 gi|295429697|gb|ADG08869.1| DSBA oxidoreductase [Caulobacter segnis ATCC 21756]
          Length = 205

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 87/155 (56%), Gaps = 5/155 (3%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--PLD 111
           T  D++ G  +A VT+VEYAS +C HCA+++ + +   + KYI TGK+ Y+ RE   P +
Sbjct: 29  TADDMTQGNPNAKVTVVEYASASCSHCAQWNEEVYPAFKAKYIDTGKVNYVYREILTPPN 88

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            V+  A ++ARCA K     Y+  V  ++  Q     +  +R+ LL +A+ AG S+  F+
Sbjct: 89  EVAAAAFLMARCAGKDK---YFQVVDSVYRAQHQMFQTGQFREGLLTVAQSAGMSEEQFN 145

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            C+ D+  L  +    ++ S++  I  TP F + G
Sbjct: 146 ACVTDEKGLKALNDRVQKYSKEAKIQGTPTFVVNG 180


>gi|84502796|ref|ZP_01000909.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family protein) [Oceanicola batsensis HTCC2597]
 gi|84388779|gb|EAQ01649.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family protein) [Oceanicola batsensis HTCC2597]
          Length = 219

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 92/178 (51%), Gaps = 8/178 (4%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           S + ++++G  DA VT+ EYAS TC HCA FH   FK L+  YI TGK++++ R+   D 
Sbjct: 46  SGVTEMTLGSDDAGVTLTEYASFTCPHCANFHQAVFKDLKRDYIDTGKVKFVYRDVYFDQ 105

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN---YRDALLNMAKFAGFSKND 169
               A M+ARC   R    ++G   +L+ +Q DWI + +     D L  +   AG     
Sbjct: 106 FGLWAAMIARCEPTR----FFGIADMLYAQQKDWIGNGDPAGIADRLRKIGLVAGLEAEA 161

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            D CL D++    + A  ++ +E   I  TP   I G  +  +MS     +I+D+ ++
Sbjct: 162 IDACLADEDKARSLVAWYQQNAEADEITGTPTLLIDGEKH-SNMSYPDLREILDARLE 218


>gi|326402643|ref|YP_004282724.1| hypothetical protein ACMV_04950 [Acidiphilium multivorum AIU301]
 gi|325049504|dbj|BAJ79842.1| hypothetical protein ACMV_04950 [Acidiphilium multivorum AIU301]
          Length = 209

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 94/182 (51%), Gaps = 11/182 (6%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           A SP +++  S+G  +APVT+ EY S+ C HCAEF       + + Y+K GK+ Y+ ++F
Sbjct: 32  ADSPYSIR--SLGNPNAPVTVYEYFSLNCPHCAEFATHALPKVIESYVKPGKVYYVFKDF 89

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI------NSKNYRDALLNMAKF 162
           PL+  +  A  +AR    +    Y+ F+S LF  QD+W         K+Y++AL   A  
Sbjct: 90  PLNEDALWAAQIARALPAK---AYYPFISELFRTQDEWAYAPGLKTPKDYQNALFRYAAL 146

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           AG  +  FD  + ++ +   +      A + + ++STP F I G    G +S   FS  +
Sbjct: 147 AGMDRTTFDAAIANKKLRAFVLNELNDAEKTYKVNSTPTFIINGRKREGAVSFDTFSSWL 206

Query: 223 DS 224
            +
Sbjct: 207 KA 208


>gi|126736226|ref|ZP_01751969.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter sp. CCS2]
 gi|126714392|gb|EBA11260.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter sp. CCS2]
          Length = 221

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 107/218 (49%), Gaps = 10/218 (4%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
           GG  L+ + + +  TR       LP   G    +     +P  ++ + +G  +APV ++E
Sbjct: 10  GGGALVALGAGWTLTRPDPQTGLLP---GAAMAQTADGEAPEVVEMI-LGDPNAPVEVIE 65

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           YAS TC HCA FH   FK L++ YI TG++++I RE   D     A M+ARC+       
Sbjct: 66  YASFTCPHCATFHANQFKALKENYIDTGRIKFIYREVYFDRPGLWASMIARCSNDA--DF 123

Query: 132 YWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK 188
           ++ F  LL+ +Q +W  S +     + L  +AK AG      D CL+D    + +    +
Sbjct: 124 FFAFSELLYAEQREWAGSGDPATIIEELRTLAKTAGLDDATLDACLSDGAKAEALFTWYQ 183

Query: 189 RASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             +E   + STP F I G  Y  +M+   F+ I+D  +
Sbjct: 184 ENAERDEVRSTPTFMIDGQQY-SNMAYDEFAGILDGKL 220


>gi|148259417|ref|YP_001233544.1| protein-disulfide isomerase-like protein [Acidiphilium cryptum
           JF-5]
 gi|146401098|gb|ABQ29625.1| Protein-disulfide isomerase-like protein [Acidiphilium cryptum
           JF-5]
          Length = 209

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 93/180 (51%), Gaps = 11/180 (6%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           SP +++  S+G  +APVT+ EY S+ C HCAEF       + + Y+K GK+ Y+ ++FPL
Sbjct: 34  SPYSIR--SLGNPNAPVTVYEYFSLNCPHCAEFATHALPKVIESYVKPGKVYYVFKDFPL 91

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI------NSKNYRDALLNMAKFAG 164
           +  +  A  +AR    +    Y+ F+S LF  QD+W         K+Y++AL   A  AG
Sbjct: 92  NEDALWAAQIARALPAK---AYYPFISELFRTQDEWAYAPGLKTPKDYQNALFRYAALAG 148

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             +  FD  + ++ +   +      A + + ++STP F I G    G +S   FS  + +
Sbjct: 149 MDRTTFDAAIANKKLRAFVLNELNDAEKTYKVNSTPTFIINGRKREGAVSFDTFSSWLKA 208


>gi|295841152|dbj|BAJ06962.1| disulfide isomerase [uncultured bacterium]
          Length = 197

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 89/175 (50%), Gaps = 8/175 (4%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ++ ++VS+G   APVT++EY S+TC  C  FH   +  L+ +YI TG  R+I R FP   
Sbjct: 24  ASSEEVSLGSIQAPVTIIEYGSLTCGKCLSFHKYVYPELKKQYIDTGTARFIFRHFPTGE 83

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            +      A C   +    Y+  +  LF+  D W+ ++N     +  A     +   F T
Sbjct: 84  AAVYGARAANCTGDK----YYEMLDKLFSTTDTWVRAENREAIFVKYATSLELNSETFVT 139

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS----EGVFSKIID 223
           C+ ++  LD+I   +K A ++  +  TP FFI G++  G+ S    E + S+ I+
Sbjct: 140 CIRNEKHLDNILLQQKAARKELDVIGTPTFFINGSMVRGERSFPKMEALISEAIN 194


>gi|295841184|dbj|BAJ06981.1| disulfide isomerase [uncultured bacterium]
          Length = 179

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 91/180 (50%), Gaps = 8/180 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +  S ++ ++VS+G   APVT++EY S+TC  C  FH   +  L+ +YI TG +R+I R 
Sbjct: 1   MMVSFASSEEVSLGSIQAPVTIIEYGSLTCGKCLSFHKYVYPELKKQYIDTGTVRFIFRH 60

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
           FP    +      A C   +    Y+  +  LF+  D W+ ++N     +  A     + 
Sbjct: 61  FPTGEAAVYGARAANCTGDK----YYEMLDKLFSTTDTWVRAENREAIFVKYATSLELNS 116

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS----EGVFSKIID 223
             F TC+ ++  LD+I   +K A ++  +  TP FFI G++  G  S    E + S+ I+
Sbjct: 117 ETFVTCIRNKKHLDNILLQQKAARKELDVIGTPTFFINGSMVRGKRSFPEMEALISEAIN 176


>gi|260574056|ref|ZP_05842061.1| thiol-disulfide oxidoreductase D, putative [Rhodobacter sp. SW2]
 gi|259023522|gb|EEW26813.1| thiol-disulfide oxidoreductase D, putative [Rhodobacter sp. SW2]
          Length = 220

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 87/174 (50%), Gaps = 9/174 (5%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           + +++IG  DA VT+ EYAS TC HCA FH   FK L+  YI TGK+R+I RE   D   
Sbjct: 48  VPELAIGNPDAKVTVTEYASYTCPHCAHFHEDVFKPLKADYIDTGKVRFIFREVYFDKYG 107

Query: 115 TVAVMLARC-AEKRMDGGYWGFVSLLFNKQDDWI---NSKNYRDALLNMAKFAGFSKNDF 170
             A M+ARC  E R    Y+G   ++F  Q +W    ++    D L  + + AG      
Sbjct: 108 LWASMIARCGGEMR----YFGISGMMFETQKEWAAFSDATAVVDQLKTIGRAAGMDDATM 163

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           + CLND ++   +    +   E   I+ TP   I G  Y  +MS      I+D+
Sbjct: 164 EACLNDNDMAMAMVTAFQANMEADGIEGTPSLIINGTKYQ-NMSYAELKPILDA 216


>gi|329113342|ref|ZP_08242123.1| Putative protein-disulfide oxidoreductase [Acetobacter pomorum
           DM001]
 gi|326697167|gb|EGE48827.1| Putative protein-disulfide oxidoreductase [Acetobacter pomorum
           DM001]
          Length = 206

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 78/145 (53%), Gaps = 5/145 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  +A + + E+ S+TC HCA F   TF  ++ + I TGK+RY+  +FP D ++TVA M
Sbjct: 40  LGNPNAKIVVEEWFSLTCIHCAHFAENTFPQVQKELIDTGKIRYVFHDFPTDQLATVAAM 99

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSK--NYRDALLNMAKFAGFSKNDFDTCLNDQ 177
           +AR         Y  F S L +  D W  +K  N +D L  MA FAG   + F+  + DQ
Sbjct: 100 VARTLPPER---YEPFCSSLLSSLDRWAYTKEGNPKDELKKMAAFAGMPGDTFEKAIADQ 156

Query: 178 NILDDIKAGKKRASEDFAIDSTPVF 202
            ++  I   +  A + F  DSTP F
Sbjct: 157 QLMQFILNQQTEAQDKFHFDSTPTF 181


>gi|255261725|ref|ZP_05341067.1| thiol:disulfide interchange protein, DsbA family [Thalassiobium sp.
           R2A62]
 gi|255104060|gb|EET46734.1| thiol:disulfide interchange protein, DsbA family [Thalassiobium sp.
           R2A62]
          Length = 218

 Score =  102 bits (254), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 91/176 (51%), Gaps = 6/176 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           S +K+++IG ++AP+T+VEYAS TC HCA FH   +  L+  YI+TGK+R+I RE   D 
Sbjct: 46  SGIKEMAIGDENAPITIVEYASFTCPHCASFHANQYPQLKANYIETGKVRFIYREVYFDR 105

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSKNDF 170
               A M+ARC     D  ++    +L+ +Q +W        A  L  +    G   ++ 
Sbjct: 106 PGLWASMMARCGG---DSRFFAIADMLYARQREWTQGDGGAVASNLRKIGLSVGIDADEI 162

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D C+ D  +  ++    +  ++   + STP   I G  +  +MS G  S ++D  +
Sbjct: 163 DACMADGEMAQNLVGWYRENADADQVQSTPTLIIDGEKF-SNMSYGDLSALLDEKL 217


>gi|294084667|ref|YP_003551425.1| hypothetical protein SAR116_1098 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664240|gb|ADE39341.1| hypothetical protein SAR116_1098 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 223

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 95/166 (57%), Gaps = 4/166 (2%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   AP+ +VEY SMTC HCA FHN TF  ++   I+ G +++ +R FPLD ++     
Sbjct: 58  MGNAKAPIKVVEYFSMTCGHCANFHNVTFPKVKSDMIERGLIQFEMRPFPLDGLALRGHA 117

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           LAR         Y+  V  L ++   W+ +++   AL+ +A+ AG S  +F+  ++++ +
Sbjct: 118 LARSLPATR---YFPMVKALMSQHKQWVRAEDPLAALMKIARLAGISGAEFNKIMSNRAL 174

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGN-LYLGDMSEGVFSKIIDS 224
           L+ +   ++ A +D+ + STP F I  + L  G+M+   F++ I++
Sbjct: 175 LEKLVEMRQAALDDWNVSSTPSFVINDDKLLSGNMNYETFAEEINA 220


>gi|209963843|ref|YP_002296758.1| protein-disulfide isomerase, putative [Rhodospirillum centenum SW]
 gi|209957309|gb|ACI97945.1| protein-disulfide isomerase, putative [Rhodospirillum centenum SW]
          Length = 227

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 110/223 (49%), Gaps = 22/223 (9%)

Query: 25  YTRKGSALNELPIPDGVVDFRAL-----LAASPSTM---------KDVSIGQKDAPVTMV 70
           +TR+G  L  L +  G+V    L     LA  P+++         +D  IG   AP+T++
Sbjct: 9   WTRRGF-LGALALAAGIVALPLLAGPSALAQQPASLPGFDLARATEDKVIGDPKAPITII 67

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC-AEKRMD 129
           EYAS+TC HCA  H      ++ ++I TG+ + I R+FP+D V+  A M +RC A +R  
Sbjct: 68  EYASLTCSHCAHMHTDILPRIKAEFIDTGQAKLIFRDFPMDQVALTASMFSRCVAPER-- 125

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
             Y+  +S LF  Q  W  +K+    +   A+ AG +    + CL+++ +   I   +  
Sbjct: 126 --YFSMLSALFKSQKAWFAAKDPLAEVGKTARMAGLTPEQQEACLSNKQLETHILQTRLD 183

Query: 190 ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             + + I  TP   +     + D +     ++I+++++   +R
Sbjct: 184 GIKKYNISGTPTLILNDGAVVIDGARE--EELINALVKLGAKR 224


>gi|83950888|ref|ZP_00959621.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseovarius nubinhibens ISM]
 gi|83838787|gb|EAP78083.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseovarius nubinhibens ISM]
          Length = 331

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 95/175 (54%), Gaps = 7/175 (4%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           ++ +G +DA VT++EYAS TC HCA FH   FK L+  YI TGK+R++ R+   D     
Sbjct: 161 EMVLGNEDAKVTVMEYASFTCPHCASFHENQFKQLKADYIDTGKIRFVYRDVYFDRYGLW 220

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN---YRDALLNMAKFAGFSKNDFDTC 173
           A M+ARC        ++G  +LL+ +Q +W+++++     + L  + + AG   +    C
Sbjct: 221 AAMVARC---EGPSKFFGISNLLYEQQREWMDTQDPVKTSENLRRLGRIAGLDGDKLTAC 277

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           L D++    + +  +  SE   I STP   I G  + G+M+     ++I++ + +
Sbjct: 278 LEDEDKARALVSWWQENSEADDISSTPTLLINGESH-GNMNYADLKELIEAELAE 331


>gi|51473314|ref|YP_067071.1| hypothetical protein RT0103 [Rickettsia typhi str. Wilmington]
 gi|81610835|sp|Q68XQ3|DSB_RICTY RecName: Full=Putative protein-disulfide oxidoreductase RT0103;
           Flags: Precursor
 gi|51459626|gb|AAU03589.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 270

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 89/175 (50%), Gaps = 3/175 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 97  DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPALKKKYIDTNKIAYVVREFIATKQDLD 156

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +  F +++  +QD W  S  YR+ L ++ +  G S  ++  CLN 
Sbjct: 157 AAILARC--KGDINSFIQFHNIILQQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNS 214

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
             I + + A     ++      TP FF+ G +   + S    S+ +D  ++D T+
Sbjct: 215 DKITETLIANTNLVAKAPKFIGTPSFFVNG-VQTENYSIDNISRAVDRALEDETK 268


>gi|258542170|ref|YP_003187603.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633248|dbj|BAH99223.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636307|dbj|BAI02276.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639360|dbj|BAI05322.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642416|dbj|BAI08371.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645471|dbj|BAI11419.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648524|dbj|BAI14465.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651577|dbj|BAI17511.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654568|dbj|BAI20495.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-12]
          Length = 206

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 77/145 (53%), Gaps = 5/145 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  +A + + E+ S+TC HCA F   TF  ++ + I TGK+RYI  +FP D ++TVA M
Sbjct: 40  LGNPNAKIVVEEWFSLTCIHCAHFAENTFPQVQKELIDTGKIRYIFHDFPTDQLATVAAM 99

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDW--INSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
           +AR         Y  F S L +  D W  I   + +D L  MA FAG   + F+  + DQ
Sbjct: 100 VARTLPPER---YEPFCSSLLSSLDRWAYIKEGSPKDELKKMAAFAGMPGDTFEKAIADQ 156

Query: 178 NILDDIKAGKKRASEDFAIDSTPVF 202
            ++  I   +  A + F  DSTP F
Sbjct: 157 QLMQFILNQQTEAQDKFHFDSTPTF 181


>gi|89052888|ref|YP_508339.1| DsbA family thiol:disulfide interchange protein [Jannaschia sp.
           CCS1]
 gi|88862437|gb|ABD53314.1| thiol:disulfide interchange protein DsbA family [Jannaschia sp.
           CCS1]
          Length = 227

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 106/230 (46%), Gaps = 18/230 (7%)

Query: 7   RIGVLGGIV-LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDV---SIGQ 62
           R  +LGG   +L   +Y  +  +G    +   P  +  F A  A   + + DV   S G 
Sbjct: 4   RAMLLGGATGILGAGAYLLWNGRGGQRFQTEAP--LTPFTAANAQEATDLPDVLEMSKGN 61

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            D+ VT++EYAS TC HC  FH   +  L   YI+ G + ++ RE   D     A M+AR
Sbjct: 62  PDSGVTLIEYASFTCPHCRSFHTNVYPDLNRDYIEPGLINFVYREVYFDRYGLWAGMVAR 121

Query: 123 CAEKRMDGG---YWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSKNDFDTCLNDQ 177
           C      GG   Y+G V L++ +Q +W        A  L  + + AG S  + D C+ D 
Sbjct: 122 C------GGPLRYFGIVDLIYAQQSEWTQGSPAEIAENLKRIGRAAGLSNEELDACMTDA 175

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + + + A  +   E+  I  TP F + G +  G+M+       +D+ I+
Sbjct: 176 AMAEAMIANYEAQMEEHPIAGTPAFVLNGEMS-GNMNYNELRGRLDAAIE 224


>gi|259417523|ref|ZP_05741442.1| thiol:disulfide interchange protein, DsbA family [Silicibacter sp.
           TrichCH4B]
 gi|259346429|gb|EEW58243.1| thiol:disulfide interchange protein, DsbA family [Silicibacter sp.
           TrichCH4B]
          Length = 230

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 6/158 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+ ++  G +DAPVT++EYAS TC HCA FH   +K L+ +YI TGK+++I RE   D 
Sbjct: 56  STIIEMVQGAEDAPVTLIEYASYTCPHCANFHEGAYKKLKAEYIDTGKVKFIYREVYFDR 115

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS---KNYRDALLNMAKFAGFSKND 169
               A M+ARC  +     ++G    +F +Q +W  +       DAL  + + AG     
Sbjct: 116 FGLWASMVARCGGEEK---FFGITDRIFKQQSEWTRAGGPAEMVDALKKIGRVAGIDNEQ 172

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            + C+ D      +    +  +    ++STP F + G 
Sbjct: 173 LEACMQDATKAQTLVTWYQENATKDEVESTPSFILNGT 210


>gi|218660391|ref|ZP_03516321.1| DSBA oxidoreductase [Rhizobium etli IE4771]
          Length = 190

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 86/159 (54%), Gaps = 5/159 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  +G   APVT++EY+S TC HC ++  +    +E +++  GK R I R F  ++V  V
Sbjct: 21  DRPVGSASAPVTIIEYSSPTCSHCVDYRTQVAPEIEKEFVARGKARLIFRPFVRNNVDMV 80

Query: 117 AVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
             ML  CA +  DG  +    +L ++K DD   S +    + ++A  AG  ++ FD  ++
Sbjct: 81  IFML--CAWQ--DGAKFEELTNLFYSKYDDIAQSGDIEKTIRDIAGSAGIDRSAFDRLVS 136

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           DQ+ LD +     +A EDF ++ TP FF+ G  + G  S
Sbjct: 137 DQSTLDGLTKLTSQAREDFEVEGTPTFFVNGKKFTGAQS 175


>gi|254451654|ref|ZP_05065091.1| thiol-disulfide oxidoreductase D, Putative [Octadecabacter
           antarcticus 238]
 gi|198266060|gb|EDY90330.1| thiol-disulfide oxidoreductase D, Putative [Octadecabacter
           antarcticus 238]
          Length = 221

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 93/177 (52%), Gaps = 9/177 (5%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           +++ G  DA V ++EYAS TC HCA FH   ++ +++ YI TG + +  RE   D+    
Sbjct: 49  EMTQGNPDASVQVLEYASYTCPHCASFHADQYQQIKENYIDTGLIGFTYREVYFDAPGLW 108

Query: 117 AVMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRD---ALLNMAKFAGFSKNDFDT 172
           A M+ARC  E R    ++G  SLL+  Q DW   ++  +   +L N+ K AG S  + D 
Sbjct: 109 ASMVARCGGEMR----FFGISSLLYENQQDWARGESGEEIITSLRNIGKVAGLSDAELDV 164

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           CL D+    ++    +  ++   +  TP F I G  Y  +M+   F++++   + +S
Sbjct: 165 CLTDEAKAQELTGWYRSNADADDVQGTPTFLINGEKY-SNMNYADFAEVLGEKLAES 220


>gi|167648327|ref|YP_001685990.1| DSBA oxidoreductase [Caulobacter sp. K31]
 gi|167350757|gb|ABZ73492.1| DSBA oxidoreductase [Caulobacter sp. K31]
          Length = 211

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 89/168 (52%), Gaps = 5/168 (2%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           A  A  P+   D+ +G   A V +VEYAS++C HCA ++N+ F   + ++I TGK+RY+ 
Sbjct: 25  ARAAPLPAAEGDMVLGSPKAKVQVVEYASLSCTHCAHWNNEVFPAFKTRFIDTGKVRYVF 84

Query: 106 REFPLDSVSTVAV--MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           REF  +     A   +LAR   +     Y+  +  +F++Q     S++    LL + K  
Sbjct: 85  REFLTEPYPFAAAGYLLAR---RVGPAKYFEVIDTVFHQQAAIFQSEDLWGGLLKIGKGF 141

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           G ++  F T L D+  LD + A   +A+E   ++ TP FF+ G  + G
Sbjct: 142 GLTEAQFTTALQDKAALDAVNARVAKAAERDKVEVTPTFFVNGQRFEG 189


>gi|15603904|ref|NP_220419.1| hypothetical protein RP025 [Rickettsia prowazekii str. Madrid E]
 gi|81859425|sp|Q9ZEB9|DSB_RICPR RecName: Full=Putative protein-disulfide oxidoreductase RP025;
           Flags: Precursor
 gi|3860595|emb|CAA14496.1| unknown [Rickettsia prowazekii]
 gi|292571620|gb|ADE29535.1| Protein-disulfide isomerase [Rickettsia prowazekii Rp22]
          Length = 272

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 87/176 (49%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 96  DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVIREFIATKQDLD 155

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +  F +++  +QD W  S  YR+ L ++ +  G    ++  CLN 
Sbjct: 156 AAILARC--KGDINSFIQFHNIILQQQDKWAYSNKYRELLTDIGQLGGIPPEEYKQCLNS 213

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I   + A     ++      TP FF+ G +   + S    SK +D  + D T++
Sbjct: 214 DKITATLIANTNLVAKAPKFIGTPSFFVNG-VQTENYSIDNISKAVDKALDDETKK 268


>gi|295687465|ref|YP_003591158.1| putative disulfide isomerase [Caulobacter segnis ATCC 21756]
 gi|295429368|gb|ADG08540.1| putative disulfide isomerase [Caulobacter segnis ATCC 21756]
          Length = 202

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 92/164 (56%), Gaps = 11/164 (6%)

Query: 49  AASPSTMKD-VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           A++P+ M D +S+G KDA +T+VEYAS+ C  CA +  + +   + KYI TGK+RY+ RE
Sbjct: 22  ASAPTAMADDMSLGNKDAKITVVEYASVGCPVCAAWQKEVYPAFKAKYIDTGKVRYVFRE 81

Query: 108 FPLDSVSTVAV-----MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
             +   S V V     +LARCA K     Y+  V  +F  Q    ++   R+ LL +AK 
Sbjct: 82  MLVGGGSEVTVASAGFLLARCAGKEK---YFPVVDAVFASQPGVFDTP--RETLLEIAKS 136

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
           +G S++ F  C+ D+  +  + A  +R + +  + +TP F I G
Sbjct: 137 SGMSEDQFTQCVTDEAQIKALNARVERNASENDVTATPTFEING 180


>gi|91206103|ref|YP_538458.1| protein-disulfide isomerase [Rickettsia bellii RML369-C]
 gi|117940092|sp|Q1RGZ5|DSB_RICBR RecName: Full=Putative protein-disulfide oxidoreductase RBE_1288;
           Flags: Precursor
 gi|91069647|gb|ABE05369.1| Protein-disulfide isomerase [Rickettsia bellii RML369-C]
          Length = 259

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 89/176 (50%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G KD+ + +VEY S TC HCA +H+  F  L+ KYI T K+ Y+ REF        
Sbjct: 84  DMVLGNKDSKIVVVEYFSPTCPHCAYYHSTIFPELKQKYIDTNKIAYVTREFIATKQDLD 143

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +  F  ++  +QD W  S  YR+ L ++ +  G +  ++  CL+D
Sbjct: 144 ASILARC--KGDINSFMLFHDIILKQQDKWSVSNKYRELLTDIGQLGGVTPEEYKKCLSD 201

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I + + A     ++      TP FF+ G +   + S    S  ID  I++S  +
Sbjct: 202 DKITETLIANTNFITKAPKFIGTPSFFVNG-VQTENYSINSISAAIDKAIEESKNK 256


>gi|157803211|ref|YP_001491760.1| protein-disulfide isomerase [Rickettsia canadensis str. McKiel]
 gi|157784474|gb|ABV72975.1| Protein-disulfide isomerase [Rickettsia canadensis str. McKiel]
          Length = 274

 Score = 98.6 bits (244), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 86/182 (47%), Gaps = 6/182 (3%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMK----DVSIGQKDAPVTMVEYASMTCFHCAEFH 84
            +  NE+  PD        +     T K    D+ +G K + V ++EY S TC HCA +H
Sbjct: 67  NNQTNEVSTPDSQEHKDPKIKPIKVTFKVDDNDMVLGNKKSNVIVIEYFSPTCPHCAYYH 126

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
              F  L+ KYI T K+ Y++REF        A +LARC  K     +  F +++  +QD
Sbjct: 127 QTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAILARC--KGDINSFVQFHNIILKQQD 184

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W  S  YR+ L ++ K  G S  ++  CLN   I + + A     ++      TP FF+
Sbjct: 185 KWAYSNKYRELLTDIGKLGGISPEEYKQCLNSDKITETLIANTNLVAKTPKFIGTPSFFV 244

Query: 205 GG 206
            G
Sbjct: 245 NG 246


>gi|16124629|ref|NP_419193.1| hypothetical protein CC_0374 [Caulobacter crescentus CB15]
 gi|221233317|ref|YP_002515753.1| thiol:disulfide interchange protein DsbA [Caulobacter crescentus
           NA1000]
 gi|13421529|gb|AAK22361.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220962489|gb|ACL93845.1| thiol:disulfide interchange protein dsbA [Caulobacter crescentus
           NA1000]
          Length = 202

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 84/172 (48%), Gaps = 6/172 (3%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--P 109
           P    D+ +G   APV  V YAS +C HCA +       +   +I TGK+R + REF  P
Sbjct: 28  PPAPGDMVLGAATAPVQFVVYASPSCGHCAHWWTTELPAIRKTFIDTGKVRLVFREFLTP 87

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
            +  +    +LAR    R+ G Y+  ++ +F K++    S    + L  +A+  G ++  
Sbjct: 88  PNEFAAAGFLLAR----RVPGKYFEVLTTVFQKRETIFESGRLWEGLQAIAQQYGLTEAQ 143

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
           F T +ND   LD +    +RA  +  ++ TP FF+ G  Y G+      SKI
Sbjct: 144 FTTAMNDTKALDGVNTRFRRAIGEDQVEVTPTFFVNGAPYEGEADLAALSKI 195


>gi|295841118|dbj|BAJ06944.1| disulfide isomerase [uncultured bacterium]
 gi|295841176|dbj|BAJ06977.1| disulfide isomerase [uncultured bacterium]
          Length = 197

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 83/182 (45%), Gaps = 4/182 (2%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           L  S +  ++VS+G   APVT++EY S+TC  C  FH   +  L+ +YI TG +R+I R 
Sbjct: 19  LMVSSALSEEVSLGSNQAPVTIIEYGSLTCGKCLSFHRHVYPKLKKQYIDTGTVRFIFRH 78

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
           FP    +        C   +    Y+  +  LF+  D WI ++N     +  A     + 
Sbjct: 79  FPTGEAAVYGARAVNCTGDK----YYEMLDKLFSTTDKWIRAENREAIFVKYATSLELNS 134

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             F TC+ ++  LD+I   +  A +   +  TP FFI   +  G  S      +I   I 
Sbjct: 135 EAFVTCIRNKKHLDNILLQQNAARKHLDVIGTPTFFINEKIVRGKRSFLEMEALISEAIN 194

Query: 228 DS 229
            S
Sbjct: 195 KS 196


>gi|157826464|ref|YP_001495528.1| protein-disulfide isomerase [Rickettsia bellii OSU 85-389]
 gi|157801768|gb|ABV78491.1| Protein-disulfide isomerase [Rickettsia bellii OSU 85-389]
          Length = 254

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 89/176 (50%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G KD+ + +VEY S TC HCA +H+  F  L+ KYI T K+ Y+ REF        
Sbjct: 79  DMVLGNKDSKIVVVEYFSPTCPHCAYYHSTIFPELKQKYIDTNKIAYVTREFIATKQDLD 138

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +  F  ++  +QD W  S  YR+ L ++ +  G +  ++  CL+D
Sbjct: 139 ASILARC--KGDINSFMLFHDIILKQQDKWSVSNKYRELLTDIGQLGGVTPEEYKKCLSD 196

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I + + A     ++      TP FF+ G +   + S    S  ID  I++S  +
Sbjct: 197 DKITETLIANTNFITKAPKFIGTPSFFVNG-VQTENYSINSISAAIDKAIEESKNK 251


>gi|295841092|dbj|BAJ06931.1| disulfide isomerase [uncultured bacterium]
          Length = 179

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 83/182 (45%), Gaps = 4/182 (2%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +  S +  ++VS+G   APVT++EY S+TC  C  FH   +  L+ +YI TG +R+I R 
Sbjct: 1   MMVSSALSEEVSLGSNQAPVTIIEYGSLTCGKCLSFHRHVYPKLKKQYIDTGTVRFIFRH 60

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
           FP    +        C   +    Y+  +  LF+  D WI ++N     +  A     + 
Sbjct: 61  FPTGEAAVYGARAVNCTGDK----YYEMLDKLFSTTDKWIRAENREAIFVKYATSLELNS 116

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             F TC+ ++  LD+I   +  A +   +  TP FFI   +  G  S      +I   I 
Sbjct: 117 EAFVTCIRNKKHLDNILLQQNAARKHLDVIGTPTFFINEKIVRGKRSFLEMEALISEAIN 176

Query: 228 DS 229
            S
Sbjct: 177 KS 178


>gi|157825169|ref|YP_001492889.1| protein-disulfide isomerase [Rickettsia akari str. Hartford]
 gi|157799127|gb|ABV74381.1| Protein-disulfide isomerase [Rickettsia akari str. Hartford]
          Length = 312

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 88/178 (49%), Gaps = 3/178 (1%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           + D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF      
Sbjct: 131 VNDMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQD 190

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
             A +LARC  K     +  F +++  +QD W  S  YR+ L ++ +  G    ++  CL
Sbjct: 191 LDAAILARC--KGDINSFVQFHNIILQQQDKWAYSNKYRELLTDIGQLGGVPPEEYKQCL 248

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           N   I + + A     ++      TP FF+ G +  G+ S    S  +D  +++   +
Sbjct: 249 NSDKITETLIANTNFVAKAPKFIGTPSFFVNG-VQTGNYSIDSISTAVDKALEEQKEK 305


>gi|126730849|ref|ZP_01746658.1| thiol:disulfide interchange protein, DsbA family [Sagittula
           stellata E-37]
 gi|126708565|gb|EBA07622.1| thiol:disulfide interchange protein, DsbA family [Sagittula
           stellata E-37]
          Length = 228

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 103/227 (45%), Gaps = 15/227 (6%)

Query: 12  GGIVLLFIAS----YFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           G +V L +A+    Y     +G+  N + +P       +      ST+ ++ +G  DAPV
Sbjct: 7   GALVALGLAAGGAWYITQGAQGTGAN-IALPGAANAQESTAEVDTSTITEMVMGDPDAPV 65

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            ++EYAS TC HCA         L+  Y+ TGK+++I RE   D       M+ARC    
Sbjct: 66  EVIEYASYTCPHCANAAKTLIPELKKNYVDTGKVKFIYREVYFDKYGMWGSMIARCGGPE 125

Query: 128 MDGGYWGFVSLLFNKQDDWI------NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
               ++G   L++  QD  +      N     D L  + + AG      D CL D + L 
Sbjct: 126 K---FFGITDLIYKGQDTILAPARDGNDAGVADELRKIGRIAGIDNEQLDACLADGDKLR 182

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            +    +  ++   IDSTP F I G  Y  +M+   FSKI+D  + +
Sbjct: 183 TLLVWFQENAKRDGIDSTPSFIIDGEKY-SNMNYRDFSKILDEKLGE 228


>gi|67458424|ref|YP_246048.1| protein-disulfide isomerase [Rickettsia felis URRWXCal2]
 gi|75537101|sp|Q4UNH3|DSB_RICFE RecName: Full=Putative protein-disulfide oxidoreductase RF_0032;
           Flags: Precursor
 gi|67003957|gb|AAY60883.1| Protein-disulfide isomerase [Rickettsia felis URRWXCal2]
          Length = 278

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 86/176 (48%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 99  DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLD 158

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +  F +++  +QD W  S  YR+ L ++ +  G    ++  CLN 
Sbjct: 159 AAILARC--KGDINSFVQFHNIILQQQDKWAYSNKYRELLTDIGQLGGVPPEEYKQCLNS 216

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I + + A     +       TP FF+ G +  G+ S    S  +D  +++   +
Sbjct: 217 DKITETLIANTNFVANAPKFIGTPSFFVNG-VQTGNYSIDSISTAVDKALEEQKEK 271


>gi|85703950|ref|ZP_01035053.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseovarius sp. 217]
 gi|85671270|gb|EAQ26128.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseovarius sp. 217]
          Length = 202

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 92/185 (49%), Gaps = 12/185 (6%)

Query: 50  ASPSTMK--DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           A+P T +  ++++G +DA VT++EYAS TC HCA FH    K L+  YI T K+ ++ R+
Sbjct: 24  AAPDTSQIVEMTMGPEDAKVTIIEYASFTCPHCANFHKGPLKQLKADYIDTDKVHFVYRD 83

Query: 108 FPLDSVSTVAVMLARC--AEKRMDGGYWGFVSLLFNKQDDWINSK--NYRDALLNMAKFA 163
              D     A M+ARC  AEK     ++G   +++ +Q +W   +     D L  + K A
Sbjct: 84  VYFDRFGLWASMVARCGGAEK-----FFGISDMIYEQQAEWTKGEPAEIADNLRRIGKVA 138

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G   +  + CLND      + A  +  +E   + STP   I    Y  +M+      IID
Sbjct: 139 GLEPDALEACLNDNEKAKTLVAWYQENAEAHEVTSTPTLVINEQKY-ANMAYDELRAIID 197

Query: 224 SMIQD 228
             + +
Sbjct: 198 EKLAE 202


>gi|302383805|ref|YP_003819628.1| DSBA oxidoreductase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194433|gb|ADL02005.1| DSBA oxidoreductase [Brevundimonas subvibrioides ATCC 15264]
          Length = 213

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 87/166 (52%), Gaps = 8/166 (4%)

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV--ML 120
           + A VT++EYAS+TC HCA + N+ +   + KY+ T K+RY+ REFP   V   A   ++
Sbjct: 51  EGAKVTVIEYASVTCSHCATWQNEVYPEFKAKYVDTNKVRYVFREFPTPPVPIAAAGFLV 110

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCA       Y+  +  +   Q +   S   R  LL +A  AG S+  F TC+ DQ  +
Sbjct: 111 ARCAGADK---YFPVIHEIMASQAELF-SGPPRPVLLRIANGAGLSEEQFQTCVTDQAGI 166

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + + A + +A     ++ TP FF+ G   + D S    S  ID+ +
Sbjct: 167 EAMDA-RIKAGIAAGVEGTPTFFVNGE-KVADTSLAGLSSKIDAAL 210


>gi|157964090|ref|YP_001498914.1| protein-disulfide isomerase [Rickettsia massiliae MTU5]
 gi|157843866|gb|ABV84367.1| Protein-disulfide isomerase [Rickettsia massiliae MTU5]
          Length = 282

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 87/176 (49%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 103 DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLD 162

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +    +++  +QD W  S  YR+ L ++ +  G S  ++  CLN+
Sbjct: 163 AAILARC--KGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNN 220

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I + + A     ++      TP FF+ G +  G  S    S  +D  +++   +
Sbjct: 221 DKITEILIANTNFVAKAPQFIGTPSFFVNG-VQTGSYSIDTISTAVDKALEEQKEK 275


>gi|239948444|ref|ZP_04700197.1| protein-disulfide oxidoreductase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922720|gb|EER22744.1| protein-disulfide oxidoreductase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 278

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 87/176 (49%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y+ REF        
Sbjct: 99  DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVAREFIATKQDLD 158

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +  F +++  +QD W  S  YR+ L ++ +  G S  ++  CLN 
Sbjct: 159 AAILARC--KGDIDSFVQFHNIILKQQDKWAYSNKYRELLTDIGQLGGVSPEEYKQCLNS 216

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I + + A     ++      TP FF+ G +  G+ S    S  +D  +++   +
Sbjct: 217 DKITETLIANTNFVAKAPKFIGTPSFFVNG-VQTGNYSIDNISTAVDKALEEQKEK 271


>gi|240142680|ref|YP_002967193.1| hypothetical protein MexAM1_META2p1072 [Methylobacterium extorquens
           AM1]
 gi|240012627|gb|ACS43852.1| Hypothetical protein MexAM1_META2p1072 [Methylobacterium extorquens
           AM1]
          Length = 195

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 82/171 (47%), Gaps = 7/171 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +AA+ S++ D ++G      T+  Y SM C  CAEFH KT   +       G+LR + RE
Sbjct: 27  IAATGSSLPDKAMGTGAQ--TLYVYMSMGCPSCAEFHRKTIAEVRRVLADAGRLRIVYRE 84

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
           FPLD  S  A MLAR A  R    Y+  + LLF +Q  W+ +K+   A   +A   G   
Sbjct: 85  FPLDGRSYAAAMLARQAGDR----YFEALDLLFAEQAFWMQAKDSGSAFRTLAARLGLPP 140

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
               T   D+ + D I A +K A     +  TP  F+ G +Y G +   V 
Sbjct: 141 GIVGTVATDRPLFDGIAAIRKHAIT-LGVSGTPTLFVQGEMYEGGLPAPVL 190


>gi|99082483|ref|YP_614637.1| DsbA family thiol:disulfide interchange protein [Ruegeria sp.
           TM1040]
 gi|99038763|gb|ABF65375.1| thiol:disulfide interchange protein DsbA family [Ruegeria sp.
           TM1040]
          Length = 233

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 81/157 (51%), Gaps = 6/157 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+ ++  G +DAPVT++EY+S TC HCA FH   +K L+ +YI TGK++ + RE   D 
Sbjct: 59  STIMEMVQGAEDAPVTLIEYSSYTCPHCANFHADAYKKLKAEYIDTGKVKLVYREVYFDR 118

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS---KNYRDALLNMAKFAGFSKND 169
               A M+ARC  +     ++G   L+F +Q +W  +       +AL  + + AG   + 
Sbjct: 119 FGLWASMVARCGGEEK---FFGITDLIFKQQAEWTRAGGPAEMVEALKKIGRVAGVDGDA 175

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            + CL D      +    +  +    I STP F + G
Sbjct: 176 LEACLQDATKAQTLVTWYQENATKDDISSTPSFILNG 212


>gi|296116299|ref|ZP_06834915.1| DSBA oxidoreductase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977118|gb|EFG83880.1| DSBA oxidoreductase [Gluconacetobacter hansenii ATCC 23769]
          Length = 206

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 74/147 (50%), Gaps = 7/147 (4%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G   A V + E+ S+TC HCA F  + F  +  K I TGK+ YI R+FPLD V+  A 
Sbjct: 39  ALGNPSAKVHVEEWFSLTCTHCARFSEEVFPEVRSKLIDTGKVYYIFRDFPLDQVALSAA 98

Query: 119 MLARCAEKRMDGG-YWGFVSLLFNKQDDWINSK--NYRDALLNMAKFAGFSKNDFDTCLN 175
           M+AR     + G  Y  FV  L   QD W   K  N +D L  MA  AG S + F   L 
Sbjct: 99  MIARS----LPGDRYEAFVLALLASQDRWAFGKDVNPQDELRKMAALAGMSADLFQQTLA 154

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVF 202
           D  +   I   + RA   + ID TP F
Sbjct: 155 DDKLRHAIMDEEDRAQAQYKIDGTPTF 181


>gi|254512414|ref|ZP_05124481.1| thiol:disulfide interchange protein, DsbA family [Rhodobacteraceae
           bacterium KLH11]
 gi|221536125|gb|EEE39113.1| thiol:disulfide interchange protein, DsbA family [Rhodobacteraceae
           bacterium KLH11]
          Length = 221

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 78/157 (49%), Gaps = 6/157 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+ ++  G +DAPV ++EYAS TC HCA FH   +K L+  +I TGK+++  RE   D 
Sbjct: 47  STIVEMVQGAEDAPVEIIEYASYTCPHCANFHQGAYKQLKKDFIDTGKVKFTYREVYFDR 106

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS---KNYRDALLNMAKFAGFSKND 169
               A M+ARCA       ++G   L++  Q +W  +       D L  + + AG   + 
Sbjct: 107 YGLWASMVARCAGPEK---FFGITDLIYQGQSEWTRAGGPTEIVDELRKIGRLAGIDNDQ 163

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            + CL D      + A  +  +E   +  TP F + G
Sbjct: 164 LEACLQDGTRAQTLVAWYQENAERDDVQGTPSFVVNG 200


>gi|149203474|ref|ZP_01880444.1| thiol:disulfide interchange protein, DsbA family [Roseovarius sp.
           TM1035]
 gi|149143307|gb|EDM31346.1| thiol:disulfide interchange protein, DsbA family [Roseovarius sp.
           TM1035]
          Length = 202

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 83/164 (50%), Gaps = 7/164 (4%)

Query: 50  ASPSTMK--DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           A+P T +  ++++G +DA VT++EYAS TC HCA FH    K L+ +YI T K+ +I R+
Sbjct: 24  AAPDTSQIVEMTMGPEDAKVTIIEYASFTCPHCANFHKGPLKQLKAEYIDTDKVHFIYRD 83

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN--YRDALLNMAKFAGF 165
              D     A M+ARC        ++G   +++ +Q +W   +     D L  + K AG 
Sbjct: 84  VYFDRFGLWASMVARCGGPEK---FFGISDMIYEQQGEWTQGEPAAIADNLRRIGKVAGL 140

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
             +  + CLND      + A  +  +E   ++STP   I    Y
Sbjct: 141 EPDAVEACLNDTEKAKALVAWYQENAEAHGVESTPTLVINEQKY 184


>gi|56698269|ref|YP_168642.1| DsbA family thiol:disulfide interchange protein [Ruegeria pomeroyi
           DSS-3]
 gi|56680006|gb|AAV96672.1| thiol:disulfide interchange protein, DsbA family [Ruegeria pomeroyi
           DSS-3]
          Length = 222

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 80/157 (50%), Gaps = 6/157 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           S++ ++  G +DAPV ++EYAS TC HCA FH   +K L+  +I TGK+R+I RE   D 
Sbjct: 48  SSIVEMVQGAEDAPVEVIEYASYTCPHCAAFHEGPYKKLKADFIDTGKVRFIYREVYFDR 107

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS---KNYRDALLNMAKFAGFSKND 169
               A M+ARCA       ++G   L++  Q +W  +       + L  + + AG   + 
Sbjct: 108 YGLWASMVARCAGPEK---FFGISDLIYKGQAEWSRAGGPAEIAEELRKIGRLAGIENDK 164

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            + CL D      + A  +  +    I+STP F I G
Sbjct: 165 LEACLGDATKAQTLVAWYQEHATRDDINSTPSFMING 201


>gi|157827899|ref|YP_001494141.1| hypothetical protein A1G_00185 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932587|ref|YP_001649376.1| thiol:disulfide interchange protein [Rickettsia rickettsii str.
           Iowa]
 gi|157800380|gb|ABV75633.1| hypothetical protein A1G_00185 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907674|gb|ABY71970.1| thiol:disulfide interchange protein [Rickettsia rickettsii str.
           Iowa]
          Length = 277

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 86/176 (48%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 98  DMVLGNKKSNVIVVEYFSPTCPHCAYYHKTIFPELKKKYIDTNKIAYVVREFIATKQDLD 157

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +    +++  +QD W  S  YR+ L ++ +  G S  ++  CLN+
Sbjct: 158 AAILARC--KGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNN 215

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I   + A     ++      TP FF+ G +  G  S    S  ID  +++   +
Sbjct: 216 DKITAILIANTNFVAKAPQFIGTPSFFVNG-VQTGSYSIDTISTAIDKALEEQKEK 270


>gi|254440062|ref|ZP_05053556.1| hypothetical protein OA307_4932 [Octadecabacter antarcticus 307]
 gi|198255508|gb|EDY79822.1| hypothetical protein OA307_4932 [Octadecabacter antarcticus 307]
          Length = 222

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 98/204 (48%), Gaps = 9/204 (4%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
           LN  P           L A+   + ++  G  DA V ++EYAS TC HCA FH   +  +
Sbjct: 24  LNRTPASAQSSGAAETLEAAQFDVVEMIQGNPDAAVQVLEYASFTCPHCASFHADQYPQI 83

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +  YI TG + +  RE   D+    A M+ARC  E R    ++G  +LL+  Q DW   +
Sbjct: 84  KANYIDTGLIGFTYREVYFDAPGLWASMIARCGGEMR----FFGISNLLYENQQDWARGE 139

Query: 151 NYRD---ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           +  D   +L N+ K AG +  + D CL D+    ++    +  ++   +  TP F I G 
Sbjct: 140 SGEDIITSLRNIGKVAGLTDAELDVCLTDEAKAQELTGWYRFNADADDVQGTPTFLINGE 199

Query: 208 LYLGDMSEGVFSKIIDSMIQDSTR 231
            Y  +M+   F+++++  + ++  
Sbjct: 200 KY-SNMNYADFAEVLEEKMAEANE 222


>gi|15891952|ref|NP_359666.1| hypothetical protein RC0029 [Rickettsia conorii str. Malish 7]
 gi|81854135|sp|Q92JN8|DSB_RICCN RecName: Full=Putative protein-disulfide oxidoreductase RC0029;
           Flags: Precursor
 gi|15619063|gb|AAL02567.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 277

 Score = 95.1 bits (235), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 87/176 (49%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 98  DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLD 157

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +    +++  +QD W  S  YR+ L ++ +  G S  ++  CLN+
Sbjct: 158 AAILARC--KGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNN 215

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I   + A     ++      TP FF+ G +  G+ S    S  +D  +++   +
Sbjct: 216 DKITAILIANTNFVAKAPQFIGTPSFFVNG-VQTGNYSIDTISTAVDKALEEQKEK 270


>gi|328950917|ref|YP_004368252.1| DSBA oxidoreductase [Marinithermus hydrothermalis DSM 14884]
 gi|328451241|gb|AEB12142.1| DSBA oxidoreductase [Marinithermus hydrothermalis DSM 14884]
          Length = 214

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 104/227 (45%), Gaps = 35/227 (15%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYA 73
           I  LF A  F +TR                  AL A  P+     ++G+ DAP+T+VE+A
Sbjct: 12  IATLFTAGLFVFTRP-----------------ALPAEDPAAGAHFAVGRPDAPITVVEFA 54

Query: 74  SMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM---DG 130
           +  C HC     +    +   Y++TGK+RY+ R+FP     T   ++            G
Sbjct: 55  NYQCPHCRTHALEVLPRILRDYVETGKVRYVFRDFPFKGAPTYRPVVRAGEAAACAADQG 114

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDAL----LNMAKFAGFSKNDFDTCL----NDQNILDD 182
            Y  + +LLF  Q  W   +   +AL    ++ A   G  +  F  CL     ++ +L+D
Sbjct: 115 RYLEYHTLLFRAQGQWGRYRG--EALDRLFIDYAGQIGLDREAFAACLASGEKERIVLED 172

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +K     A+E   ++STP FFIG  +Y G +    + +++D+++ + 
Sbjct: 173 LK-----AAEALNLNSTPTFFIGDKMYRGVLPYEEWQRLLDALLAEK 214


>gi|34581010|ref|ZP_00142490.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262395|gb|EAA25899.1| unknown [Rickettsia sibirica 246]
          Length = 277

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 86/176 (48%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 98  DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLD 157

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +    +++  +QD W  S  YR+ L ++ +  G S  ++  CLN+
Sbjct: 158 AAILARC--KGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNN 215

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I   + A     ++      TP FF+ G +  G  S    S  +D  +++   +
Sbjct: 216 DKITAILIANTNFVAKAPQFIGTPSFFVNG-VQTGSYSIDTISTAVDKALEEQKEK 270


>gi|254462151|ref|ZP_05075567.1| dsba oxidoreductase:tat pathway signal [Rhodobacterales bacterium
           HTCC2083]
 gi|206678740|gb|EDZ43227.1| dsba oxidoreductase:tat pathway signal [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 198

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 90/186 (48%), Gaps = 7/186 (3%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           ++  A    + D+  G  DA V ++EYAS TC HCA FH   +K L+  Y+ TGK++++ 
Sbjct: 17  SMATAQEGDIADMVQGSPDAKVEIIEYASYTCPHCASFHAGPYKDLKKDYVDTGKVKFVF 76

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--- 162
           RE   D     A M+ARCA       ++G   LLF +Q  W  + +    +  + K    
Sbjct: 77  REVYFDRFGLWASMIARCAGPDR---FFGMTDLLFKEQSLWSRAGDPAAIVAELRKIGLK 133

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G  +   + CL D +    + A  +  +E   + STP F I G  Y  +M+   FS II
Sbjct: 134 GGMEEAQLNACLEDADNAQALVAWYQENAERDDVGSTPSFLINGEPY-SNMNYADFSAII 192

Query: 223 DSMIQD 228
           +  + +
Sbjct: 193 EENLAE 198


>gi|229586255|ref|YP_002844756.1| Protein-disulfide isomerase [Rickettsia africae ESF-5]
 gi|228021305|gb|ACP53013.1| Protein-disulfide isomerase [Rickettsia africae ESF-5]
          Length = 277

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 86/176 (48%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 98  DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLD 157

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +    +++  +QD W  S  YR+ L ++ +  G S  ++  CLN+
Sbjct: 158 AAILARC--KGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNN 215

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I   + A     ++      TP FF+ G +  G  S    S  +D  +++   +
Sbjct: 216 DKITAILIANTNFVAKAPQFIGTPSFFVNG-VQTGSYSIDTISTAVDKALEEQKEK 270


>gi|238650342|ref|YP_002916194.1| Periplasmic thiol:disulfide interchange protein DsbA [Rickettsia
           peacockii str. Rustic]
 gi|238624440|gb|ACR47146.1| Periplasmic thiol:disulfide interchange protein DsbA [Rickettsia
           peacockii str. Rustic]
          Length = 277

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 86/176 (48%), Gaps = 3/176 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF        
Sbjct: 98  DMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLD 157

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +LARC  K     +    +++  +QD W  S  YR+ L ++ +  G S  ++  CLN+
Sbjct: 158 AAILARC--KGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNN 215

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             I   + A     ++      TP FF+ G +  G  S    S  +D  +++   +
Sbjct: 216 DKITAILIANTNFVAKAPQFIGTPSFFVNG-VQTGSYSIDTISTAVDKALEEQKEK 270


>gi|330994666|ref|ZP_08318589.1| Putative protein-disulfide oxidoreductase [Gluconacetobacter sp.
           SXCC-1]
 gi|329758307|gb|EGG74828.1| Putative protein-disulfide oxidoreductase [Gluconacetobacter sp.
           SXCC-1]
          Length = 211

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 89/184 (48%), Gaps = 7/184 (3%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           RA+  A+   +   ++G   A V + E+ S+TC HCA F  + F  +  + I TGK+ YI
Sbjct: 28  RAMAEAADPRLSIRAVGNPQARVRVEEWFSLTCTHCARFAAEIFPEVRSRLIDTGKVYYI 87

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI---NSKNYRDALLNMAK 161
            R+FPLD V+  A M+AR         Y  FV  L + QD W      +  ++ +  MA 
Sbjct: 88  FRDFPLDQVALTASMVARSLPPER---YEPFVLALLSSQDHWAFGKTPEESQEEIRKMAA 144

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF-FIGGNLYLGDMSEGVFSK 220
            AG S + F   ++D  +   I   + RA   + ID TP F F        +++   F+K
Sbjct: 145 LAGMSSDVFQQTIHDDTLRHAIMDEEDRAQAQYKIDGTPTFRFNDKEQVAQELTYAEFAK 204

Query: 221 IIDS 224
            +++
Sbjct: 205 KVEA 208


>gi|16124630|ref|NP_419194.1| hypothetical protein CC_0375 [Caulobacter crescentus CB15]
 gi|221233318|ref|YP_002515754.1| thiol:disulfide interchange protein DsbA [Caulobacter crescentus
           NA1000]
 gi|13421530|gb|AAK22362.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220962490|gb|ACL93846.1| thiol:disulfide interchange protein dsbA [Caulobacter crescentus
           NA1000]
          Length = 204

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 95/180 (52%), Gaps = 6/180 (3%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS- 112
           T +D+ +G  +A VT++EYAS+ C HCA ++ + F   + KYI TGK++Y+ R+      
Sbjct: 29  TAEDMVLGDPNAKVTVIEYASVACPHCATWNAEVFPAFKAKYIDTGKVKYVHRDALTGEP 88

Query: 113 -VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            ++    MLARCA K     Y+     L+  Q +   S + R  LL +A+ AG ++  F+
Sbjct: 89  RLANAGAMLARCAGKDK---YFQVTEALYRAQTNIFTSGDIRGELLTIAQAAGMNEAQFN 145

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +CL+D+N     +  +K  + D  I  TP F + G    G+         +D+ I ++++
Sbjct: 146 SCLSDENAAKSAERIEKMMT-DNNIRGTPTFEVNGKRLGGEEGGEQTLAQLDAAIAEASK 204


>gi|161528658|ref|YP_001582484.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339959|gb|ABX13046.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 247

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 101/196 (51%), Gaps = 24/196 (12%)

Query: 49  AASPSTM---KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           + +PS +    D  +G  DAP+++VE+++  C  C  F++ T   L+ +YI TGK+  I 
Sbjct: 58  SNTPSQISKDNDPLLGDPDAPLSIVEFSNFQCKFCLRFYSDTLPLLKTQYIDTGKVNLIY 117

Query: 106 REFPLDSV---STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD-ALLNMAK 161
           R+FP+  +   S  A + + CA ++  G +W +  +LF  Q  W   +N  D +LL   +
Sbjct: 118 RDFPIPKIYDNSMSAALASECANEQ--GKFWEYHDILFENQHTW--RQNESDLSLLTFKQ 173

Query: 162 FAG---FSKNDFDTCLNDQNILDDIKA--GKKRASEDFAIDSTPVFFIGGNL-----YLG 211
           FA     ++  FD+CL+     D+I +  G  R   D+A+  TP FF+G +        G
Sbjct: 174 FANTLVLNQEKFDSCLDSGKYADEINSDVGDGR---DYAVSGTPTFFVGNDKVGYSSLFG 230

Query: 212 DMSEGVFSKIIDSMIQ 227
             S   F KIID  ++
Sbjct: 231 TQSFSDFQKIIDEKLE 246


>gi|88608124|ref|YP_506766.1| hypothetical protein NSE_0900 [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600293|gb|ABD45761.1| conserved hypothetical protein [Neorickettsia sennetsu str.
           Miyayama]
          Length = 230

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 89/179 (49%), Gaps = 6/179 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ IG  DAP+T+V+Y+S +C HC     +      +KY++TGK+  I+R+FPLD +S  
Sbjct: 51  DLPIGGIDAPITIVDYSSFSCTHCKAAFERLILPTYEKYVRTGKVMLIMRDFPLDKLSFD 110

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA------LLNMAKFAGFSKNDF 170
           A +   C  K +       + L+    D    SKN  DA      +++ +   G +K  F
Sbjct: 111 ASVFLGCYRKTIMPDDERVIKLITKLFDIGNGSKNKEDAGKAFDGIVSDSNLQGNTKEKF 170

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            +C+ D  + DD+   K    +   ID TP+ FI G  Y G      F K I+ ++ +S
Sbjct: 171 LSCVEDLGVKDDVLYSKLFGIKKIGIDGTPMIFINGERYTGPFKFSSFEKKIEKILNNS 229


>gi|162147622|ref|YP_001602083.1| thioredoxin protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542253|ref|YP_002274482.1| DSBA oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786199|emb|CAP55781.1| Thioredoxin protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209529930|gb|ACI49867.1| DSBA oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 205

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 85/170 (50%), Gaps = 6/170 (3%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           + G   A V + E+ S+TC HCA F  + F  +  + I+TGK+ YI R+FPLD ++  A 
Sbjct: 38  AAGNPAAKVHVEEWFSLTCTHCARFAGEVFPEIRTRLIETGKVYYIFRDFPLDQLALAAA 97

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSK--NYRDALLNMAKFAGFSKNDFDTCLND 176
           M+AR         Y  FV  L + QD W  ++  N +D L  MA  AG   + F   + D
Sbjct: 98  MIARTLPPER---YEPFVLSLLSSQDRWAFARDVNPQDELQKMAALAGMPADLFQKTIAD 154

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG-DMSEGVFSKIIDSM 225
             +   I   + RA   + I+ TP F     + +G +M+   F++ + S+
Sbjct: 155 DTLRQAIMDEENRAQAQYKIEGTPTFRFNDKVQVGQEMTYDDFAQKVASL 204


>gi|309790379|ref|ZP_07684944.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
 gi|308227571|gb|EFO81234.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
          Length = 243

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (50%), Gaps = 3/172 (1%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  +APVT+ E+    C  C +F+ +T   L  +Y++TGK+R + R+FPL+  ++  +
Sbjct: 73  AMGDPNAPVTIYEFTDYECPFCKQFYAETRAQLITEYVETGKVRLVARDFPLEIHASAML 132

Query: 119 MLARCAEKRMDGGYWGFVSLLF-NKQDDWIN-SKNYRDALLNMAKFAGFSKNDFDTCLND 176
                        +W     LF   Q +W    K  R+ L+++A   G     F  CL+D
Sbjct: 133 AAVAGHCAAAQQNFWPMYETLFETHQVEWGGVPKRDRETLIDLATQIGIEPVAFTACLDD 192

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
                 ++A + +A+    I+STP F + G L  G +  G F ++IDS++ +
Sbjct: 193 PATEQAVQA-EMQAAMQLGINSTPNFMVNGTLLRGSLPIGSFRQLIDSLLAE 243


>gi|254797229|ref|YP_003082070.1| hypothetical protein NRI_0867 [Neorickettsia risticii str.
           Illinois]
 gi|254590459|gb|ACT69821.1| conserved hypothetical protein [Neorickettsia risticii str.
           Illinois]
          Length = 229

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 89/178 (50%), Gaps = 6/178 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G  DAP+T+V+Y+S +C HC     K    + +KY++TGK+  I+R+FPLD +S  
Sbjct: 49  DLPVGSTDAPITIVDYSSFSCTHCKAAFEKLILPVYEKYVRTGKVMLIMRDFPLDKLSFN 108

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA------LLNMAKFAGFSKNDF 170
           A +   C  K +       + L+    D    +K+  DA      +++ +   G +K  F
Sbjct: 109 ASVFLGCYRKTIIPDDEHVIRLITKLFDIGSGAKSKEDAEKMFDGIVSDSNLQGSTKEKF 168

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            +C+ D  + D++   K    +   ID TP+ FI G  Y G      F + I+ ++ D
Sbjct: 169 LSCMEDLGVKDEVLYSKLFGIKKIGIDGTPMIFINGERYTGPFKFSFFERKIEKILND 226


>gi|254419156|ref|ZP_05032880.1| hypothetical protein BBAL3_1466 [Brevundimonas sp. BAL3]
 gi|196185333|gb|EDX80309.1| hypothetical protein BBAL3_1466 [Brevundimonas sp. BAL3]
          Length = 215

 Score = 92.0 bits (227), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 93/179 (51%), Gaps = 16/179 (8%)

Query: 57  DVSIGQKD-APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV-- 113
           D+ +G  + A VT+VEYAS+TC HCA +  KT+   + KY+ T K+RYI RE P   V  
Sbjct: 42  DMGLGAAEGAKVTVVEYASVTCPHCAVWQAKTWPAFKAKYVDTNKVRYIFRELPTPPVDA 101

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           +T   ++ARCA       Y+  +  L   Q + + S + RD LL  A+ AG S+  F+ C
Sbjct: 102 ATAGFLVARCAGPDK---YFDVIHQLMATQQEMLTS-SPRDWLLRTAQAAGLSEQQFNDC 157

Query: 174 LNDQNILDDIKAGKKRA--SEDFAIDSTPVFFIGGNLYLGDMSEGV----FSKIIDSMI 226
           + D+   + + A +KR   ++   +  TP F++     +    EG      S  ID+ +
Sbjct: 158 VTDK---EAVAAMEKRVQFAQAQGVTGTPAFYVNDTQVITPGGEGASLADLSTAIDAEL 213


>gi|197104047|ref|YP_002129424.1| hypothetical protein PHZ_c0581 [Phenylobacterium zucineum HLK1]
 gi|196477467|gb|ACG76995.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 214

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 78/157 (49%), Gaps = 7/157 (4%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--PLDSVS 114
           D+S+G   APV +VEY S+TC HCA F+   F  L+ KYI TG++R+  RE      +V+
Sbjct: 41  DISVGSPKAPVHVVEYLSVTCPHCAHFNADVFPTLKAKYIDTGQVRWTFREMLTAPGNVA 100

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
               ++ARCA       Y   V  +   Q  W  S N +   L +A+  G ++  F+ CL
Sbjct: 101 AAGFLMARCAGPSK---YVKVVDEVLRSQPRW-QSGNIKPIFLEIAQANGLTEAQFEACL 156

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            D    + ++     A +D  +  TP FF+ G    G
Sbjct: 157 TDPKGQEALQQRLMLAQKD-EVTGTPTFFVNGKRVGG 192


>gi|296536551|ref|ZP_06898636.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
 gi|296263116|gb|EFH09656.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
          Length = 202

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 88/165 (53%), Gaps = 12/165 (7%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           + + S GQ+DA V +VEY S+TC HCA FH + +  ++ + + TGK+R + R+FPLD ++
Sbjct: 34  LGERSAGQEDAKV-VVEYFSLTCSHCAAFHKEVWPRVKQELVATGKVRMVWRDFPLDQLA 92

Query: 115 TVAVMLARC--AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK---FAGFSKND 169
             A  +AR   AE+     Y GF+  L   QD W  ++N  D +  +AK    AG S+  
Sbjct: 93  LAAAQVARALPAER-----YEGFIGALLATQDRWAFNRNG-DPVAEIAKVAALAGMSRAQ 146

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
            D  + D+ +   I   + R  +   ++STP F  G     G +S
Sbjct: 147 VDAAIADEGLRRGILESRLRGQQQHNVNSTPTFVFGNRPVPGALS 191


>gi|161529178|ref|YP_001583004.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160340479|gb|ABX13566.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 240

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 102/212 (48%), Gaps = 14/212 (6%)

Query: 2   VMSTTRIGVLGGIVLLF-IASYF--FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDV 58
           ++   +  ++  IVL+  IA YF     +  S L E       +D + L     S   D 
Sbjct: 6   IVKNNKTTLIASIVLVIAIALYFTEIQAKNNSDLGET----NSLDAKILPETEISKDDDP 61

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV-- 116
            +G  DAP++++E++   C  CA F+ +T   LE +YI+ GK+ +I R+FP+ +      
Sbjct: 62  LLGNPDAPISIIEFSDYQCPFCARFYTQTLPTLESEYIEKGKVNFIYRDFPIQNHPNARP 121

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDW--INSKNYRDALLNMAKFAGFSKNDFDTCL 174
           A + + CA+++    +W +  +LF KQD W  ++           A+    ++  FD+CL
Sbjct: 122 AALASECADEQ--EQFWEYHDILFKKQDMWKRLDLDTVTSTFKEYAEELNLNQEMFDSCL 179

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
           + +   D++ +        + I  TP FFIG 
Sbjct: 180 DSEKYSDEVDSDFADGRS-YKISGTPTFFIGN 210


>gi|254487515|ref|ZP_05100720.1| dsba oxidoreductase:tat pathway signal [Roseobacter sp. GAI101]
 gi|214044384|gb|EEB85022.1| dsba oxidoreductase:tat pathway signal [Roseobacter sp. GAI101]
          Length = 227

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 86/179 (48%), Gaps = 7/179 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST+K++ +G  ++ V ++EYAS TC HCA F    +K L+ +YI T K+ +  RE   D 
Sbjct: 53  STIKEMKLGNAESAVQIIEYASFTCPHCAAFDQGPYKQLKAEYIDTDKIGFTYREVFFDR 112

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKND 169
               A M+ARC  +     ++G   L++  Q +W+ +         L  + + AG   + 
Sbjct: 113 YGLWASMVARCGGEEK---FFGISDLIYKGQSEWVRAGEPAAIVGELRKIGRLAGIDGDT 169

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            + CL D      + A  +   +   I STP F I G  Y  +M      +IID+ + D
Sbjct: 170 LEACLQDSTKAQTLVAWWEENQKADDITSTPSFIINGTKY-SNMPYAEMKEIIDAALAD 227


>gi|114798923|ref|YP_760617.1| DSBA-like thioredoxin domain-containing protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114739097|gb|ABI77222.1| DSBA-like thioredoxin domain protein [Hyphomonas neptunium ATCC
           15444]
          Length = 223

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 95/177 (53%), Gaps = 13/177 (7%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +GQ DAP+T++EYAS TC  C  FH+     +E+KYI TGK++++ RE+PL+ +   A  
Sbjct: 48  LGQADAPLTIIEYASPTCPACKYFHDTVKPTIEEKYISTGKVKFVFREYPLNEIDVAAYA 107

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDD---WINSKNYRDALLNMAKFAGFSKN-DFDTCLN 175
           +ARCA    D  ++  +  LF  Q+       +   +  L  + +  G +    F+ CL+
Sbjct: 108 MARCA---GDDKFFDVLDDLFENQEGIRYAAQNGVVKTTLGAIGQRHGIADTATFEACLS 164

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGG--NLYLGD--MSEGVFSKIIDSMIQD 228
           +  I   + A     SE + ++ TP F I G  + + G+   +EG FSK ID+ + +
Sbjct: 165 NSEIRQAL-ADTYATSEKWGVEGTPTFIIDGVKHNFQGEYTTAEG-FSKQIDAKLAE 219


>gi|189183411|ref|YP_001937196.1| hypothetical protein OTT_0504 [Orientia tsutsugamushi str. Ikeda]
 gi|189180182|dbj|BAG39962.1| hypothetical protein OTT_0504 [Orientia tsutsugamushi str. Ikeda]
          Length = 276

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 72/145 (49%), Gaps = 5/145 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G KD+ + + EY S  C+HCA +H K F  L+ K+I T K+ YI REF        
Sbjct: 92  DIVLGNKDSNIKIFEYFSYACYHCARYHEKIFPTLKHKFIDTNKIAYITREFITAKQDLD 151

Query: 117 AVMLARCAEKRMDGGYWG-FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
             ML+RC    M    W  F + L  +QD W+ +KNY + L ++ K  G + + F  C  
Sbjct: 152 GAMLSRCGGTLM----WNKFHTTLLEQQDKWVFNKNYMNWLKDIGKIGGITTDQFLNCFK 207

Query: 176 DQNILDDIKAGKKRASEDFAIDSTP 200
           D+ +   +       S+    D TP
Sbjct: 208 DEILAQQLMLNTVNISKFEIFDGTP 232


>gi|83855279|ref|ZP_00948809.1| thiol:disulfide interchange protein, DsbA family protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83843122|gb|EAP82289.1| thiol:disulfide interchange protein, DsbA family protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 231

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 89/182 (48%), Gaps = 7/182 (3%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A+ + ++D+++G  D+ V ++EYAS TC HCA F    F+ L+  YI   K+ +  RE  
Sbjct: 54  AATTEIQDMTLGNPDSAVQIIEYASYTCPHCAAFDQGPFQQLKADYIDNDKIGFTYREVY 113

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFS 166
            D     A M++RC  +     ++G   +++  Q +W+ +       + L  + + AG  
Sbjct: 114 FDRYGLWASMVSRCGGEDK---FFGITDMIYAGQSEWVRAGEPAAIVEELRKIGRLAGLD 170

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             + D CL D      + A  +   +   I+STP F I G  Y  +M      +IID+ +
Sbjct: 171 NAELDACLQDGEKAQSLVAWWEENQKADDINSTPSFIINGKKY-SNMPYAEMKEIIDAAL 229

Query: 227 QD 228
           ++
Sbjct: 230 EE 231


>gi|83941802|ref|ZP_00954264.1| thiol:disulfide interchange protein, DsbA family protein
           [Sulfitobacter sp. EE-36]
 gi|83847622|gb|EAP85497.1| thiol:disulfide interchange protein, DsbA family protein
           [Sulfitobacter sp. EE-36]
          Length = 231

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 89/182 (48%), Gaps = 7/182 (3%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A+ + ++D+++G  D+ V ++EYAS TC HCA F    F+ L+  YI   K+ +  RE  
Sbjct: 54  AATTEIQDMTLGNPDSAVQIIEYASYTCPHCAAFDQGPFQQLKADYIDNDKIGFTYREVY 113

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFS 166
            D     A M++RC  +     ++G   +++  Q +W+ +       + L  + + AG  
Sbjct: 114 FDRYGLWASMVSRCGGEDK---FFGITDMIYAGQSEWVRAGEPAAIVEELRKIGRLAGLD 170

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             + D CL D      + A  +   +   I+STP F I G  Y  +M      +IID+ +
Sbjct: 171 NAELDACLQDGEKAQSLVAWWEENQKADDINSTPSFIINGKKY-SNMPYAEMKEIIDAAL 229

Query: 227 QD 228
           ++
Sbjct: 230 EE 231


>gi|148284575|ref|YP_001248665.1| hypothetical protein OTBS_1026 [Orientia tsutsugamushi str.
           Boryong]
 gi|146740014|emb|CAM80092.1| hypothetical protein OTBS_1026 [Orientia tsutsugamushi str.
           Boryong]
          Length = 276

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 72/145 (49%), Gaps = 5/145 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+ +G KD+ + + EY S  C+HCA +H K F  ++ K+I T K+ YI REF        
Sbjct: 92  DIVLGNKDSNIKIFEYFSYACYHCARYHEKIFPTIKHKFIDTNKIAYITREFITSKQDLD 151

Query: 117 AVMLARCAEKRMDGGYWG-FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
             ML+RC    M    W  F + L  +QD W+ +KNY + L ++ K  G + + F  C  
Sbjct: 152 GAMLSRCGGTLM----WNKFHTTLLEQQDKWVFNKNYMNWLKDIGKIGGITADQFLNCFK 207

Query: 176 DQNILDDIKAGKKRASEDFAIDSTP 200
           D+ +   +       S+    D TP
Sbjct: 208 DEILAQQLMLNTVNISKFEIFDGTP 232


>gi|161529166|ref|YP_001582992.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160340467|gb|ABX13554.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 263

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 87/175 (49%), Gaps = 9/175 (5%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +AP+T++E++   C  C +F+  T   +E+ YI TGK+ ++ R+FP+ S+   AV  
Sbjct: 89  GDPNAPITIIEFSDYECPFCGKFYTDTLPLIEENYINTGKVNFVYRDFPIQSIHPNAVHT 148

Query: 121 ARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYR--DALLNMAKFAGFSKNDFDTCLNDQ 177
           A  AE   D   +W +  ++F  +  W   +       L+  A   G    +F TCL   
Sbjct: 149 AMAAECADDQEMFWPYHDMIFENKSTWEKQRGQSLVSELVQYADVLGLDTEEFTTCLESN 208

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNL--YL---GDMSEGVFSKIIDSMIQ 227
             LD+++    +  + + I  TP FFIG +   Y+   G      F++I++ M++
Sbjct: 209 KHLDEVR-NDLQDGQSYGISGTPGFFIGNDNSGYIKVSGAKPYQTFAEILEGMLR 262


>gi|329888148|ref|ZP_08266746.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846704|gb|EGF96266.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 201

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 90/177 (50%), Gaps = 8/177 (4%)

Query: 53  STMKDVSIGQKD-APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL- 110
           +T  D+++G  + A VT+VEYAS TC  CA ++   +   + KY+   K+R++ REFP  
Sbjct: 30  TTQGDMAMGAAEGAKVTVVEYASTTCAGCAAWNETVWPDFKAKYVDNNKVRFVFREFPTP 89

Query: 111 -DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
              ++    ++ARCA    D  Y+  V  L   Q +  N    R+ LL  A+ AG S+  
Sbjct: 90  PQDIAVAGFLIARCAG---DDKYFEVVDHLMRAQTEMRNGVPPREILLRTAQAAGLSETQ 146

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           F+ C  D+  +  ++   K+AS    +  TP F + G + + D S    S  ID ++
Sbjct: 147 FEECTTDKAAVAALEQRIKQASA-AGVTGTPTFMVNGQI-VTDNSLSGLSASIDPLL 201


>gi|196018402|ref|XP_002118796.1| hypothetical protein TRIADDRAFT_62803 [Trichoplax adhaerens]
 gi|190578190|gb|EDV18719.1| hypothetical protein TRIADDRAFT_62803 [Trichoplax adhaerens]
          Length = 247

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 83/171 (48%), Gaps = 5/171 (2%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  IG   A VT++ Y+S++C  CA FH      ++ +YI +GKL +I R++P +  +  
Sbjct: 81  DHYIGNTKAKVTIITYSSLSCPGCAYFHENLLPKIKKEYIDSGKLLFIFRDYPNNEPALY 140

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
              LA C E      Y+  + +LF  Q  W   K+++  L N+ + +GFS      C  D
Sbjct: 141 GATLANCFE----NSYFELIDILFKSQIKWAFRKDFKKMLKNIGRLSGFSAEKISKCFED 196

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           ++  D ++    +  +   ++ TP  +I     + +  +  + KIID  + 
Sbjct: 197 KSFSDQLQMKAFKDMKTLNLNQTPTIYINQEFIIANNYDD-YVKIIDKYLN 246


>gi|83945336|ref|ZP_00957684.1| hypothetical protein OA2633_14156 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851170|gb|EAP89027.1| hypothetical protein OA2633_14156 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 240

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 82/156 (52%), Gaps = 10/156 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--PLDSVS 114
           D  +G  DAPVT++EYAS +C  C  F+N+    ++D  ++ G +R++ RE      +++
Sbjct: 41  DRGVGPIDAPVTIIEYASTSCPGCGAFYNQGKPAIDDA-VERGDVRFVFREMLTGQPNLA 99

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQD---DWINSKNYRDALLNMAKFAGFSKNDFD 171
               MLARCA +     Y   + LLF +Q      +   N +   L++A+ AGFS  +F 
Sbjct: 100 RAGFMLARCAPEDQ---YLDVIDLLFEQQRALFSAMQQGNAQAQFLSIARTAGFSDAEFR 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            C+ +Q +L+ ++    +A  D  +  TP F I G 
Sbjct: 157 ACMTNQEVLEAVEEANMQAVRD-GVGGTPHFIINGQ 191


>gi|84515029|ref|ZP_01002392.1| thiol:disulfide interchange protein, DsbA family [Loktanella
           vestfoldensis SKA53]
 gi|84511188|gb|EAQ07642.1| thiol:disulfide interchange protein, DsbA family [Loktanella
           vestfoldensis SKA53]
          Length = 221

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 88/173 (50%), Gaps = 6/173 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           ++ +G  DA V ++EYAS TC HCA FH   FK +++ YI T K+R++ RE   D     
Sbjct: 51  EMVLGNPDAAVEVIEYASFTCPHCASFHADQFKQIKENYIDTDKIRFVYREVYFDRPGLW 110

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN---YRDALLNMAKFAGFSKNDFDTC 173
           A M+AR         ++ F  +L+ +Q  W+   +     + L  +AK AG      D  
Sbjct: 111 ASMIARSTNN--PDFFFSFAGMLYEQQRSWLAGGDPVVIVEELRRLAKVAGLDDAALDAA 168

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           L++    + +    +  +E   I STP F I G LY  +M+   F++I+D+ I
Sbjct: 169 LSNGPKAEALFTWYQANAERDGISSTPSFLIDGRLY-SNMAYPEFAEILDARI 220


>gi|295687793|ref|YP_003591486.1| thiol:disulfide interchange protein DsbA [Caulobacter segnis ATCC
           21756]
 gi|295429696|gb|ADG08868.1| thiol:disulfide interchange protein DsbA [Caulobacter segnis ATCC
           21756]
          Length = 206

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 77/158 (48%), Gaps = 6/158 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--PLDSVS 114
           ++ +G   APV +V YAS +C HCA +  +    +   ++ TGK+R++ REF  P    +
Sbjct: 37  EMVLGSPTAPVQLVAYASASCPHCAHWWTEVLPQVRKSFVDTGKVRFVFREFLTPPTEFA 96

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
               +LAR    R+ G Y+  +S +F +Q++   S+   + L  + K  G +   F   +
Sbjct: 97  AAGFILAR----RIPGKYFEVLSTVFQRQEEIYRSEKLWEGLQAIGKQYGLTDAQFAAAM 152

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
           ND   L  +     RA     I+ TP FF+ G    GD
Sbjct: 153 NDPAALKGVNDRFFRALNQENIEVTPTFFVNGAPIEGD 190


>gi|161528689|ref|YP_001582515.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339990|gb|ABX13077.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 265

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 115/245 (46%), Gaps = 31/245 (12%)

Query: 10  VLGGIVLLFIASYF----FYTRKGSALNELPIPDGVVDFR------ALLAASPSTMKDVS 59
           ++G IV + +A++F    F       +++  + D +           L    PS    +S
Sbjct: 24  IIGLIVAVGVAAFFAGMYFSNANSDQISQEDLDDAIAKLELKMLQNRLPTNQPSEPVKIS 83

Query: 60  ------IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
                 IG  DAP+T++E++   C  CA FH +T   L ++YI  GK++ + R+FP+ S+
Sbjct: 84  ADDDPIIGNPDAPITIIEFSDFQCPFCARFHVQTLPLLLEEYIDQGKVKLVFRDFPIQSI 143

Query: 114 STVAV---MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA---GFSK 167
              A+   + A CA ++  G +     +LF+ Q  W N +   DAL   +++A      +
Sbjct: 144 HPNALPASVAAECANEQ--GQFKAMHDMLFDNQGQWSNQETV-DALSMFSQYATQIQLDQ 200

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG----GNLYL-GDMSEGVFSKII 222
             FD+CL     +++I+         + +  TP FF+G    G + L G      F K+I
Sbjct: 201 ETFDSCLTSGKYIEEIRKDLDDGRS-YDVTGTPGFFVGNDEIGYVELKGAQPFESFKKVI 259

Query: 223 DSMIQ 227
           D+ ++
Sbjct: 260 DAQLE 264


>gi|329850284|ref|ZP_08265129.1| putative disulfide isomerase [Asticcacaulis biprosthecum C19]
 gi|328840599|gb|EGF90170.1| putative disulfide isomerase [Asticcacaulis biprosthecum C19]
          Length = 223

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 80/167 (47%), Gaps = 7/167 (4%)

Query: 47  LLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR 106
           + AA P  + D+S+G   A +T++EYAS  C HCA ++   +   E KY+KTGK+R+I R
Sbjct: 38  IPAAKPGLLPDMSLGNPKAKITVIEYASAACPHCAHWNETVWPQFEAKYVKTGKVRFIFR 97

Query: 107 EFPLD--SVSTVAVMLARCAEKRMD-----GGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           E   +  + +  A M+ RCA  R         Y+  +   F+ QD +  +      L ++
Sbjct: 98  EVLTNPQAYALSAFMVGRCAVNRSQDPTSSAPYFAVLHSFFSGQDVYYKTNRLGFVLNDI 157

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
               G ++ D   C+ D+  +           E   I+STP F + G
Sbjct: 158 NIKTGMTEADIQACVGDEKAMAAFYDNMNAHLEADQIESTPTFVVNG 204


>gi|85374546|ref|YP_458608.1| protein-disulfide isomerase [Erythrobacter litoralis HTCC2594]
 gi|84787629|gb|ABC63811.1| protein-disulfide isomerase [Erythrobacter litoralis HTCC2594]
          Length = 256

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 90/202 (44%), Gaps = 28/202 (13%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDVS---IGQKDAPVTMVEYASMTCFHCAEFH 84
           +G  + E+P P+G         A  +T+ D+    IG  DAP+ +VEY S+TC  CA F 
Sbjct: 40  EGEPVAEVPAPEG------QQWADVTTVTDLQGHMIGNPDAPIKLVEYGSLTCGTCANFT 93

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR----MDGGYW-GFVSLL 139
              F+ L  +YI TG++ + LR   L+ +  V V LARC+       +    W  F  ++
Sbjct: 94  QTGFEELRSEYINTGRVSFELRPLVLNPLDLVMVNLARCSSDEAVVPLSEQVWMNFQEVM 153

Query: 140 ---------FNKQDDWINSKNYRDA-----LLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
                    F +       + Y  A     LL+     G S++   TCL D   +  I  
Sbjct: 154 GQAQQAGQAFEQAIGLPEEQRYVAAAEATGLLDFFAARGLSRDQARTCLQDVEKVKAIAE 213

Query: 186 GKKRASEDFAIDSTPVFFIGGN 207
              +  E+F +  TP FF+ GN
Sbjct: 214 RSAQQGEEFNVTGTPTFFVNGN 235


>gi|148657335|ref|YP_001277540.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
 gi|148569445|gb|ABQ91590.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
          Length = 269

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 104/214 (48%), Gaps = 26/214 (12%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDV-SIGQKDAPVTMVEYASMTCFHCAEFHNK 86
           + S +  +P P  + D   +  + P+   D  + G  DAP+T+VE++   C  CA F  +
Sbjct: 64  RPSGVTPIPAPTSIPDDPPV--SEPAPFDDPRAQGAPDAPITVVEFSDFQCPFCASFARE 121

Query: 87  TFKYLEDKYIKTGKLRYILREFPLDSVST---VAVMLARCAEKRMDGGYWGFVSLLFN-- 141
               +E++Y++TGK+R + R+FPL S+     +A  +A CA ++  G +W   + +F   
Sbjct: 122 VRPLIEERYVRTGKVRLVYRDFPLMSIHPGALLAAHVANCAGEQ--GAFWQMHTRIFEGM 179

Query: 142 KQDDWI--NSKNYRDALLNMAKFAGFSKNDFDTCLNDQ----NILDDIKAGKKRASEDFA 195
            Q +W   ++ ++R   L  A+           C+        I +DI AG++       
Sbjct: 180 TQREWSSGDANDFR-TFLRYAEELELDAGAVQQCVESNRYGAQIQEDILAGQQ-----AG 233

Query: 196 IDSTPVFFIGGNLYLG----DMSEGVFSKIIDSM 225
           + STP F I G L +G    ++ E +F +I+ + 
Sbjct: 234 VRSTPSFLINGQLLVGAQPFEVWEQIFERILSTQ 267


>gi|108804655|ref|YP_644592.1| DSBA oxidoreductase [Rubrobacter xylanophilus DSM 9941]
 gi|108765898|gb|ABG04780.1| DSBA oxidoreductase [Rubrobacter xylanophilus DSM 9941]
          Length = 230

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 89/177 (50%), Gaps = 12/177 (6%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S+G++DAPV MVEYA   C +C E+  +    L +KY+++G LR   R+FP     +V  
Sbjct: 59  SLGREDAPVVMVEYADFQCPYCGEYAREVQPKLVEKYVESGTLRIEWRDFPYLGQESVNA 118

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-LLNMAKFAGFSKNDFDTCLN-- 175
            LA  A  +  G +W +  LL+  Q   +NS  + DA L+  AK AG     F+  L   
Sbjct: 119 ALAARA-AQAQGRFWEYHDLLYENQKP-VNSGGFSDANLIKFAKKAGLDVERFEEDLKSG 176

Query: 176 --DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
             +  +  D + G++R      +  TP F I G + +G   + VF K I+   +++ 
Sbjct: 177 RYEAAVARDFREGQRR-----GVAGTPTFVINGKVVVGAQPQEVFEKAIEKAEREAQ 228


>gi|149377658|ref|ZP_01895395.1| DSBA oxidoreductase [Marinobacter algicola DG893]
 gi|149358070|gb|EDM46555.1| DSBA oxidoreductase [Marinobacter algicola DG893]
          Length = 243

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 103/223 (46%), Gaps = 15/223 (6%)

Query: 14  IVLLFIAS--YFFYTRKGSALNELPIPDGVVD-FRALLAASPSTMKDVSIGQKDAPVTMV 70
           IVL+F+A   +F         +ELP+     D F A L         VS+G +DAPV + 
Sbjct: 31  IVLVFVAVGVFFLTASPAPTSDELPVAGPNADPFPAQL-----DRFGVSVGDEDAPVVVR 85

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV--AVMLARCAEKRM 128
           E+A   C  CA F + + + L+ +Y++TGK+R++  + PL        A   ARCA  + 
Sbjct: 86  EFADYQCPACARFSDAS-QQLKQEYVETGKVRFVYFDLPLQQHDNAMPAAQAARCAGDQ- 143

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK 188
             GYW     LF+ Q +W  S +  D     A   G  +  F  C+     +++I+  ++
Sbjct: 144 -DGYWAMHDKLFDMQTEWSGSSSPVDTFSRYADDLGLDERRFSRCMTTDLHVEEIEQSRR 202

Query: 189 RASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            A +   + STP   +  N+ L     G  S +++  +  S +
Sbjct: 203 VAMQ-LRVTSTPTVLV-DNIRLTRPGWGQLSAVVERELAGSQQ 243


>gi|156743646|ref|YP_001433775.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
 gi|156234974|gb|ABU59757.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
          Length = 268

 Score = 84.7 bits (208), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 98/208 (47%), Gaps = 20/208 (9%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKT 87
           + S +  +P P  V +        P TM     G  DAP+ +VE++   C  CA F  + 
Sbjct: 69  RPSGVTPVPAPTDVPERAPSFDGDPRTM-----GDPDAPIVVVEFSDFQCPFCASFSREV 123

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD-GGYWGFVSLLFN--KQD 144
              +E++Y+ TGK+R++ R+FPL S+   A++ A  A    D G +W   + +F   +Q 
Sbjct: 124 RPLIEERYVSTGKVRFVYRDFPLMSIHPGALLAAHVANCAGDQGAFWEMHNRIFAGMEQR 183

Query: 145 DWI--NSKNYRDALLNMAKFAGFSKNDFDTCL----NDQNILDDIKAGKKRASEDFAIDS 198
           +W   ++ ++R   L  A            C+    +   I +DI+A ++       + S
Sbjct: 184 EWASGDAGDFR-TFLKYADELNLDTAQVQQCVESNRHGPRIQEDIQAAQR-----AGVRS 237

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           TP F I G L +G     V+ ++ ++++
Sbjct: 238 TPSFLINGQLLVGAQPFEVWERMFETIL 265


>gi|254455828|ref|ZP_05069257.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082830|gb|EDZ60256.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 192

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 91/189 (48%), Gaps = 8/189 (4%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
           ++ F  +   S   +K + IG  DA ++++ + S+TC HCA FH      L+  Y+ TG 
Sbjct: 9   IIFFCTISNISAENIKRIVIGNADAKISIIAFESLTCSHCANFHKDVLPDLKKDYLDTGL 68

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
            +   R FPLD  +  A  +A+C     + G    ++ L+  Q  W+   +  +A  N+ 
Sbjct: 69  AKIEFRHFPLDIAAFNASKVAQCN----NDGDSKILNSLYANQQKWVKGSSAAEANQNLK 124

Query: 161 KF---AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
           KF    GF+ N F+ C+ND+ I D I   +    + F +++TP   I    +   ++   
Sbjct: 125 KFLENEGFNIN-FEACINDEKIEDFILNDRIDGVKKFKVNATPTIIINDKKFEKTLNYKN 183

Query: 218 FSKIIDSMI 226
             K ++ +I
Sbjct: 184 LKKALEKLI 192


>gi|148658073|ref|YP_001278278.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
 gi|148570183|gb|ABQ92328.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
          Length = 253

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 84/211 (39%), Gaps = 22/211 (10%)

Query: 10  VLGGIVLLFIA--SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG------ 61
           V+G  VLL IA  +      + SA    P  D          A P+T     +G      
Sbjct: 26  VMGAAVLLVIAVAATIALQNRQSAATATPGRD---------PARPATGVATGVGADGFFF 76

Query: 62  --QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--STVA 117
               DAPVT+ E++   C  CA +        E +Y+ TGK+R++  E+PL+       A
Sbjct: 77  KGNADAPVTVTEFSDYQCPGCAYYATILAAQFEQEYVATGKVRFVYHEYPLNGHINGVPA 136

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            + ARCA ++    YW     LF  Q  W    N +   +  A+  G     F+ C    
Sbjct: 137 AIAARCAGEQGADNYWAMHDYLFTNQRQWSGQPNPQAQFVAYARQIGLDTAAFERCYTSN 196

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
              D I   K  + +   I  TP F + G L
Sbjct: 197 RFRDAINQAKA-SGDALRIPGTPSFAVNGQL 226


>gi|55980792|ref|YP_144089.1| hypothetical protein TTHA0823 [Thermus thermophilus HB8]
 gi|55772205|dbj|BAD70646.1| hypothetical membrane protein [Thermus thermophilus HB8]
          Length = 211

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 84/177 (47%), Gaps = 3/177 (1%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P+     ++G++DAPV +V++++  C HC          L+ +YI TGK+RY+ R+FP  
Sbjct: 32  PAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPRLKAEYIDTGKVRYLFRDFPFP 91

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN--SKNYRDALLNMAKFAGFSKND 169
             + V       A     G Y+ +  +LF     W N   +     L+++A   G  +  
Sbjct: 92  GQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVDLAGQIGLEEGA 151

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           F  CL      +++ A +K A+ D  +  TP FFI G  + G +    + +++D  +
Sbjct: 152 FAACLASGRHREEVLADQKLAT-DLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEAL 207


>gi|46198779|ref|YP_004446.1| thiol:disulfide interchange protein dsbA [Thermus thermophilus
           HB27]
 gi|46196402|gb|AAS80819.1| thiol:disulfide interchange protein dsbA [Thermus thermophilus
           HB27]
          Length = 211

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 84/177 (47%), Gaps = 3/177 (1%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P+     ++G++DAPV +V++++  C HC          L+ +YI TGK+RY+ R+FP  
Sbjct: 32  PAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPRLKAEYIDTGKVRYLFRDFPFP 91

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN--SKNYRDALLNMAKFAGFSKND 169
             + V       A     G Y+ +  +LF     W N   +     L+++A   G  +  
Sbjct: 92  GQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVDLAGQIGLDEGA 151

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           F  CL      +++ A +K A+ D  +  TP FFI G  + G +    + +++D  +
Sbjct: 152 FAACLASGRHREEVLADQKLAT-DLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEAL 207


>gi|329888147|ref|ZP_08266745.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846703|gb|EGF96265.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 211

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 83/162 (51%), Gaps = 7/162 (4%)

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTVAVMLAR 122
           A VT+VEYAS+TC HCA ++ + +   + KY+   K+R++ REFP     ++    ++AR
Sbjct: 51  AKVTVVEYASVTCGHCAVWNEEVWPEFKTKYVDNNKVRFVFREFPTPPQDIAVAGFLIAR 110

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           CA       Y+  VS +   Q +W      R  L    + AG S+   + C+ D+  ++ 
Sbjct: 111 CAGPDK---YFDVVSDIMASQKEWQAGVAPRTTLFRAGQAAGLSEQQINDCIRDKAAIEA 167

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           ++  + +A     +  TP F + G + + D S    S++ID+
Sbjct: 168 MEK-RIQAGISAGVTGTPYFTVNG-VKVADSSLSGLSEVIDA 207


>gi|58040433|ref|YP_192397.1| putative thiol:disulfide interchange protein [Gluconobacter oxydans
           621H]
 gi|58002847|gb|AAW61741.1| Putative thiol:disulfide interchange protein [Gluconobacter oxydans
           621H]
          Length = 275

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           L  S   M    IG  DA V + E+ S+TC HCA F  + F  +    I TGK+RY   +
Sbjct: 97  LPTSDPRMGPRVIGSPDAKVIVDEWFSLTCSHCAHFAQEIFPQIRKNLIDTGKIRYRFHD 156

Query: 108 FPLDSVSTVAVMLARC--AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA-- 163
           FPLD V+ +A M++R   AE+     Y  FV+ L + QD+W  ++N  D +  + K A  
Sbjct: 157 FPLDQVALLASMVSRSLPAER-----YEPFVTDLLDHQDEWAFAQNI-DPIAELKKRAAL 210

Query: 164 -GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            G S  +FD    D  + + I   + R      I  TP F I
Sbjct: 211 FGVSAAEFDKINADNALRESIINRQDRDGAFLQIQGTPYFRI 252


>gi|329888149|ref|ZP_08266747.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846705|gb|EGF96267.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 203

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 81/173 (46%), Gaps = 7/173 (4%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVS 114
           D  +G+ DAPVT++EYAS TC HCA + N      + +YI TGK+R + R+ P     ++
Sbjct: 34  DRVMGRADAPVTVIEYASFTCSHCAHWTNDILPQFKARYIDTGKVRLVFRDMPTPPAQIA 93

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
             A  +ARCA       ++     L + Q       + RD        +G ++   +TC+
Sbjct: 94  ATAAGIARCAAPNR---FFDVAHSLMSGQAAAFEKGDARDWFAAAIAASGRTQEQIETCM 150

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            +      ++A +   +    +  TP FF+ G   + D S    S  ID +I+
Sbjct: 151 KNPATSQALQA-EVDGAVAAGVTGTPSFFVNGR-RVSDHSLEALSAAIDPLIR 201


>gi|315498143|ref|YP_004086947.1| dsba oxidoreductase [Asticcacaulis excentricus CB 48]
 gi|315416155|gb|ADU12796.1| DSBA oxidoreductase [Asticcacaulis excentricus CB 48]
          Length = 231

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 84/176 (47%), Gaps = 10/176 (5%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
             D ++   A  + +K+++ G  +A VT+VEY S+TC HCA ++   +   E  YIKTGK
Sbjct: 38  AADAQSAGKAKVAPLKEMTKGATNARVTVVEYGSVTCTHCAHWYTTNWPKFERDYIKTGK 97

Query: 101 LRYILREFPLDSVSTV--AVMLARCAEKRMD-----GG---YWGFVSLLFNKQDDWINSK 150
           ++Y+ RE   +         ML  CA  + +     GG   Y+  +   F  Q     + 
Sbjct: 98  VKYVYREVATNPAQMAFGVYMLGHCAAGKSNWLGQKGGTKAYFTVIDGFFAAQSKIYETG 157

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                  ++A  AG ++++ D CL ++++   I A  +       ++ TP FF+ G
Sbjct: 158 EAEPVFRSLAAKAGLNQSEADNCLKNEDLFKAISARMEANMNRDGVEGTPTFFVNG 213


>gi|315498445|ref|YP_004087249.1| dsba oxidoreductase [Asticcacaulis excentricus CB 48]
 gi|315416457|gb|ADU13098.1| DSBA oxidoreductase [Asticcacaulis excentricus CB 48]
          Length = 212

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 80/157 (50%), Gaps = 10/157 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           ++S G+ DAPVT+VEYAS+ C  CA+ + K     + KY++TGK+RY+ R     + +  
Sbjct: 36  ELSEGKADAPVTVVEYASVACPICAQVNEKMMPVFKSKYVETGKVRYVYRPMMTGNAAVA 95

Query: 117 AV--MLARCAEKRMDGGYWGFVSLL-----FNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           A   MLA C  +  D       S++      ++        N R  LL +A+ AG  + D
Sbjct: 96  AAGHMLANCVSR--DKALTVIDSIMRAQPEMDRGGAPEQYANARPVLLRVAQSAGLREAD 153

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
           F+ C+ D   L+ +    ++A +D  +  TP F I G
Sbjct: 154 FNRCVTDPAGLNALNELNQQALKD-GVTGTPTFLING 189


>gi|302383806|ref|YP_003819629.1| DSBA oxidoreductase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194434|gb|ADL02006.1| DSBA oxidoreductase [Brevundimonas subvibrioides ATCC 15264]
          Length = 200

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 76/151 (50%), Gaps = 7/151 (4%)

Query: 57  DVSIGQKD-APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SV 113
           D+++G  + A VT+VEYAS+TC  CA +  + +   + KY+ T K+RY+ RE P     V
Sbjct: 30  DMALGAPEGAKVTVVEYASVTCHVCAAWQEEVWPGFKAKYVDTNKVRYVFREIPTPPVEV 89

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           +T   +LARCA +     Y+  V  +      W      R  LL +A   G  +     C
Sbjct: 90  ATAGFLLARCAGEDK---YFDVVHEMLASVKSWDAGVPPRQTLLQIANGVGIDQQQLQQC 146

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           + D++ +  ++A +  A+    +  TP FF+
Sbjct: 147 ITDEDAIKALEA-RITAANARGVTGTPAFFV 176


>gi|91762756|ref|ZP_01264721.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718558|gb|EAS85208.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 196

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 90/181 (49%), Gaps = 6/181 (3%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           LAA    +K +S G++ A +T++ Y S+TC HCA FH   +  L+  +I  G ++   R 
Sbjct: 20  LAADNEMVKRISEGEESAKITIIAYESLTCGHCANFHKDVYPELKKDFIDKGLVKIEFRH 79

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF-AGFS 166
           FPLD  +  A  +A+C     + G    +++L++ Q  W   K   +A   + KF    S
Sbjct: 80  FPLDLAAFNASKIAQCN----NDGNSNILNILYSGQKKWARGKTPEEATGYLKKFLESES 135

Query: 167 KN-DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            N DF+ CL+D+ I D +   +    + F +++TP   I    +   ++     K ++ +
Sbjct: 136 VNLDFEKCLSDKAIEDYVLNDRIDGVKKFEVNATPTIIINDKKFDKALNYKNLKKYLEKL 195

Query: 226 I 226
           I
Sbjct: 196 I 196


>gi|254419287|ref|ZP_05033011.1| hypothetical protein BBAL3_1597 [Brevundimonas sp. BAL3]
 gi|196185464|gb|EDX80440.1| hypothetical protein BBAL3_1597 [Brevundimonas sp. BAL3]
          Length = 200

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 86/176 (48%), Gaps = 8/176 (4%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
           T +D  +G+ DAPVT++EYAS TC HCA+FHN      + +YI TGK+R + R  P    
Sbjct: 30  TAQDHVLGRADAPVTVIEYASFTCSHCADFHNDVLPAFKARYIDTGKVRLVHRNLPTAPA 89

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW--INSKNYRDALLNMAKFAGFSKNDFD 171
           +  A   A  A     G Y+    +    Q +     +K + DA L     +G ++   +
Sbjct: 90  NVAAAAAAV-AICAAPGRYFDVAEVFMRDQANLRTTGAKPWFDAGLAA---SGKTREQIE 145

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           TCL D      ++A +   +++  +  TP FF+ G   + D S    S  +D +++
Sbjct: 146 TCLGDPATGAALQA-QIEGAQEAGVAGTPSFFVNGK-PVADHSLEALSAAVDPLLR 199


>gi|320450878|ref|YP_004202974.1| thiol:disulfide interchange protein DsbA [Thermus scotoductus
           SA-01]
 gi|320151047|gb|ADW22425.1| thiol:disulfide interchange protein DsbA [Thermus scotoductus
           SA-01]
          Length = 203

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 82/179 (45%), Gaps = 3/179 (1%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P+     ++G  +APV +V++++  C HC          L+ +YI TGK+RY+ R+FP  
Sbjct: 24  PAQGARFALGDPNAPVVVVDFSNYLCPHCQNHALNVLPRLKAEYIDTGKVRYLFRDFPFP 83

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN--YRDALLNMAKFAGFSKND 169
             + V       A     G Y+ +  +LF     W N +       L+++A   G  +N 
Sbjct: 84  GQANVIRASEAAACAADQGRYYEYHEVLFRASSSWANLQGSVLDRYLVDLAGQMGLDENT 143

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F  CL+     + + A +K AS D  +  TP FFI G    G +    +  ++D  + +
Sbjct: 144 FSQCLSSNKHREGVLADQKLAS-DLGLTGTPTFFIAGEKRTGFLPYEEWKTLLDKALAE 201


>gi|161528656|ref|YP_001582482.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339957|gb|ABX13044.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 265

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 89/193 (46%), Gaps = 23/193 (11%)

Query: 52  PSTMKDVSI------GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           P  ++++S       G  +A +T+VE++   C  CA+FH  T   +E  YI+TGK+ ++ 
Sbjct: 76  PQIIRNISFDDDPMKGNPNASITIVEFSDFQCPFCAKFHETTLPLIEQNYIQTGKVNFVY 135

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALL--NMAKF 162
           R+FP+ ++   AV  A  +E   D G +W    ++F  Q  W +    +   L    A  
Sbjct: 136 RDFPIQNIHPNAVPAALASECADDQGKFWEMHDMIFEDQQIWKDLPVAQSVTLYKQYASE 195

Query: 163 AGFSKNDFDTCLND----QNILDDIKAGKKRASEDFAIDSTPVFFIGG-----NLYLGDM 213
            G    +FD+CL+     + + +D+  G+      + +  TP FF+G          G  
Sbjct: 196 LGLDSIEFDSCLDSGKYIEEVQNDLNDGRT-----YGVSGTPGFFVGNADIGFTPISGAQ 250

Query: 214 SEGVFSKIIDSMI 226
               F ++ID  +
Sbjct: 251 PYSTFQRVIDGQL 263


>gi|329765534|ref|ZP_08257110.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137972|gb|EGG42232.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 269

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 90/186 (48%), Gaps = 25/186 (13%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--- 113
           D  IG ++AP+T++E++   C  CA F  +T   + ++Y+ TGK++++ R+FP+ S    
Sbjct: 91  DPVIGDQNAPITIIEFSDFQCPFCARFQTQTLPLILEQYVNTGKVKFVFRDFPIQSSHPN 150

Query: 114 STVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG---FSKND 169
           +  A + A CA E+ M   YW F   LF  Q  W N  +  DA      +A     ++  
Sbjct: 151 AMPAAVAAECANEQDM---YWQFHDELFENQGVW-NKMSIVDATDVFKGYAAKLELNQEQ 206

Query: 170 FDTCLND----QNILDDIKAGKKRASEDFAIDSTPVFFIGGN-----LYLGDMSEGVFSK 220
           F++CL+       I  D+  G+K     + I  TP FFIG          G     VF  
Sbjct: 207 FNSCLDSGKYIGEINSDLNDGRK-----YGITGTPGFFIGNEKTGFVKVNGAQPFEVFKS 261

Query: 221 IIDSMI 226
           +IDS +
Sbjct: 262 VIDSQL 267


>gi|302383807|ref|YP_003819630.1| disulfide isomerase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194435|gb|ADL02007.1| putative disulfide isomerase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 205

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 89/194 (45%), Gaps = 12/194 (6%)

Query: 46  ALLAASPSTMKDVS-----IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
           A +A +P  +  V+     +GQ +APVT++EYAS+ C HC ++H   +   + ++I TG+
Sbjct: 17  AAVAQTPGALPAVTASDRILGQANAPVTVIEYASLVCSHCGDWHRTVYPEFKRQFIDTGR 76

Query: 101 LRYILREFPLDSVSTVAVM--LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
           +R + R+ P       A    +ARCA       ++  +   F  Q+             +
Sbjct: 77  VRMVFRDLPTAPAPVAARAAGIARCAAPNR---FYEVIGTFFRGQEALFAGGPVAPWFAS 133

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
               +G ++ + D CL D   L+ ++A    A+    ++ TP FF+ G   + D+S    
Sbjct: 134 GVAASGRTQAEIDACLADPATLEGLRASIAGATAA-GVEGTPTFFVNGR-RVTDISLAGL 191

Query: 219 SKIIDSMIQDSTRR 232
           +  I      + RR
Sbjct: 192 TAAITPSPTPARRR 205


>gi|118575694|ref|YP_875437.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
 gi|118194215|gb|ABK77133.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
          Length = 246

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 77/157 (49%), Gaps = 8/157 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD- 111
           ST  D   G  DAP+T++E++   C  C  F+  T   LE +YI TGK+  + R+ PLD 
Sbjct: 67  STDDDPVKGSPDAPLTVIEFSDFQCPFCNRFYQDTLPQLEREYIDTGKVNLVFRDMPLDI 126

Query: 112 -SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW--INSKNYRDALLNMAKFAGFSKN 168
              +  A M A CA+ +  G +W +  LLF++   W  +   +  + L   A   G    
Sbjct: 127 HPNALPAHMAAECADGQ--GAFWEYHDLLFDRAGQWGRLGPADLIEQLGAYADELGVGSG 184

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            FD C+   + + +++    + S  + +  TP FFIG
Sbjct: 185 -FDECMVMPDTVSEVRKDLAQGS-GYGVTGTPTFFIG 219


>gi|148557586|ref|YP_001265168.1| protein-disulfide isomerase-like protein [Sphingomonas wittichii
           RW1]
 gi|148502776|gb|ABQ71030.1| Protein-disulfide isomerase-like protein [Sphingomonas wittichii
           RW1]
          Length = 247

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 85/199 (42%), Gaps = 33/199 (16%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D+ A L  +P       +G  DAPV +VEYAS+TC HC +F       L   Y++TGK+ 
Sbjct: 45  DWTATLVKTPEG--GFRMGNPDAPVKLVEYASITCPHCRDFSKVGGDPLRQTYVRTGKVS 102

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD-------- 154
           +  R F L+ +   A ++ARC        ++ F+  L+  Q +W+   N  D        
Sbjct: 103 WEYRNFVLNPLDVAATLVARCQGAET---FFPFIDQLYATQTEWVGKFNSVDEATLRSVG 159

Query: 155 ALLNMAKFA---------------GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
            L    +F                G   +    CL+D+  L ++   +   + +  +D T
Sbjct: 160 GLPQQEQFTKLIELSGLGDFFKERGVPADRIQACLSDKAALAELLKIRDHGANEDKVDGT 219

Query: 200 PVFFIGGNLYLGDMSEGVF 218
           P F I      G+  EGV+
Sbjct: 220 PNFLIN-----GERQEGVY 233


>gi|313679853|ref|YP_004057592.1| dsba oxidoreductase [Oceanithermus profundus DSM 14977]
 gi|313152568|gb|ADR36419.1| DSBA oxidoreductase [Oceanithermus profundus DSM 14977]
          Length = 207

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 77/184 (41%), Gaps = 3/184 (1%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +A   A P+       G  DAPVT+VE+++  C HC +   K+   +   Y+ TGK+RYI
Sbjct: 22  QATAEADPAAGAHFVYGSPDAPVTVVEFSNYLCPHCKDHSEKSLPRIFADYVDTGKVRYI 81

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW--INSKNYRDALLNMAKF 162
            R+FP      V +     A     G Y+ +  LLF     W  + +        + A+ 
Sbjct: 82  FRDFPFAGQDNVILAGEAAACAADQGRYYDYHQLLFRATGQWGRVPTSELPSFFSDYARQ 141

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G     FD CL+       + A  +  +    +  TP FF+ G    G      + KI+
Sbjct: 142 LGLDTARFDACLSSHEKRPLVLA-DQELTRKLGLGGTPSFFVNGKFIEGFRPYDEWKKIL 200

Query: 223 DSMI 226
           D  +
Sbjct: 201 DEAL 204


>gi|307296242|ref|ZP_07576069.1| protein-disulfide isomerase [Sphingobium chlorophenolicum L-1]
 gi|306878044|gb|EFN09267.1| protein-disulfide isomerase [Sphingobium chlorophenolicum L-1]
          Length = 255

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 81/204 (39%), Gaps = 26/204 (12%)

Query: 32  LNELPIPDGVVDFRA---LLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
           L+ L IP G++   A   L   +PS++    +G   A   +VEY S TC HCA F  +  
Sbjct: 45  LSLLAIPAGLIAAPAANWLSRVAPSSIGGHVLGNPAASTKLVEYVSYTCSHCAHFVREAS 104

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI- 147
           + L  +Y+K GK+   +R    D     A +LARC      G ++G    LF  QD W+ 
Sbjct: 105 EPLRARYVKGGKVSVEVRNAVRDKYDLAAALLARCGG---PGRFFGNHEALFANQDAWME 161

Query: 148 --------------NSKNYRD-----ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK 188
                              RD      L  +    GF     D C+ND   +  I A   
Sbjct: 162 KLIAYDKDATKPAEEKAALRDIGQKTGLYALMAKRGFKPAQLDACINDPASMKQILAMTD 221

Query: 189 RASEDFAIDSTPVFFIGGNLYLGD 212
            A     I  TP F + G L  G 
Sbjct: 222 EAWNKLRIGGTPAFTLNGTLVQGS 245


>gi|296282456|ref|ZP_06860454.1| protein-disulfide isomerase [Citromicrobium bathyomarinum JL354]
          Length = 236

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 20/172 (11%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DAPVT+ EY S TC HC EF  +  + L+  Y+  G LRY  R    + V   A M
Sbjct: 37  VGNPDAPVTLTEYISYTCPHCREFAMQGEEILKLGYVSKGDLRYEYRNVAANPVDLTATM 96

Query: 120 LARC-AEKRMDGGYWG-------FVSLLF----NKQDDWIN---SKNYRDALLNMAKFA- 163
           +ARC A ++  G +         F +LL     ++ D W N   + + R    ++  +A 
Sbjct: 97  MARCGAPEKFPGNHSALMMAQPQFNALLRLATKSQTDRWFNGDKAASRRSVASDLNLYAI 156

Query: 164 ----GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
               G+++ + D CL DQ + D I+   +     +   STP F + G +  G
Sbjct: 157 FERRGYTRVELDRCLADQALADRIEGAIEADVVTYGPISTPSFVVNGTMLEG 208


>gi|163848707|ref|YP_001636751.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222526649|ref|YP_002571120.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
 gi|163669996|gb|ABY36362.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222450528|gb|ACM54794.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
          Length = 262

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 89/195 (45%), Gaps = 6/195 (3%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
           P P   VD   LL  +    +  ++G  +APV M+E+    C  CA F +++   +  ++
Sbjct: 69  PTPAPPVDLVELLKLTDDDPR--AMGDPNAPVLMIEFTDYECPFCARFVSESRPRIVREF 126

Query: 96  IKTGKLRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQD-DWINSKNY- 152
           ++TG +R ++R+FPL S+   A++           G +W    +LF   + +W    N  
Sbjct: 127 VETGVVRLVVRDFPLTSIHPSALLAAGVAHCAAAQGQFWPVYEMLFQTHNVEWGGVPNRD 186

Query: 153 RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
           RD L+ +A   G        CL+D      I A  + A+    I+STP F I G +  G 
Sbjct: 187 RDVLIELAGKLGVDTAQLRACLDDPATEATIIAEVETATR-LGINSTPNFIINGRIVRGA 245

Query: 213 MSEGVFSKIIDSMIQ 227
                F+ +I  + +
Sbjct: 246 FPFESFASLIRRLAE 260


>gi|218295130|ref|ZP_03495966.1| DSBA oxidoreductase [Thermus aquaticus Y51MC23]
 gi|218244333|gb|EED10858.1| DSBA oxidoreductase [Thermus aquaticus Y51MC23]
          Length = 208

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 85/179 (47%), Gaps = 7/179 (3%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P+     ++G++DAP+ +V++++  C  C +        L+ +Y+ TGK+RY+ R+FP  
Sbjct: 31  PAQGARFALGREDAPIVVVDFSNYLCGFCQQHALNVLPRLKAEYVDTGKVRYLFRDFPFP 90

Query: 112 SVSTV--AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR--DALLNMAKFAGFSK 167
               V  A   A CA ++  G Y+ +  +LF     W N +       L+++A   G   
Sbjct: 91  GQDQVIRAGEAAACAHEQ--GRYYEYHEVLFRAAQAWGNLRGQALDRYLVDLAGQLGLDT 148

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             F +CL    +   + A ++ A +D  +  TP FFI G    G M    +  ++D  +
Sbjct: 149 GAFQSCLASGRMRQGVLADQQLA-QDLGLTGTPTFFIAGEKRTGFMPYEEWKALLDKAL 206


>gi|87198978|ref|YP_496235.1| protein-disulfide isomerase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134659|gb|ABD25401.1| protein-disulfide isomerase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 249

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 79/167 (47%), Gaps = 19/167 (11%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DAP+ ++E+ +++C HCAEF  K F  L D+YI +G++ Y LR F L+++   AV+
Sbjct: 63  LGNPDAPIKLIEFGALSCSHCAEFSEKGFPKLRDEYIASGRVSYELRLFLLNALDMPAVL 122

Query: 120 LARCAEKR----MDGGYWGFVSLLF-NKQDD-----WINSKNYRDALLNMAKFAGFSK-- 167
           LA C        +   +W +   +F N Q D      I++         +A+  G S+  
Sbjct: 123 LATCGAPEAVIPLSEQFWAWQPNMFSNLQKDEAAFQQISNLPAEKRFAGIAQLGGLSEFF 182

Query: 168 -------NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
                      TCL D      +     +  +++ I  TP FF+ G+
Sbjct: 183 ASRGIAAAQGATCLADTAKATRLATVNDQWGKEYDITGTPTFFLNGS 229


>gi|159899804|ref|YP_001546051.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159892843|gb|ABX05923.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 228

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 95/213 (44%), Gaps = 23/213 (10%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIPDGVVDF-RALLAASPSTMKDVSIGQKDAPVTMVEY 72
           + +L I +    T+ G+       P   VD  R +   SP       +G+ DAPVT+VE+
Sbjct: 33  VPVLLIVAVVMLTKAGAE------PAQTVDVSRLIYPDSPV------LGKTDAPVTIVEF 80

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
               C  C  F    F  ++D   + G  +R ++R FPL + S +A+     A  +  G 
Sbjct: 81  LDPECESCRAF----FPIVKDVLAQNGDNVRLVVRYFPLHNNSVLAIAATEAAGNQ--GK 134

Query: 132 YWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
           YW    LLFNKQ +W   +  + AL L  A+  G   + F   L+D  I+  I+     A
Sbjct: 135 YWEMQELLFNKQSEWGEKQTPQTALMLQYAQELGLDGDQFAKDLSDPKIMQKIERDNADA 194

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
            +   +  TP FF+ G   +  +S+      ID
Sbjct: 195 -QALNVRGTPSFFVNGK-EVSSLSQAALQSAID 225


>gi|118576169|ref|YP_875912.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
 gi|118194690|gb|ABK77608.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
          Length = 226

 Score = 78.2 bits (191), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 79/150 (52%), Gaps = 12/150 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   A VT+VE+    CF+C +F + T + + D+Y+ TGK+R I ++F +    +VA  
Sbjct: 56  LGDPGAAVTLVEFGDYQCFYCNQFFHDTEQAILDEYVSTGKVRMIFKDFTIIGPDSVAAA 115

Query: 120 L-ARCAEKRMDGGYWGFVSLLFNK----QDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
             ARCA+++  G +W +  +L+++       W +++N    LL+MA  AG   N +  C+
Sbjct: 116 HGARCADEQ--GSFWEYHDILYSRWAGENTGWASAEN----LLDMAGTAGLDVNAWGICM 169

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           ++      + A    A     +  TP FF+
Sbjct: 170 DEGRHEGALSASNNDA-RSLGLTGTPAFFV 198


>gi|71082821|ref|YP_265540.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|71061934|gb|AAZ20937.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 171

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           +K +S G++ A +T++ Y S+TC HCA FH      L+  +I  G ++   R FPLD  +
Sbjct: 2   VKRISEGKESAKITIIAYESLTCGHCANFHKDVLPELKKDFIDKGLVKIEFRHFPLDLAA 61

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF-AGFSKN-DFDT 172
             A  +A+C     + G    + +L++ Q  W   K   +A   + KF    S N DF+ 
Sbjct: 62  FNASKIAQCN----NDGNSNILHILYSGQKKWARGKTPEEATGYLKKFLESESVNLDFEK 117

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           CL+D+ I D +   +    + F +++TP   I    +   ++     K ++ +I
Sbjct: 118 CLSDKAIEDFVLNDRIDGVKKFEVNATPTIIINDKKFDKALNYKNLKKYLEKLI 171


>gi|126667123|ref|ZP_01738098.1| hypothetical protein MELB17_06234 [Marinobacter sp. ELB17]
 gi|126628529|gb|EAZ99151.1| hypothetical protein MELB17_06234 [Marinobacter sp. ELB17]
          Length = 242

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 97/213 (45%), Gaps = 13/213 (6%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIP-DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEY 72
           +V + I  +F  +      +ELP+   G  DF A L         VS+G  DAPV + E+
Sbjct: 33  VVAMLIGLFFITSGPSPDSDELPVAKQGTPDFPAEL-----DQFGVSVGAADAPVVVREF 87

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS--VSTVAVMLARCAEKRMDG 130
           A   C  CA F + + + L+ +Y+++GK+R++  E PL     +  A   ARCA  +   
Sbjct: 88  ADYQCPACARFADAS-QRLKKEYVESGKVRFVYFELPLSQHANAMPAAQAARCAGDQ--N 144

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
            +W     L++ Q  W    + +      A   G S+N F  C+  +   + I+   K A
Sbjct: 145 AFWPMHEALYSNQSAWAGVSDPQATFTRYAGDLGLSENRFSRCMATELHREAIEQSAKVA 204

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           ++   + STP   +  N+ L     G  S +++
Sbjct: 205 TQ-LRVVSTPTVMV-DNIVLTRPGWGQLSAVVE 235


>gi|72161925|ref|YP_289582.1| protein-disulfide isomerase [Thermobifida fusca YX]
 gi|71915657|gb|AAZ55559.1| similar to Protein-disulfide isomerase [Thermobifida fusca YX]
          Length = 279

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 85/176 (48%), Gaps = 14/176 (7%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           ++ +G+ DAPVTMV ++   C +CA F  +    L ++Y++TG++R + R++P     +V
Sbjct: 108 ELVLGRSDAPVTMVVFSDYQCPYCARFALEQQPVLVERYVETGQVRLVWRDYPYLGEESV 167

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
              +A  A  R  G YW +   L+   + W  +   R++L+ +A   G   + F   L D
Sbjct: 168 RAAVAARAAGRQ-GRYWDYHEALYESSEVWRAAGASRESLVEVAATIGLDTDQFAVDLAD 226

Query: 177 QNILDDIKAGKKRASEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             + + ++       EDFA      +  TP F I G  + G      F++ +D  +
Sbjct: 227 PVLREAVE-------EDFAFALGLGVPGTPAFLIDGEAFFGAQPVERFAERLDEAL 275


>gi|114570748|ref|YP_757428.1| protein-disulfide isomerase-like protein [Maricaulis maris MCS10]
 gi|114341210|gb|ABI66490.1| Protein-disulfide isomerase-like protein [Maricaulis maris MCS10]
          Length = 252

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 84/173 (48%), Gaps = 14/173 (8%)

Query: 45  RALLAASPSTMK--DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           +A LA   + ++  D  IG  DA + ++EYAS  C HCA F  + +  +  ++++TG +R
Sbjct: 24  QAQLAEGAAELRPTDRVIGGADADLLIIEYASFACPHCAHFQTEVWPMIRSEFVETGLIR 83

Query: 103 YILREFPLDSVSTVA---VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL-- 157
           Y +R   L S   +A   V+L+ C     D  Y+  V LLF++Q +   +      +L  
Sbjct: 84  YSVRPM-LTSPPQIAGAGVILSECVP---DDRYFDAVDLLFHEQANIFETAREGGDVLAV 139

Query: 158 --NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
              +A   G S      C  D    + + A   +ASED  I STP F I G+L
Sbjct: 140 YNRIAAATGGSAETLLACFQDTAANEHVNAVAVQASED-GIRSTPAFIIAGDL 191


>gi|218658575|ref|ZP_03514505.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           IE4771]
          Length = 130

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 2/70 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           ++P  DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN TF  ++ 
Sbjct: 63  DMPQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTFDTIKQ 120

Query: 94  KYIKTGKLRY 103
           KYI TGK+++
Sbjct: 121 KYIDTGKVQF 130


>gi|11498950|ref|NP_070183.1| hypothetical protein AF1354 [Archaeoglobus fulgidus DSM 4304]
 gi|2649220|gb|AAB89891.1| membrane protein, putative [Archaeoglobus fulgidus DSM 4304]
          Length = 305

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 91/189 (48%), Gaps = 37/189 (19%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVM 119
           G +DA V +VE+++  C HCA+F  +T   + +KY    K++ + R+FP    +S  A  
Sbjct: 135 GAEDAKVVIVEFSNYACGHCADFAIETEPKILEKY--GDKVKIVFRDFPGFGEISYFAAE 192

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWI--NSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            A CA ++  G YW F  LLF  Q +WI  NSK Y     + A+  G + ++F  C    
Sbjct: 193 AANCAGEQ--GKYWEFHDLLFENQREWISNNSKIY-----DYAEQLGLNVDEFKAC---- 241

Query: 178 NILDDIKAGKKRASED--------FAIDSTPVFFIG--------GNLYLGDMSEGVFSKI 221
                I++GK R   D        + +  TP FFIG        G    G ++   F+ +
Sbjct: 242 -----IESGKYREEVDKDYKDGISYGVTGTPTFFIGTPNGTFVNGKKVAGALNFEQFAAL 296

Query: 222 IDSMIQDST 230
           I+  +Q ++
Sbjct: 297 IEQELQQAS 305


>gi|161528389|ref|YP_001582215.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339690|gb|ABX12777.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 214

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 90/187 (48%), Gaps = 19/187 (10%)

Query: 51  SPSTMKDVS---IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +PST+ +     +G  +AP+T++E+    C  C +FH  T   + + +IKTGK++ + ++
Sbjct: 35  TPSTLIENGSPILGNSNAPITILEWGDYQCTFCYKFHKDTLNVINEDFIKTGKVKLVFKD 94

Query: 108 FPLDSVSTVAVMLAR-CAEKRMDGGYWGFVSLLFN----KQDDWINSKNYRDALLNMAKF 162
           FPL+   +V    A  CA  R  G YW +   L+     ++  W+     R++L   A  
Sbjct: 95  FPLNGPDSVLAGEASFCA--RDQGKYWEYHDELYKNWGGERTGWVT----RESLDIFAST 148

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL----GDMSEGVF 218
            G     F+ CL++    + + A  +   E   ID+TP F +  +  +    G+    VF
Sbjct: 149 VGLDLQTFNECLDEHKYQNKVNALYEFGRE-IGIDATPSFLVFNDEKIIKIRGNQPLEVF 207

Query: 219 SKIIDSM 225
            K ID +
Sbjct: 208 LKTIDEL 214


>gi|309791025|ref|ZP_07685562.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
 gi|308226940|gb|EFO80631.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
          Length = 235

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 71/149 (47%), Gaps = 4/149 (2%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV---STVA 117
           G  DA V ++EYA   C  CAE+       ++  Y+ TGK+++I  E PL ++   + ++
Sbjct: 67  GNPDAVVKVIEYADYQCPSCAEYDRNLAPLIDRDYVNTGKIQFIYHELPLTNIHRNAQIS 126

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
              ARCA  +    +W    +++  QD W +  + ++   + A   G  +N   +CL + 
Sbjct: 127 AEAARCAGDQGVENFWKMHDMIYINQDQWASINSAQNVFASYASQLGMDRNALTSCLTNG 186

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                I+A  + A     + +TP F + G
Sbjct: 187 THKAPIEAAMQVAMAT-GVQATPTFEVNG 214


>gi|291295950|ref|YP_003507348.1| DSBA oxidoreductase [Meiothermus ruber DSM 1279]
 gi|290470909|gb|ADD28328.1| DSBA oxidoreductase [Meiothermus ruber DSM 1279]
          Length = 227

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 76/169 (44%), Gaps = 3/169 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           IG  +A VT+V++++  C HC +  N+ F  ++  YI TGK+RY+ R+FP      V   
Sbjct: 43  IGNPEAKVTVVDFSNYLCSHCRDHANEVFPLIKRDYIDTGKIRYVFRDFPFGGQENVIRA 102

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDW--INSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
               A       Y  +   LF  Q  W  ++ +   +   ++A   G +   F  CL   
Sbjct: 103 GEAAACAADHNLYVEYHEALFRAQMQWAGLSGEALDNYFTDLAGQIGIAPATFSQCLKSG 162

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +    + A +K A+ D  +  TP F + G  Y G      + +I+D  +
Sbjct: 163 SKRAGVLADQKLAT-DLGLTGTPSFIVNGETYTGQRPYDSWQEILDKAL 210


>gi|58040432|ref|YP_192396.1| putative thiol:disulfide interchange protein [Gluconobacter oxydans
           621H]
 gi|58002846|gb|AAW61740.1| Putative thiol:disulfide interchange protein [Gluconobacter oxydans
           621H]
          Length = 211

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 76/167 (45%), Gaps = 9/167 (5%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           IG  +A V + E+ S+TC HCA F  + F  ++++ I TGK+RY   +F  D V   A M
Sbjct: 45  IGNPNAKVLVQEWFSLTCTHCAHFATEEFPKIKEQLIDTGKIRYQFHDFCGDRVGLTAAM 104

Query: 120 LARC-AEKRMDGGYWGFVSLLFNKQDDWINSK--NYRDALLNMAKFAGFSKNDFDTCLND 176
           +AR   E+R    Y  F+  LF+ Q  W  +   +    L  M+  AG S   FD    D
Sbjct: 105 VARSLPEER----YVPFLEALFSSQMQWAFAAGGDPMQRLQQMSALAGVSAAQFDAISKD 160

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
               + +    K+ S+ + I  TP F      Y  D     + K  D
Sbjct: 161 NVFAEALFDQVKKDSDTYNIQGTPYFRFNNTHY--DQDPETYEKFAD 205


>gi|326386684|ref|ZP_08208305.1| protein-disulfide isomerase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208737|gb|EGD59533.1| protein-disulfide isomerase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 255

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 78/176 (44%), Gaps = 37/176 (21%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DA + +VEY +++C HCA F ++ F  L D Y+ +G++ Y LR F L+ +   +V+
Sbjct: 67  MGNPDAQLKLVEYGALSCSHCAAFSSEGFPKLRDDYVNSGRVSYELRFFMLNPLDVPSVL 126

Query: 120 LARCAEK-----RMDGGYWGFVSLLFNKQDDWINSKNYRDALLN-------------MAK 161
           LA C         M   +W +   +FN      N K   D  L              +A+
Sbjct: 127 LATCGGAADTVIPMAEQFWAWQPNMFN------NLKASGDGTLQQVQNLPANQRPTAIAR 180

Query: 162 FAGFSKNDF-----------DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
             G   NDF            TCL+D      +    ++A++DF I  TP F + G
Sbjct: 181 LTGM--NDFFAQRGIPTGQGATCLSDVGKATALATATEKATKDFNITGTPTFILNG 234


>gi|269968758|ref|ZP_06182749.1| hypothetical protein VMC_41790 [Vibrio alginolyticus 40B]
 gi|269826630|gb|EEZ80973.1| hypothetical protein VMC_41790 [Vibrio alginolyticus 40B]
          Length = 262

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 79/148 (53%), Gaps = 10/148 (6%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTVA 117
           +G K+A + +VE++   C +C  F +  FK +++ YI  GK++YI R+FPL   + +  A
Sbjct: 87  LGNKEAKIAIVEFSDFQCPYCKRFTDNAFKQIKENYIDNGKVQYIARDFPLSFHAKAKGA 146

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            + A C+ K+    YW    +LFN   D +  + Y+ A ++++     +  +F+ C+ DQ
Sbjct: 147 AIAAACSLKQ--NSYWTMREMLFNNAKD-LGEEFYQKAAIDLS----LNIEEFNKCMEDQ 199

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIG 205
           ++ D I+       +   I  TP F IG
Sbjct: 200 SVADKIEQD-MTLGKSLGIRGTPTFLIG 226


>gi|116624599|ref|YP_826755.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116227761|gb|ABJ86470.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 340

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 89/189 (47%), Gaps = 22/189 (11%)

Query: 48  LAASPSTMKDVSI------GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-K 100
           LA  P    +VS+      G   APVT+VE++    FHC  F  K    L++   K G K
Sbjct: 158 LAPPPVFRSEVSVEGAPSRGGVAAPVTIVEFSD---FHCP-FCRKAQSVLDNLRAKYGEK 213

Query: 101 LRYILREFPLDSV---STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           +R++ R+FPL+ +   + VA   +RCA ++  G +W F   LF+   D   +     AL 
Sbjct: 214 IRFVYRDFPLEGLHPQARVAAEASRCAAEQ--GKFWEFHDRLFHGDPDASQA-----ALS 266

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +AK +G     F+ C       + ++A  +  +    I  TP FF+ G + +G  S   
Sbjct: 267 RIAKESGMDLTAFEACRTSGKYKNSVQASAQEGAR-LGITGTPTFFVNGRMLVGSQSLDE 325

Query: 218 FSKIIDSMI 226
           F  IID  +
Sbjct: 326 FVSIIDEEL 334


>gi|24214838|ref|NP_712319.1| oxidoreductase [Leptospira interrogans serovar Lai str. 56601]
 gi|45657648|ref|YP_001734.1| hypothetical protein LIC11782 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24195853|gb|AAN49337.1| oxidoreductase [Leptospira interrogans serovar Lai str. 56601]
 gi|45600888|gb|AAS70371.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 348

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 87/173 (50%), Gaps = 15/173 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTV 116
           SIG ++A VT++E++   C  C    +   + L +KY    ++R++ R++PL     +  
Sbjct: 188 SIGPENAKVTVIEFSDFECPFCKRSQSVNSQ-LREKY--KDQIRWVFRDYPLSFHPNAMF 244

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLN 175
           A + A C+  +  G YW F  +LF+      NS N  +D +L++A+  G     F  C+N
Sbjct: 245 AHIAANCSASQ--GKYWEFFKVLFD------NSGNLPKDRVLDLARGLGLDMKVFSQCVN 296

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           D  +  +++A      E + +  TP FFI G +  G      F K+ID  +++
Sbjct: 297 DSEVRKEVEADMAEG-EKYGVSGTPAFFINGVMIEGAQPIEAFIKVIDQELKN 348


>gi|51893196|ref|YP_075887.1| hypothetical protein STH2058 [Symbiobacterium thermophilum IAM
           14863]
 gi|51856885|dbj|BAD41043.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 260

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 88/221 (39%), Gaps = 12/221 (5%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           IGV  G+    I +     R+   L E+ +P        +L           +G  DAPV
Sbjct: 45  IGVAVGVTAALIVASNVTARR---LGEIVLPS------IILTDQERGADRHVLGSADAPV 95

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            +VE++   C HC E H      +E+  +  G  RY+ +   +   S  ++  A   E  
Sbjct: 96  ELVEFSDFRCPHCRESHEILGSQIEE-LVAEGTARYVRKHMLVIDPSDTSLNAAEAVECA 154

Query: 128 MDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
            D G YW F+ +LF  Q      K  RDA+   A+  G     F+ C++ Q   D + A 
Sbjct: 155 ADQGYYWAFLDMLFANQAA-QGQKWTRDAMKTYARELGLDTKAFNECMDQQKYRDKVLAD 213

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                    I  TP F + G L      + V S ++ +  Q
Sbjct: 214 SAEGYSTPGITGTPSFLVNGELLRIRSYQDVISAVLAAAGQ 254


>gi|262276827|ref|ZP_06054620.1| dsba oxidoreductase [alpha proteobacterium HIMB114]
 gi|262223930|gb|EEY74389.1| dsba oxidoreductase [alpha proteobacterium HIMB114]
          Length = 194

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 70/158 (44%), Gaps = 8/158 (5%)

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           ++S+TC HCA+FH      L +KY+ + K+   L +FPLD     A  + +C        
Sbjct: 42  FSSLTCPHCADFHLNVMPKLLEKYVLSEKVLIKLMDFPLDLSGLKAAQIQKCLPLETQKS 101

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFA---GFSKNDFDTCLNDQNILDDIKAGKK 188
           Y   +  ++  Q  W  +K  ++   N+ K     G    DF  CL ++   D +   + 
Sbjct: 102 Y---LDEIYKTQPQWTTAKTLKELEANIEKITSKLGLQGKDFRNCLKNKKNEDAVLQSRI 158

Query: 189 RASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +A   + ID+TP   I    + G   E    K ID ++
Sbjct: 159 KAQSKYEIDATPTLIINEKKFKGSTKE--LEKYIDKLL 194


>gi|116331436|ref|YP_801154.1| oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116125125|gb|ABJ76396.1| Oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 348

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 88/173 (50%), Gaps = 15/173 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTV 116
           SIG ++A VT++E++   C  C    +   + L  KY    ++R++ R++PL     +  
Sbjct: 188 SIGPENAKVTVIEFSDFECPFCKRSQDVNAQ-LRAKY--KDQIRWVFRDYPLSFHPNAMF 244

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLN 175
           A + A C+  +  G YW F  +LF+      NS N  ++ +L++A+  G     F  C+N
Sbjct: 245 AHIAANCSTSQ--GKYWEFFKVLFD------NSGNLSKERVLDLARGVGLDMKTFSQCVN 296

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           D ++  +++A      E + +  TP FFI G +  G      F+K+ID  +++
Sbjct: 297 DASVRKEVEADIAEG-EKYGVSGTPAFFINGIMVEGAQPIEAFTKVIDQELKN 348


>gi|116328111|ref|YP_797831.1| oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116120855|gb|ABJ78898.1| Oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
          Length = 348

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 87/173 (50%), Gaps = 15/173 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTV 116
           SIG ++A VT++E++   C  C    +   + L  KY    ++R++ R++PL     +  
Sbjct: 188 SIGPENAKVTVIEFSDFECPFCKRSQDVNAQ-LRAKY--KDQIRWVFRDYPLSFHPNAMF 244

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLN 175
           A + A C+     G YW F  +LF+      NS N  ++ +L++A+  G     F  C+N
Sbjct: 245 AHIAANCS--TFQGKYWEFFKVLFD------NSGNLSKERVLDLARGVGLDMKTFSQCVN 296

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           D ++  +++A      E + +  TP FFI G +  G      F+K+ID  +++
Sbjct: 297 DASVRKEVEADIAEG-EKYGVSGTPAFFINGIMVEGAQPIEAFTKVIDQELKN 348


>gi|332187440|ref|ZP_08389178.1| hypothetical protein SUS17_2471 [Sphingomonas sp. S17]
 gi|332012601|gb|EGI54668.1| hypothetical protein SUS17_2471 [Sphingomonas sp. S17]
          Length = 231

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 77/186 (41%), Gaps = 39/186 (20%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           IG   A V +VEY S TC HC +F  K+   L+DK +++G     +R F  D +   A +
Sbjct: 45  IGNPAARVKLVEYVSYTCPHCGDFAVKSAPVLKDKMVRSGSTSVEIRHFIRDRLDLAAAL 104

Query: 120 LARCAEKRMDGGYWGFVSL---LFNKQDDWI-------NSKNYRDALLNMA--------- 160
           +ARC      GG   F  L   +F +Q  W+        +   R     MA         
Sbjct: 105 IARC------GGAAKFAGLNQTIFAEQKTWLARGMEFEQANGQRIGTYPMAAQMRALADG 158

Query: 161 -------KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
                  K AG S      CL D+   D I A    A +   I+ TP FFI G       
Sbjct: 159 AGLTAIGKAAGLSDAQLGACLADRAAADRIVAITTAAPDT--IEGTPGFFINGK-----Q 211

Query: 214 SEGVFS 219
           ++GVF+
Sbjct: 212 AQGVFT 217


>gi|116625220|ref|YP_827376.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116228382|gb|ABJ87091.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 344

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 83/195 (42%), Gaps = 26/195 (13%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
           LP P   V     LA +P        G  DAPV +VEYA   C +C        K L D 
Sbjct: 161 LPAPRAKVS----LAGAPVR------GAADAPVVLVEYADYECPYCQMVQPALDKVLGDY 210

Query: 95  YIKTGKLRYILREFPLDSVSTV--AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY 152
               GK+ +  ++ PL   +    A    RCAE +  G YW +  LLF+       +K  
Sbjct: 211 ---KGKVAFAFKDVPLPMHANAIKAAEATRCAEAQ--GKYWEYHDLLFS-------TKMV 258

Query: 153 RDALL-NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             A L   A+        FDTCL+     D IK     A +D  ++STP FFI G    G
Sbjct: 259 EPARLKEHARTLKLDTAAFDTCLDSGAKSDSIKTALNEA-QDLGLNSTPSFFINGRFTQG 317

Query: 212 DMSEGVFSKIIDSMI 226
           ++S     +IID  +
Sbjct: 318 NLSYEQLRQIIDEEL 332


>gi|320334352|ref|YP_004171063.1| DSBA oxidoreductase [Deinococcus maricopensis DSM 21211]
 gi|319755641|gb|ADV67398.1| DSBA oxidoreductase [Deinococcus maricopensis DSM 21211]
          Length = 230

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 94/223 (42%), Gaps = 25/223 (11%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           ++G ++   + +   +TR G+   +    D        L   P       +G+ DAPVTM
Sbjct: 20  LIGTVIAAVLIALALFTRHGNGNTQAQTFD--------LTGRPV------LGRADAPVTM 65

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--------DSVSTVAVMLA 121
           + +    C  C  F  +    L+ KYI TGK++ +   +P         D  ST A + A
Sbjct: 66  IVFEDYKCPVCKGFDEEDLPTLKSKYIDTGKVKMVAMAYPFLAQNFGLSDDDSTRASVAA 125

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA-KFAGFSKNDFDTCLNDQNIL 180
           +C  ++    +W +   LF  Q D        +AL ++A    G     F+TCL DQ  L
Sbjct: 126 KCMARQGTEKFWAYHHALFRGQQDEKTVWATEEALQDLAGTIDGVDTAAFNTCLKDQATL 185

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
            ++   K +  +   ++ TP  ++ G  Y+ +       + I+
Sbjct: 186 KEVNDDKAQGDK-AGVNGTPSVYVNGR-YIANFHADALGQAIE 226


>gi|159897139|ref|YP_001543386.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890178|gb|ABX03258.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 246

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 74/151 (49%), Gaps = 13/151 (8%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFH----NKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           G  +AP+ ++E+A   C  C +      N  F   + +YI+TGK+++I REFPL S+   
Sbjct: 75  GDPNAPIKVIEFADFECPGCRQLEVDLANANF---DAEYIETGKVQWIYREFPLRSIHKS 131

Query: 117 A---VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           A     ++RCA  +  G YW     L++ Q  W N  N    +L+ A  AG + +  + C
Sbjct: 132 AQYTAEVSRCAGDQ--GVYWPVHMALYDSQLQWTNLDNPNPLILDAAVKAGANLDKLEDC 189

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           ++ +     I A    A +   +D TP  FI
Sbjct: 190 MDAETHTAAINASYDSA-KSLGLDQTPTVFI 219


>gi|320162238|ref|YP_004175463.1| DSBA oxidoreductase family protein [Anaerolinea thermophila UNI-1]
 gi|319996092|dbj|BAJ64863.1| DSBA oxidoreductase family protein [Anaerolinea thermophila UNI-1]
          Length = 246

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 83/177 (46%), Gaps = 9/177 (5%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D + G  DAP+T++E++   C  C ++H + +  +++++   G++R + R+FPL  +   
Sbjct: 78  DPAFGPADAPITIIEFSDYECPFCRKWHLEVWPRIQEEF--GGQVRLVYRDFPLYGLHAN 135

Query: 117 AVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           A   A  A    + G YW +   LF  +  +      R A   + K  G     F  CL+
Sbjct: 136 AAPSANAANCAGEQGKYWEYHDGLFTYEGGYS-----RAAFEEIGKQVGLEMTAFTQCLD 190

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           +    D+++A    A+ D  + STP FFI G   +G     VF ++I   +     R
Sbjct: 191 ENRYKDEVEADYAYAA-DLGVQSTPTFFINGLALIGAQPYEVFRQVIQMELNGEIPR 246


>gi|288932140|ref|YP_003436200.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
 gi|288894388|gb|ADC65925.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
          Length = 284

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 82/169 (48%), Gaps = 19/169 (11%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +A +T+VE++S  C  CA+F  +T      K ++   ++ + ++FP+      A   
Sbjct: 128 GDPNAKITIVEFSSYDCPFCAKFALETLP----KILQNFSVKVVFKDFPIHG-EVKAHEA 182

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND---- 176
           A CA ++  G YW +  +LF +Q++W   +     LL  AK  G + ++F+ CLN     
Sbjct: 183 ANCAGEQ--GKYWEYHDVLFQRQEEW---RKNESKLLEYAKELGLNVSEFEICLNSDKYR 237

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + +L D + G K       +  TP FF+ G +  G      F KI+  +
Sbjct: 238 EEVLKDKEEGIK-----LGVRGTPTFFVNGKVVEGAKPYEEFEKILKEL 281


>gi|219847461|ref|YP_002461894.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
 gi|219541720|gb|ACL23458.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
          Length = 251

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 90/196 (45%), Gaps = 14/196 (7%)

Query: 37  IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
           IP    D  ALL  +P   +  ++G  +APV M+E+    C  CA F ++T   L  +++
Sbjct: 60  IPRPTPDVVALLNLTPDDPR--ALGDPNAPVLMIEFTDYECPFCARFVSETRSRLISEFV 117

Query: 97  KTGKLRYILREFPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQD-DWIN-SKNYR 153
           + G +R ++R+FPL S+ ++  +  +          +W    +LF   + +W    +  R
Sbjct: 118 EAGIVRLVVRDFPLTSIHASAVLAASVAHCAAAQDRFWPVYEMLFQTHNVEWGGVPRRDR 177

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQ----NILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
             L+ +A   G       TCL+D      +L+++    +       I+STP F I G + 
Sbjct: 178 PVLVELAGKLGVDTAQLATCLDDPATEAAVLNEVALATQ-----LGINSTPNFLINGQIV 232

Query: 210 LGDMSEGVFSKIIDSM 225
            G +    F+ +I  +
Sbjct: 233 RGALPFENFASLIRQL 248


>gi|83945337|ref|ZP_00957685.1| hypothetical protein OA2633_14161 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851171|gb|EAP89028.1| hypothetical protein OA2633_14161 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 240

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 74/161 (45%), Gaps = 10/161 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF--PLDSVS 114
           D  +G  DAPVT +EY S+ C HC  F    F  + +  I+ G +R++ RE      +++
Sbjct: 42  DKVMGDADAPVTFIEYGSVACGHCGHFQEAGFTAV-NAAIEAGDVRFVFREMITGQPNIA 100

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQD---DWINSKNYRDALLNMAKFAGFSKNDFD 171
                LA CA    D  Y+  +  LF       + + +   ++    +A   GFS  D  
Sbjct: 101 IAGFALAECAP---DDQYFEVIDSLFTNMRSIFEALQTGEAQERFNAIAAEFGFSPEDVQ 157

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
            C +D+  +  ++   + A ED  + STP F I G+  + +
Sbjct: 158 ACFSDEAAITQVQNAHRTALED-GVRSTPYFIINGDRLIAE 197


>gi|288930968|ref|YP_003435028.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
 gi|288893216|gb|ADC64753.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
          Length = 316

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 93/206 (45%), Gaps = 29/206 (14%)

Query: 41  VVDFRALLAASPSTMKDVSI--------GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLE 92
           + +  A    +PS    V++        G + A V ++E++   C +CAEF N     + 
Sbjct: 121 ISELSARAQQTPSAQAAVNVSADDDPWRGNESASVVIIEFSDYACPYCAEFANDVEPKIL 180

Query: 93  DKYIKTGKLRYILREFPLD-SVSTVAVMLARCA-EKRMDGG-----YWGFVSLLFNKQDD 145
           D Y    +++ + R+FP+   +S +A   A CA E+ +  G     YW +  LLF  Q +
Sbjct: 181 DNY--GDRVKIVFRDFPVHGEISYLAAEAADCAGEQGVKEGQGWSKYWEYHDLLFANQQE 238

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLND----QNILDDIKAGKKRASEDFAIDSTPV 201
           WI +      L + AK  G +   F  CL+       +  D++ G+     ++ +  TP 
Sbjct: 239 WIENTT---KLYDYAKQIGLNTTAFKACLDSGKYRSEVEKDLQDGR-----NYGVTGTPT 290

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           FFI G    G     VF++ I+  ++
Sbjct: 291 FFINGQKVEGLTPYEVFARFIEQELK 316


>gi|134097227|ref|YP_001102888.1| DsbA-like thioredoxin domain-containing protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|291005315|ref|ZP_06563288.1| DsbA-like thioredoxin domain-containing protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|133909850|emb|CAL99962.1| DsbA-like thioredoxin domain protein [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 232

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 76/168 (45%), Gaps = 9/168 (5%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTVA 117
           G+ DAPV +V Y    C  CA+F       L+ +Y+ TG LR   R+FP+   +S+S   
Sbjct: 66  GRPDAPVVLVNYTDFRCPFCAKFGRDIEPELQRRYVDTGVLRIEWRDFPIFGEESLSAAE 125

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLND 176
              A   + R    +W F   +F +     +    R+ L+ +A+ AG      F+  + D
Sbjct: 126 AGRAAARQGR----FWEFHDAVFAQAPPTGHPPMPRERLVELARQAGVPDIQRFEADMGD 181

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             +   I+A     ++   + STP F I G    G     VF+++I+ 
Sbjct: 182 PGVYAGIQADAMEGAQ-LGVSSTPTFVINGQPVFGAQPLEVFTEVIEQ 228


>gi|14548129|gb|AAK66786.1|U40238_6 periplasmic disulfide bond isomerase [uncultured crenarchaeote 4B7]
          Length = 223

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 83/179 (46%), Gaps = 20/179 (11%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTV 116
           +G + A VT+VE     C  C  + + T + + + Y+ TGK   +  + P    DSVS  
Sbjct: 53  LGSQTATVTIVEIGDYQCPACKSWFDNTRQDIIENYVDTGKANLVFIDMPFIGADSVS-- 110

Query: 117 AVMLARCAEKRMDGGYWGFVSLLF----NKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
           A     CA+ +  G YW +   L+    ++ D W N     D L  +A   G     F+ 
Sbjct: 111 AAEATYCADDQ--GMYWDYHVKLYQFQQHENDGWAN----IDRLTAIAFDLGLDTEKFNE 164

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFI---GGNL--YLGDMSEGVFSKIIDSMI 226
           C+N +     +   K++AS DF  +STP F I    G++   +G      F K++DSM+
Sbjct: 165 CMNSKKYYSQVNLNKQKASTDFGANSTPTFVIVNSSGDIDRLIGPHPYATFEKVLDSML 223


>gi|239928300|ref|ZP_04685253.1| hypothetical protein SghaA1_08748 [Streptomyces ghanaensis ATCC
           14672]
 gi|291436629|ref|ZP_06576019.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
 gi|291339524|gb|EFE66480.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
          Length = 252

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 84/185 (45%), Gaps = 10/185 (5%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
           P+ DG++   AL    PS    ++IG+ DAPV M+EY+   C  C +F  +T   L   Y
Sbjct: 63  PVDDGLL---ALARREPSDA--LAIGRADAPVVMIEYSDFQCPFCGKFARETKPELLRSY 117

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           +  G LR   R FP+    +    LA  A  R    +W F  +++ K       +  +D 
Sbjct: 118 VDKGVLRIEWRNFPVFGEESERAALAGWAAGRQQ-KFWEFHDVVYGKPRARNADEFSQDR 176

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA--IDSTPVFFIGGNLYLGDM 213
           L+ MA+ AG +  D D    D    +  +A ++   E ++  + STP F + G   LG  
Sbjct: 177 LVGMAREAGVA--DIDRFRADMASAEAREAVRRDREEGYSLGVASTPAFLVNGRPVLGAQ 234

Query: 214 SEGVF 218
               F
Sbjct: 235 PTDTF 239


>gi|156741642|ref|YP_001431771.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
 gi|156232970|gb|ABU57753.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
          Length = 251

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 76/167 (45%), Gaps = 4/167 (2%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE-FPLDSVSTVAV 118
           +G  DAPVT++E++   C  CA    +T   + D Y+ TGK R + R    L   S  A 
Sbjct: 88  LGNADAPVTILEFSDFLCTACAFHVEETEPAIIDAYVATGKARIVYRHLLQLGEESLRAA 147

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
             A CA  +  G +W     ++  Q     + +   AL  +A+      N+++ C+  + 
Sbjct: 148 EAAECAGDQ--GKFWEMRDAIYRNQAALYTTGDVGAALTYLAQTIDLDMNEYNVCVQSRK 205

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
               I+A   RA++D  I S PVF IGG   +G      F  I+D  
Sbjct: 206 HRARIEA-DFRAAQDAGIRSRPVFDIGGTRLVGARPFEDFQAILDQQ 251


>gi|302039249|ref|YP_003799571.1| hypothetical protein NIDE3976 [Candidatus Nitrospira defluvii]
 gi|300607313|emb|CBK43646.1| exported protein of unknown function, putative DsbA-like
           oxidoreductase [Candidatus Nitrospira defluvii]
          Length = 217

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 72/146 (49%), Gaps = 10/146 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTVAV 118
           G+ DAPVT++EY+  TC +C +F  +T+  ++ +Y+ TGK+R++ +++P         A 
Sbjct: 39  GKADAPVTLIEYSDFTCGYCLKFFKETWPKIQARYVDTGKVRFLYKDYPRADQGPGVTAA 98

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           + ARCA  +  G YW     LF       + +   D+    AK  G  ++ F  CL D  
Sbjct: 99  LAARCAGDQ--GTYWPMHDRLFA-----ADGRLDVDSYSQHAKAIGLDQSQFRQCLRDAP 151

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFI 204
            +  I   +  A+  +    TP F +
Sbjct: 152 HMQAIFHDRDEANS-WGFHGTPGFVL 176


>gi|226228008|ref|YP_002762114.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
 gi|226091199|dbj|BAH39644.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
          Length = 242

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 77/171 (45%), Gaps = 10/171 (5%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--STVAV 118
           G  +AP+T++E+A   C  C +F       L  +    G   +   +FPL S+  +T+A 
Sbjct: 58  GDPNAPITIIEFADFECPGCGQFATVQEPDLRKRVFDAGLANFRFYDFPLTSIHRNTLAA 117

Query: 119 ML-ARCAEKRMDGGYWGFVSLLFNKQDDWINSK---NYRDALLNMAKFAGFSKNDFDTCL 174
            L A CA ++  G +W +  LLF  Q DW NS+   N R          G     F  C 
Sbjct: 118 HLAASCANEQ--GKFWEYHDLLFEGQYDW-NSQAASNPRKIFDGYVTKLGLDAAKFGECY 174

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + Q  L  I+A     SE   ++STP   IG  +Y    +     +I+DS+
Sbjct: 175 DSQRNLAQIQANAAAGSER-GVNSTPTIIIGNKVYSPAPTADQLKQIVDSI 224


>gi|163751466|ref|ZP_02158690.1| hypothetical protein KT99_10483 [Shewanella benthica KT99]
 gi|161328680|gb|EDP99829.1| hypothetical protein KT99_10483 [Shewanella benthica KT99]
          Length = 261

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 88/182 (48%), Gaps = 25/182 (13%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTV 116
           SIG   A + ++E++   C +C  F ++TF  L+ KYI TGK+RY+ R+FPL     +  
Sbjct: 86  SIGSAGAEIAIIEFSDYQCPYCKRFIDQTFTQLKRKYIDTGKVRYLTRDFPLSFHPKAKA 145

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFN---KQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           A + A C+ ++    YW     LFN   +  D +  +   +  L+M +F          C
Sbjct: 146 AAIAANCSLRQ--DAYWPMRDSLFNNMGQLGDELYQQTASELALDMTQFT--------EC 195

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIG---GN------LYLGDMSEGVFSKIIDS 224
           L D+++L  I+      S+   I  TP F IG   GN      L +G  S   F+ ++D 
Sbjct: 196 LTDESVLGKIEQDMAYGSQ-LGIRGTPSFVIGRVEGNRLISPRLVVGAQSFESFAVLLDE 254

Query: 225 MI 226
           ++
Sbjct: 255 LL 256


>gi|163845898|ref|YP_001633942.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222523620|ref|YP_002568090.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
 gi|163667187|gb|ABY33553.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222447499|gb|ACM51765.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
          Length = 260

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 81/188 (43%), Gaps = 20/188 (10%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSI--------GQKDAPVTMVEYASMTCFHCAEFHNKT 87
           PIP  V+    +  AS   M  + I        G  +APVT++E+    C  C   H  T
Sbjct: 64  PIPTPVISADGITTAS---MAQLGISAEPYAILGDPNAPVTIIEFTDFGCTFCRRHHVLT 120

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQDDW 146
           F  L +++I +G++ Y++R+ P+ S     A + A CA ++  G YW     LF   D W
Sbjct: 121 FPALREEFISSGQVFYVVRQLPVTSPHGDQAALAALCAGEQ--GKYWEMHDQLFAAGDAW 178

Query: 147 IN-SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID--STPVFF 203
            + +   R  ++ +A   G        C+        +    +  SE  A+    TP FF
Sbjct: 179 YSDATTARRRIIALATDLGLDSAVLQRCMEHPATQATL---ARHVSEAHALRVFGTPTFF 235

Query: 204 IGGNLYLG 211
           I   L+ G
Sbjct: 236 INNQLFAG 243


>gi|294010075|ref|YP_003543535.1| protein-disulfide isomerase [Sphingobium japonicum UT26S]
 gi|292673405|dbj|BAI94923.1| protein-disulfide isomerase [Sphingobium japonicum UT26S]
          Length = 219

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 66/172 (38%), Gaps = 23/172 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   AP  +VEY S TC HCA F  +  + L   Y+K GK+   +R    D     A +
Sbjct: 40  LGNPGAPTKLVEYVSYTCSHCAHFVKEASEPLRAGYVKGGKVSVEVRNAVRDKYDLAAAL 99

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWI---------------NSKNYRDALLNMAKFA- 163
           LARC      G ++G    LF  QD W+                    RD       +A 
Sbjct: 100 LARCGGP---GRFFGNHEALFANQDAWMEKLIAYDKDATKPTEEKAALRDIGQKTGLYAL 156

Query: 164 ----GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
               GF     D C++D   +  I A    A     I  TP F + G L  G
Sbjct: 157 MGKRGFKPAQLDACIDDPASMKQILAMTDEAWNKLRIGGTPAFTLNGALVHG 208


>gi|149186056|ref|ZP_01864370.1| protein-disulfide isomerase [Erythrobacter sp. SD-21]
 gi|148830087|gb|EDL48524.1| protein-disulfide isomerase [Erythrobacter sp. SD-21]
          Length = 227

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 69/171 (40%), Gaps = 26/171 (15%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           IG  DA   +VEY S TC HCAEF       ++  Y+ TGK+ Y +R    D +   A +
Sbjct: 42  IGNPDAEGKLVEYMSYTCSHCAEFARTGEGAIKLLYVPTGKISYEIRHLIRDPIDLTAAL 101

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFA--------------- 163
            A+C E      +      L  K  +W+  +++   A +   KF                
Sbjct: 102 AAQCGEP---AKFPANHEALILKHPEWMAKARSMTQAQMARWKFGSFASRAQAIASDLDF 158

Query: 164 -------GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
                  G+S+   D CL D+     I    +   E FA+  TP F +GG 
Sbjct: 159 YEIMEARGYSRTKLDQCLTDEAEARAIAEQSQADIETFALQGTPTFLMGGK 209


>gi|94496122|ref|ZP_01302700.1| protein-disulfide isomerase [Sphingomonas sp. SKA58]
 gi|94424301|gb|EAT09324.1| protein-disulfide isomerase [Sphingomonas sp. SKA58]
          Length = 243

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 84/199 (42%), Gaps = 23/199 (11%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
           G+ +  +P P G   + A +  +P    +  +G  DA + +VEY S TC HCAEF     
Sbjct: 30  GTPIAAVPAPAGTT-WSATVNETPE--GNFVMGNPDAKLKLVEYGSFTCSHCAEFAETAS 86

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK----RMDGGYWGFVSLLFNK-- 142
             +  K + TGK+ Y  R +  D +     +LARC  K     +   ++     +F K  
Sbjct: 87  PEIR-KLVDTGKMNYEFRTYVRDPIDLTTALLARCGGKDVFYPLSEQFFANQGAMFEKVQ 145

Query: 143 -QDDWIN-----SKNYRD-------ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
             DD        S   R         L++ AK  G S++    CL D    + +  G + 
Sbjct: 146 GNDDAFKGVEQLSPAQRPVAIAQIAGLIDFAKQRGISEDQARQCLADTATAEKLAKGVEA 205

Query: 190 ASEDFAIDSTPVFFIGGNL 208
           A+  + I  TP F I G L
Sbjct: 206 ANNQYQITGTPSFLINGVL 224


>gi|127512573|ref|YP_001093770.1| DSBA oxidoreductase [Shewanella loihica PV-4]
 gi|126637868|gb|ABO23511.1| DSBA oxidoreductase [Shewanella loihica PV-4]
          Length = 262

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 83/182 (45%), Gaps = 27/182 (14%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTV 116
           ++G+  A V ++E++   C +C  + + TF  ++  YI TGK++YI R+FPL     +  
Sbjct: 86  ALGEATAQVAIIEFSDYQCPYCKRYMDNTFTKIKSDYIDTGKVKYIARDFPLGFHPKAKG 145

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL----LNMAKFAGFSKNDFDT 172
           A + A C+ ++    YW     LF K    +  K Y+D      L+M KFA         
Sbjct: 146 AAIAANCSLQQ--DAYWPMRDALF-KNMRQLGDKLYQDTATQLSLDMTKFAA-------- 194

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG---------GNLYLGDMSEGVFSKIID 223
           CL DQ I+  I+      S    +  TP F IG           L +G  S   F  +ID
Sbjct: 195 CLEDQAIMSKIEQDIGYGS-SIGVRGTPSFLIGKLENNRLIEPKLVVGAQSYDTFKAVID 253

Query: 224 SM 225
           ++
Sbjct: 254 AL 255


>gi|159896786|ref|YP_001543033.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159889825|gb|ABX02905.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 241

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 66/155 (42%), Gaps = 3/155 (1%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S+G  +APVT+VEY+   C  C   H   F  L+ KYI TG +RY+ R +      T A 
Sbjct: 70  SMGDPNAPVTIVEYSDFQCPFCQRHHVSVFPELKAKYIDTGMVRYVFRNYIAVESHTSAP 129

Query: 119 MLARCAEKRMDGG-YWGFVSLLFNKQDDW-INSKNYRDALLNMAKFAGFSKNDFDTCLND 176
                +   MD   +W    +LF +  +W ++       +L  A+        F  C  D
Sbjct: 130 AAGVASFCAMDQNKFWEMYDMLFVRASEWGVDPNLAPTVMLKYAEELDLDTAAFAKCQAD 189

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             +L  + A    A    A   TP FFIG  +  G
Sbjct: 190 PEVLAKVNAETAEAVAAQAT-GTPAFFIGNYIIPG 223


>gi|120555923|ref|YP_960274.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
 gi|120325772|gb|ABM20087.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
          Length = 242

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 96/214 (44%), Gaps = 14/214 (6%)

Query: 14  IVLLFIASYFFYTRKGSALNE-LPIPDGVVD-FRALLAASPSTMKDVSIGQKDAPVTMVE 71
           I +  IA  +F T+  +  +E LP+     D F A++         VS+G +DAPV + E
Sbjct: 32  IGVAVIAGLYFVTKPPAPSSEALPVAAPNADEFPAIV-----DQYGVSVGNEDAPVVVRE 86

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV--AVMLARCAEKRMD 129
           +A   C  CA F   + + L+ +Y+++GK+R++  + PL        A + ARCA  +  
Sbjct: 87  FADYQCPACARFAEAS-QRLKKEYVESGKVRFVYFDLPLRQHQNAMPAALAARCAGDQ-- 143

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
             YW     L+  Q DW  S +        A   G  +  F  C+  +   + ++   + 
Sbjct: 144 DQYWAMHDKLYGSQLDWSGSNDPTATFTRYANDLGLEERRFRRCMETELHREAVEQSLQV 203

Query: 190 ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           A +   + STP   +  N+ L     G  S +++
Sbjct: 204 AVQ-LRVASTPTVMV-DNIQLTRPGWGQLSAVVE 235


>gi|260901471|ref|ZP_05909866.1| dsba oxidoreductase [Vibrio parahaemolyticus AQ4037]
 gi|308107699|gb|EFO45239.1| dsba oxidoreductase [Vibrio parahaemolyticus AQ4037]
          Length = 262

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 72/150 (48%), Gaps = 14/150 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G KDA + ++E++   C +C  F +  FK +++ YI TGK++YI R+FPL   +     
Sbjct: 87  LGSKDAKIAIIEFSDFQCPYCKRFTDSAFKQIKENYIDTGKVQYIARDFPLSFHAKAMGA 146

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                       YW    +LF+   D +  + Y+ A  +++     +  +F+ C+ DQ+I
Sbjct: 147 AIAATCSLQQNSYWPMRDMLFSNVKD-LGDELYQKAATDLS----LNLEEFNKCMKDQSI 201

Query: 180 LD----DIKAGKKRASEDFAIDSTPVFFIG 205
            +    D+  GK        I  TP F IG
Sbjct: 202 ANKVEQDLTLGK-----SLGIRGTPSFLIG 226


>gi|258592100|emb|CBE68405.1| DSBA oxidoreductase precursor [NC10 bacterium 'Dutch sediment']
          Length = 355

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 84/180 (46%), Gaps = 26/180 (14%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G KDAP+T+VE++   C +C+     T K +   Y K  ++R   R+FP+ ++   A   
Sbjct: 193 GPKDAPITIVEFSDFQCPYCSRV-VATLKEIVRLYPK--QVRLAFRDFPIANLHPKAAKA 249

Query: 121 ---ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN------DFD 171
              ARCA ++  G +WG+   LF  Q           A   +A F  F++       +F 
Sbjct: 250 HEAARCAGEQ--GKFWGYHDRLFESQ-----------AQATVADFKRFAEQLKLDGKNFA 296

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           TCL+       ++A  +  +    I  TP FFI G L +G +   +F K ID  ++ S +
Sbjct: 297 TCLDSGKYAAAVEADVQEGTR-LGITGTPTFFINGRLVVGALPLEMFQKFIDRELRRSVK 355


>gi|148655441|ref|YP_001275646.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
 gi|148567551|gb|ABQ89696.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
          Length = 254

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 4/166 (2%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE-FPLDSVSTVAV 118
           +G  DAPVT++E++   C  CA    +T   + + Y+ +GK R + R    L   S  A 
Sbjct: 90  LGNPDAPVTILEFSDFLCTACAFHVEETEPKIIETYVASGKARIVYRHLLQLGEESLRAA 149

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
             A CA  +  G +W     ++  Q     + ++  AL  +A+      N++  C+  + 
Sbjct: 150 EAAECAGDQ--GKFWEMRDAIYRNQVALYTTGDFDAALAYLAQTVDLDSNEYSVCMQSRT 207

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
               I+A   RA++D  I S PVF I G   +G      F  IID+
Sbjct: 208 HRARIEA-DFRAAQDAGIRSRPVFDINGQRLVGARPFEDFQGIIDA 252


>gi|153832115|ref|ZP_01984782.1| DsbA oxidoreductase [Vibrio harveyi HY01]
 gi|148871730|gb|EDL70571.1| DsbA oxidoreductase [Vibrio harveyi HY01]
          Length = 260

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 83/181 (45%), Gaps = 21/181 (11%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTV 116
           S+G  +A + ++E++   C +C  F + TF  +++ Y+ +GK++Y+ R+FPL     +  
Sbjct: 86  SMGDDNATIAIIEFSDYQCPYCKRFTDNTFAKIKENYVDSGKVKYLTRDFPLGFHPQAKG 145

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN-MAKFAGFSKNDFDTCLN 175
           A + A C+ K+  G YW     LF+      N +N   AL    A         F  CL 
Sbjct: 146 AAIAANCSFKQ--GEYWPMRHALFS------NMRNLNTALYQKTASDLKLDIEKFSACLE 197

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVF---------FIGGNLYLGDMSEGVFSKIIDSMI 226
           D  + ++++     AS    I  TP F          +G  L +G     VFS + D ++
Sbjct: 198 DPQMAENVENDIALAST-LGIRGTPSFVVGRIENGQLVGAQLVVGAQDYRVFSALFDDLL 256

Query: 227 Q 227
           +
Sbjct: 257 K 257


>gi|167045299|gb|ABZ09957.1| putative DSBA-like thioredoxin domain protein [uncultured marine
           crenarchaeote HF4000_APKG9P22]
          Length = 223

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 102/227 (44%), Gaps = 29/227 (12%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPI--PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           GIV++ IA +  Y         +P+  P  +++   L   SP+      +G + AP+T+V
Sbjct: 13  GIVIIVIAGFSSYYFSLLEAQNMPMIKPTSMIN---LENGSPA------LGSESAPITIV 63

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKRMD 129
           E+    C  C  + + T   L D YI+TGK + +  + P L   S  A   + CAE +  
Sbjct: 64  EFGDYQCESCYYWFHNTRSTLIDNYIETGKAKLVFVDLPFLGRDSITAAQASYCAEDQ-- 121

Query: 130 GGYWGFVSLLFNKQD-----DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
           G YW + ++L+  QD      W N    +D L + A     + ++F+ C++       +K
Sbjct: 122 GKYWEYHTILYTFQDGAPDSGWAN----QDRLNSFAFTLEMNMDEFNDCMDSSKYKIRVK 177

Query: 185 AGKKRASEDFAIDSTPVFFI-----GGNLYLGDMSEGVFSKIIDSMI 226
           A    A +  A  +TP F I         + G     VF+  I+SM+
Sbjct: 178 ANYNEAVKQGA-QATPTFIIISSDGTTKKFAGAQPYSVFAATIESML 223


>gi|311695791|gb|ADP98664.1| DSBA oxidoreductase [marine bacterium HP15]
          Length = 243

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 78/171 (45%), Gaps = 7/171 (4%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-- 115
           VS+G  DAPV + E+A   C  C  F + + K L+++Y+  GK+R++  + PL       
Sbjct: 73  VSVGPDDAPVVVREFADYQCPACGNFASAS-KQLKEEYVAEGKVRFVYFDLPLQQHQNAM 131

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           +A   ARCA  +    YW     L++ Q +W  S +        A   G  +  F  C+ 
Sbjct: 132 LAAQAARCAGDQ--DAYWAMHERLYDSQTEWSGSNDPVATFTRYAGDLGLEERRFRRCMT 189

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            +   + ++  ++ A +   + STP   +  N+ L     G  S +++  +
Sbjct: 190 TELHREAVEQSRQVAMQ-LRVTSTPTVLV-DNIRLTRPGWGQLSAVVEREL 238


>gi|220919173|ref|YP_002494477.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957027|gb|ACL67411.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 349

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 75/176 (42%), Gaps = 13/176 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS--VSTV 116
           S G  DAP+T+VE++   C  C      T K +   Y   GK+R + R+FPL S  ++  
Sbjct: 185 SKGPNDAPITIVEFSDFQCPFCVRAE-PTVKDVMAAY--PGKVRVVYRDFPLPSHDLAPK 241

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A   A CA  +  G YW     LF       N K   D L   A+  G     FD CL  
Sbjct: 242 AAEAAHCAGDQ--GKYWEMHDRLF-----AANGKLAVDDLKGYAREVGADGAKFDRCLES 294

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
                 ++   K A E   +  TP FFI G L  G      F  +ID  ++ + ++
Sbjct: 295 GEKAPVVQEHHK-AGEAAGVSGTPAFFINGRLISGAQPLEAFKAVIDQELKAAGKQ 349


>gi|86160366|ref|YP_467151.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776877|gb|ABC83714.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 349

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 72/171 (42%), Gaps = 13/171 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS--VSTV 116
           S G  DAP+T+VE++   C  C      T K +   Y   GK+R + R+FPL S  ++  
Sbjct: 185 SKGPADAPITIVEFSDYQCPFCVRA-EPTMKDVMAAY--PGKVRVVYRDFPLPSHDLAPK 241

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A   A CA  +  G YW     LF       N K   D L   A+  G     FD CL  
Sbjct: 242 AAEAAHCAGDQ--GKYWEMHDRLF-----AANGKLAVDDLKGYAREVGVDGAKFDRCLES 294

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                 ++   K A E   +  TP FFI G L  G      F  +ID  ++
Sbjct: 295 GEKAPVVQEHHK-AGEAAGVSGTPAFFINGRLISGAQPLEAFKAVIDQELK 344


>gi|197124443|ref|YP_002136394.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
 gi|196174292|gb|ACG75265.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
          Length = 348

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 72/171 (42%), Gaps = 13/171 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS--VSTV 116
           S G  DAP+T+VE++   C  C      T K +   Y   GK+R + R+FPL S  ++  
Sbjct: 185 SKGPNDAPITIVEFSDFQCPFCVRAE-PTVKDVMAAY--PGKVRVVYRDFPLPSHDLAPK 241

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A   A CA  +  G YW     LF       N K   D L   A+  G     FD CL  
Sbjct: 242 AAEAAHCAGDQ--GKYWEMHDRLF-----AANGKLAVDDLKGYAREVGVDGAKFDRCLES 294

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                 ++   K A E   +  TP FFI G L  G      F  +ID  ++
Sbjct: 295 GEKAPVVQEHHK-AGEAAGVSGTPAFFINGRLISGAQPLEAFKAVIDQELK 344


>gi|167044022|gb|ABZ08708.1| putative DSBA-like thioredoxin domain protein [uncultured marine
           crenarchaeote HF4000_APKG3K8]
          Length = 224

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 102/228 (44%), Gaps = 30/228 (13%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPI--PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           GIV++ IA +  Y         +P+  P  +++   L   SP+      +G + AP+T+V
Sbjct: 13  GIVIIVIAGFSSYYFSLLEAQNMPMIKPTSMIN---LENGSPA------LGSESAPITIV 63

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKRMD 129
           E+    C  C  + + T   L D YI+TGK + +  + P L   S  A   + CAE +  
Sbjct: 64  EFGDYQCESCYYWFHNTRSTLIDNYIETGKAKLVFVDLPFLGRDSITAAQASYCAEDQEK 123

Query: 130 GGYWGFVSLLFNKQD------DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
             YW + ++L+  Q+       W      RD+L + A     + ++F+ C++       +
Sbjct: 124 --YWEYHTILYTFQEIEGYDSGWAG----RDSLNSFASTLDMNMDEFNDCMDSSKYKIRV 177

Query: 184 KAGKKRASEDFAIDSTPVFFI-----GGNLYLGDMSEGVFSKIIDSMI 226
           KA    A ++  + STP F I         + G     VF+  I+SM+
Sbjct: 178 KANYNEAVKN-GVQSTPTFIIISSDGTTKKFAGAQPYSVFAATIESML 224


>gi|222525231|ref|YP_002569702.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
 gi|222449110|gb|ACM53376.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
          Length = 232

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 82/169 (48%), Gaps = 6/169 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G+ DAPVTMV Y+   C  CA         L + ++ TG++R + R   L  +   + +
Sbjct: 68  LGRPDAPVTMVIYSDFLCTSCAIHTLDVEPRLIEAFVATGQMRLVYRH--LLQLGERSQI 125

Query: 120 LARCAEKRMDGGY-WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           LA  +E   D GY W     ++ + +      N R+ ++++A   G  ++ F TCL+   
Sbjct: 126 LAEASECASDFGYFWELRREIYARYNQLYF--NTRETVIDLAAGLGIPRDAFTTCLDSHT 183

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
               ++A    A E+  + + PVF IG  + +G      F+++I+ + Q
Sbjct: 184 YQAQVQADYAAAIEE-GVYARPVFRIGTEVIVGSQRFETFAQVIERVGQ 231


>gi|269962760|ref|ZP_06177102.1| hypothetical protein VME_34860 [Vibrio harveyi 1DA3]
 gi|269832515|gb|EEZ86632.1| hypothetical protein VME_34860 [Vibrio harveyi 1DA3]
          Length = 260

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 83/181 (45%), Gaps = 21/181 (11%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTV 116
           S+G  +A + ++E++   C +C  F + TF  +++ Y+ +GK++Y+ R+FPL     +  
Sbjct: 86  SMGADNATIAIIEFSDYQCPYCKRFTDNTFAKIKENYVDSGKVKYLTRDFPLGFHPQAKG 145

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN-MAKFAGFSKNDFDTCLN 175
           A + A C+ K+  G YW     LF+      N +N   AL    A       + F  CL 
Sbjct: 146 AAIAANCSFKQ--GEYWPMRHALFS------NMRNLNTALYQKTASDLKLDIDKFSACLE 197

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVF---------FIGGNLYLGDMSEGVFSKIIDSMI 226
           D  +  +++     AS    I  TP F          +G  L +G     VFS + D ++
Sbjct: 198 DPQMAKNVENDIALAST-LGIRGTPSFVVGRIEDGQLVGAQLVVGAQDYRVFSALFDDLL 256

Query: 227 Q 227
           +
Sbjct: 257 K 257


>gi|329765194|ref|ZP_08256774.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329138100|gb|EGG42356.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 214

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 82/179 (45%), Gaps = 24/179 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV-STVAV 118
           +G   A +T++E+    C  C +FH  T   ++  +I TGK++ + ++FPL+   S +A 
Sbjct: 47  LGNPSASITILEFGDYQCTFCYKFHQGTLNTIKHDFIDTGKVKLVFKDFPLNGADSILAA 106

Query: 119 MLARCAEKRMDGGYWGFVSLLFN----KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
             A CA+ +    YW +   ++     ++  W+     RD+L   A       + F+ CL
Sbjct: 107 EGAHCAQDQEK--YWQYHDEIYKNWAGERTGWVT----RDSLDKFATTVNLDLDKFNECL 160

Query: 175 NDQNILDDIKA----GKKRASEDFAIDSTPVFFIGGNLYL----GDMSEGVFSKIIDSM 225
           +    L+ +      GKK       +D+TP FF+  N  +    G+    VF K ID  
Sbjct: 161 DSHKYLEKVNQLYDFGKK-----IGVDATPSFFVFNNEKIIKITGNQPLEVFLKTIDEF 214


>gi|28900849|ref|NP_800504.1| hypothetical protein VPA0994 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836907|ref|ZP_01989574.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260362538|ref|ZP_05775458.1| dsba oxidoreductase [Vibrio parahaemolyticus K5030]
 gi|260879217|ref|ZP_05891572.1| dsba oxidoreductase [Vibrio parahaemolyticus AN-5034]
 gi|260896752|ref|ZP_05905248.1| dsba oxidoreductase [Vibrio parahaemolyticus Peru-466]
 gi|28809295|dbj|BAC62337.1| putative membrane protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749865|gb|EDM60610.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308087287|gb|EFO36982.1| dsba oxidoreductase [Vibrio parahaemolyticus Peru-466]
 gi|308094101|gb|EFO43796.1| dsba oxidoreductase [Vibrio parahaemolyticus AN-5034]
 gi|308115242|gb|EFO52782.1| dsba oxidoreductase [Vibrio parahaemolyticus K5030]
          Length = 262

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 14/150 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G KDA + ++E++   C +C  F +  FK +++ YI TGK++YI R+FPL   +     
Sbjct: 87  LGSKDAKIAIIEFSDFQCPYCKRFTDSAFKQIKENYIDTGKVQYIARDFPLSFHAKAMGA 146

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                       YW    +LF+   D +  + Y+ A  +++     +  +F+ C+ D++I
Sbjct: 147 AIAATCSLHQNSYWPMRDMLFSNVKD-LGEELYQKAATDLS----LNLEEFNKCMKDKSI 201

Query: 180 LD----DIKAGKKRASEDFAIDSTPVFFIG 205
            +    D+  GK        I  TP F IG
Sbjct: 202 ANKVEQDLTLGK-----SLGIRGTPSFLIG 226


>gi|183220540|ref|YP_001838536.1| hypothetical protein LEPBI_I1143 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910650|ref|YP_001962205.1| oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167775326|gb|ABZ93627.1| Oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167778962|gb|ABZ97260.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 349

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 82/176 (46%), Gaps = 22/176 (12%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTV 116
           SIG KDA VT++E++   C  C    +     L +KY   G++R++ R+FPL     +  
Sbjct: 188 SIGPKDAKVTVIEFSDFECPFCKRSQDVN-NQLREKY--KGQIRWVFRDFPLPFHQDAMY 244

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A M A C+ +  +G YW   ++LF    +   SK     L       G SK  + +C+ D
Sbjct: 245 AHMAANCSIE--EGKYWDVFNVLFENSGNLSKSKVDEFVLK-----TGLSKEKYQSCMKD 297

Query: 177 QNILD-----DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           Q+ L      DI+ G+K       +  TP FFI G    G +    F +II   ++
Sbjct: 298 QSKLKSEIEADIQDGQK-----VGVSGTPAFFINGIFVSGALPFENFDEIIQKELK 348


>gi|163847385|ref|YP_001635429.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|163668674|gb|ABY35040.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
          Length = 242

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 82/169 (48%), Gaps = 6/169 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G+ DAPVTMV Y+   C  CA         L + ++ TG++R + R   L  +   + +
Sbjct: 78  LGRPDAPVTMVIYSDFLCTSCAIHTLDVEPRLIEAFVATGQMRLVYRH--LLQLGERSQI 135

Query: 120 LARCAEKRMDGGY-WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           LA  +E   D GY W     ++ + +      N R+ ++++A   G  ++ F TCL+   
Sbjct: 136 LAEASECASDFGYFWELRREIYARYNQLYF--NTRETVIDLAAGLGIPRDAFTTCLDSHT 193

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
               ++A    A E+  + + PVF IG  + +G      F+++I+ + Q
Sbjct: 194 YQAQVQADYAAAIEE-GVYARPVFRIGTEVIVGSQRFETFAQVIERVGQ 241


>gi|241766654|ref|ZP_04764500.1| DSBA oxidoreductase [Acidovorax delafieldii 2AN]
 gi|241363048|gb|EER58691.1| DSBA oxidoreductase [Acidovorax delafieldii 2AN]
          Length = 259

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 65/151 (43%), Gaps = 10/151 (6%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTV 116
           ++G   AP+T+V +    C  C  F  ++   L   YI TGKLR ILR+ PLD    +  
Sbjct: 83  TLGATSAPLTLVMFTDHECPFCKRFLQESLPRLRQDYIDTGKLRLILRDLPLDMHPNAQK 142

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A  +ARCA ++  G +W  +    +  +          A+  + +  G   +  D C+ D
Sbjct: 143 AAEVARCAAEQ--GKHWPLLEAFASAPEPLAQP-----AMARLIQGMGLDASRIDACVAD 195

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
                 +KA    A      + TP F +G  
Sbjct: 196 GRYTAKVKASVAEARR-LGFNGTPTFVLGAT 225


>gi|254392758|ref|ZP_05007930.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|197706417|gb|EDY52229.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
          Length = 249

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 77/174 (44%), Gaps = 15/174 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV M+EY  + C  C  F  +T   L +KY+ TG LR   R  P     ++ 
Sbjct: 86  LALGSPDAPVVMIEYVDLRCSPCGAFVRETETELIEKYVDTGILRIEWRNAPAPGEDSMN 145

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN-----DFDT 172
           +  A  A  +  G +  F +L+  +  D ++     D L  +A  AG         DF  
Sbjct: 146 LARAAWAAGQQ-GRFRQFRALVHARAADTLSE----DGLKKLAAKAGVRDPERFSIDFHA 200

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            L D  IL+D     +  +E+  I STP F I G    G      F++ ID  +
Sbjct: 201 RLADVAILED-----QTEAEEIGIPSTPYFLINGQPVKGIHPLDTFTEAIDKAL 249


>gi|328470754|gb|EGF41665.1| hypothetical protein VP10329_08137 [Vibrio parahaemolyticus 10329]
          Length = 262

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 14/150 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G KDA + ++E++   C +C  F +  FK +++ YI TGK++YI R+FPL   +     
Sbjct: 87  LGSKDAKIAIIEFSDFQCPYCKRFTDSAFKQIKENYIDTGKVQYIARDFPLSFHAKAMGA 146

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                       YW    +LF+   D +  + Y+ A  +++     +  +F+ C+ D++I
Sbjct: 147 AIAATCSLHQNSYWPMRDMLFSNVKD-LGEELYQKAAADLS----LNLEEFNKCMKDKSI 201

Query: 180 LD----DIKAGKKRASEDFAIDSTPVFFIG 205
            +    D+  GK        I  TP F IG
Sbjct: 202 ANKVEQDLTLGK-----SLGIRGTPSFLIG 226


>gi|329765084|ref|ZP_08256668.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329138461|gb|EGG42713.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 233

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 75/152 (49%), Gaps = 16/152 (10%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTV 116
           +G  +AP+T++E+    C+ C +F +KT   L   +++TGK++ I ++F +   DS+S  
Sbjct: 62  LGDPNAPITLIEFGDYQCYFCNQFFHKTEDELFKNFVETGKVKVIFKDFTIIGADSISAA 121

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFN----KQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
                   +    G +W +   L+N    + + W +SKN    LL  A   G + ++F  
Sbjct: 122 HAAHCADDQ----GFFWEYHDTLYNNWTGENNGWASSKN----LLQFAGDVGLNIDEFSK 173

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           C+ D      I A   + ++D  +  TP FF+
Sbjct: 174 CMIDSKYSTKI-ANSNKDAKDLGLTGTPAFFV 204


>gi|94969550|ref|YP_591598.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
 gi|94551600|gb|ABF41524.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
          Length = 281

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 75/170 (44%), Gaps = 12/170 (7%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           D  V +RA L  +    K    G K+APVT+VE+A + C  C          +E    + 
Sbjct: 96  DPFVRYRAALQKADGPSK----GPKNAPVTIVEFADLECPAC----KAALPSIEKMQTEN 147

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAE--KRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
             +R I + FPL+ +   A   A   +  K  D   W F+  ++  Q D IN +N  D+L
Sbjct: 148 ANVRVIFQNFPLEKLHPWAARAALYVDCLKTDDVVAWKFIDGVYEHQQD-INEQNADDSL 206

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
              A  AG        C+ D     +++A +K   E  AI STP  FI G
Sbjct: 207 KKYAGEAGADAAKTAGCIADPKTRANVQASEKL-GEGLAITSTPTLFING 255


>gi|156743266|ref|YP_001433395.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
 gi|156234594|gb|ABU59377.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
          Length = 255

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 56/150 (37%), Gaps = 3/150 (2%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   APV + EY+   C  CA +        E +YI TGK++++  E+PL      A   
Sbjct: 80  GSAGAPVVVTEYSDFQCPGCAYYATALSSQFEQEYIATGKVKFVYHEYPLSGHVNGAPAA 139

Query: 121 ARCAEKRMDGG--YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                    G   YW     LF  Q  W    + R   +  A+  G     F+ C     
Sbjct: 140 QAARCAGEQGADKYWAMHDYLFTNQRQWSGQADPRAQFVAYARQIGLDTAAFEQCYAGNR 199

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             D I   K  A +   I  TP F + G L
Sbjct: 200 FRDAINQAKA-AGDALRIPGTPSFAVNGRL 228


>gi|326445250|ref|ZP_08219984.1| hypothetical protein SclaA2_29487 [Streptomyces clavuligerus ATCC
           27064]
          Length = 227

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 77/174 (44%), Gaps = 15/174 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV M+EY  + C  C  F  +T   L +KY+ TG LR   R  P     ++ 
Sbjct: 64  LALGSPDAPVVMIEYVDLRCSPCGAFVRETETELIEKYVDTGILRIEWRNAPAPGEDSMN 123

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN-----DFDT 172
           +  A  A  +  G +  F +L+  +  D ++     D L  +A  AG         DF  
Sbjct: 124 LARAAWAAGQQ-GRFRQFRALVHARAADTLSE----DGLKKLAAKAGVRDPERFSIDFHA 178

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            L D  IL+D     +  +E+  I STP F I G    G      F++ ID  +
Sbjct: 179 RLADVAILED-----QTEAEEIGIPSTPYFLINGQPVKGIHPLDTFTEAIDKAL 227


>gi|317486445|ref|ZP_07945271.1| DSBA-like thioredoxin domain-containing protein [Bilophila
           wadsworthia 3_1_6]
 gi|316922301|gb|EFV43561.1| DSBA-like thioredoxin domain-containing protein [Bilophila
           wadsworthia 3_1_6]
          Length = 294

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 83/179 (46%), Gaps = 28/179 (15%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPVT+V Y+  TC +C +      K L++     GK++Y+ + FPL+  +T A  L
Sbjct: 125 GAADAPVTIVAYSDFTCPYCQQAAGTMEKVLKENL---GKIKYVFKHFPLE--TTGAARL 179

Query: 121 A---RCAEKRMDGGY-WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A     A  R D    W F  LLF ++ D +  K+   A++N AK AG         LN 
Sbjct: 180 AAEYHVAAARQDPELAWKFYDLLFARRADVL--KDGEPAIVNAAKDAG---------LNM 228

Query: 177 QNILDDIKAGKKRASED--------FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           + +  D+K    RA  D          +  TP F I   +  G +S  +F + I+  +Q
Sbjct: 229 KKLAADVKRKDVRAEVDADIAEGQRIGVQGTPYFLINNLVARGALSSDLFKEAINMALQ 287


>gi|227495615|ref|ZP_03925931.1| DSBA oxidoreductase [Actinomyces coleocanis DSM 15436]
 gi|226830847|gb|EEH63230.1| DSBA oxidoreductase [Actinomyces coleocanis DSM 15436]
          Length = 275

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 77/158 (48%), Gaps = 10/158 (6%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE---FPLDSVST 115
           S+G  DAPV +V Y   +C  C  F+  T   L+ K +  GKLR   R+   FP +  S 
Sbjct: 104 SLGSPDAPVVLVSYEDFSCPMCGVFNTNTHPALK-KLVDEGKLRLEFRDMVIFP-NYNSQ 161

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSK-NDFDTC 173
           +A   AR A ++  G +W FV   F +  +  N  NY ++ +L++AK AG    + F+  
Sbjct: 162 LAHQGARAAAQQ--GKFWEFVDKAFAQTANG-NHPNYTKELVLDIAKQAGVENLSAFEKA 218

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           L    I+  ++A  + A E   +  TP F I   +  G
Sbjct: 219 LESDEIVQAVQAETQHAREKLGLTGTPFFIINNAVVSG 256


>gi|329764757|ref|ZP_08256352.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329138807|gb|EGG43048.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 230

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 87/179 (48%), Gaps = 20/179 (11%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTV 116
           +G+  AP+T++E+    C  C +++  T   ++  YI TGK++ I  +FP+   DS++  
Sbjct: 59  LGESSAPITIIEFGDYQCPFCQKWNQNTKPLIDRDYISTGKVKLIYVDFPIVGPDSINAH 118

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMAKFAGFSKNDFDT 172
           A   + CA+++  G YW +   L+  Q      W++  N ++ +  M    G   N F  
Sbjct: 119 AG--SYCADEQ--GLYWQYHDFLYKNQGHENSGWVSMNNLKNIVSGM---EGIDVNLFSN 171

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFF-IGGNLY----LGDMSEGVFSKIIDSMI 226
           C++     D +K  K  A ++ A  STP F  IG N +     G     VF + ID M+
Sbjct: 172 CIDSGKYNDRVKENKNIAVKNGA-KSTPSFIVIGPNGHGVAISGAQPYSVFKQTIDEMM 229


>gi|167624423|ref|YP_001674717.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
 gi|167354445|gb|ABZ77058.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
          Length = 266

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 88/185 (47%), Gaps = 25/185 (13%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTVAV 118
           G   A + ++E++   C +C  F ++TF  L+  YI TGK++Y+ R+FPL+    +  A 
Sbjct: 88  GDATAQLAIIEFSDYQCPYCKRFIDQTFTKLKSNYIDTGKVQYLTRDFPLNFHPKAKGAA 147

Query: 119 MLARCAEKRMDGGYWGFVSLLFN--KQ-DDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           + A C+ ++    YW     LF   KQ DD +  +   +  L+M K        F+ CL 
Sbjct: 148 IAANCSLQQ--DAYWPMRDSLFKNMKQLDDELYQQIASNLSLDMTK--------FNACLA 197

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIG---------GNLYLGDMSEGVFSKIIDSMI 226
           D+ +L+ ++      S    I  TP F IG           L +G  S   F++++D ++
Sbjct: 198 DEQMLNKVQQDVAYGS-SLGIRGTPSFVIGRVENGQLISPKLIVGAQSYQTFARLLDELL 256

Query: 227 QDSTR 231
            +  +
Sbjct: 257 ANPKK 261


>gi|219850456|ref|YP_002464889.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
 gi|219544715|gb|ACL26453.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
          Length = 293

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 76/165 (46%), Gaps = 5/165 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS-TVAV 118
           +G  +APVT+VE+    C  C   H  TF+ L ++++ TG++ Y+++  P+ S     A 
Sbjct: 104 LGDPNAPVTIVEFTDFGCPFCRRHHLLTFRTLVEEFVATGRVFYVIKHLPVSSQQGEQAA 163

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN-MAKFAGFSKNDFDTCLNDQ 177
           + A CA ++  G YW   + LF   + W  ++      ++ +A   GF       C  ++
Sbjct: 164 LAAICAGEQ--GRYWEMHNALFADGEAWQGNETIAQRRIDAIAAELGFDVAALRAC-TER 220

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
                I A     +    +  TPVFFI   L  G     V+ +++
Sbjct: 221 TDTKAIIARHVSEAHTLRVFGTPVFFINNRLLAGAQPIEVWRQVL 265


>gi|161528163|ref|YP_001581989.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339464|gb|ABX12551.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 219

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVST 115
           S+G  +AP+T++E+    C  C+E++ +T   L++KYI++G++  +  ++P    DS  T
Sbjct: 49  SLGNSNAPITIIEFGDFQCPFCSEWYKETAMPLKEKYIESGQVELVFVDYPFLGDDSYPT 108

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
                + CAE++  G YW F  +L+  Q D  +     D + + A         +D C++
Sbjct: 109 AHA--SYCAEQQ--GMYWEFHEILYLNQGDTNDGWASADKIRDFASQINLDMEKYDECMS 164

Query: 176 ----DQNILDDIKAGKKRASEDFAIDSTPVFFI 204
               +Q I   +K G     E   ++ TP F +
Sbjct: 165 SSEFNQKIDQSLKLG-----EVHEVNQTPTFIV 192


>gi|229097665|ref|ZP_04228623.1| hypothetical protein bcere0020_29060 [Bacillus cereus Rock3-29]
 gi|229116669|ref|ZP_04246055.1| hypothetical protein bcere0017_29540 [Bacillus cereus Rock1-3]
 gi|228666841|gb|EEL22297.1| hypothetical protein bcere0017_29540 [Bacillus cereus Rock1-3]
 gi|228685804|gb|EEL39724.1| hypothetical protein bcere0020_29060 [Bacillus cereus Rock3-29]
          Length = 238

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 98/225 (43%), Gaps = 19/225 (8%)

Query: 14  IVLLFIASYFFYTRKGS--ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
           I LLF+A+   +    +   LN+    +  V    ++   P   K  ++G++DAPV+++E
Sbjct: 21  IKLLFVATLIIFAAVTAFVVLNK----EDKVATNKVIKDLPPIGKQPTLGKEDAPVSIIE 76

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD-SVSTVAVMLARCAEKRMDG 130
           +    C  C  +  + F  L+  YI TGK+++         + S ++ + A    K+   
Sbjct: 77  FGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLFHGTESKLSALAAESVYKQDPQ 136

Query: 131 GYWGFVSLLFNKQ-----DDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDI 183
            YW F   LFN Q     D WI      + LL +AK    S N    +  L  Q   +++
Sbjct: 137 AYWSFHKELFNAQPANHDDPWITP----EKLLEIAKTYTPSINTVQLEEDLKKQTAQEEV 192

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
              +K  ++D+ ++ TP   I G +            +I+  ++D
Sbjct: 193 NKDEK-LTQDYGVEQTPSIVINGTMLSDPYDYEQIKNLIEKALKD 236


>gi|229162042|ref|ZP_04290016.1| hypothetical protein bcere0009_28230 [Bacillus cereus R309803]
 gi|228621448|gb|EEK78300.1| hypothetical protein bcere0009_28230 [Bacillus cereus R309803]
          Length = 218

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 79/166 (47%), Gaps = 15/166 (9%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR--YILREFP 109
           P   K  ++G++DAPV+++E+    C  C  +  + F  L+  YI TGK++  Y+   F 
Sbjct: 37  PPIGKQPTLGKEDAPVSVIEFGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLF- 95

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ-----DDWINSKNYRDALLNMAKFAG 164
             + S ++ + A    K+    YW F   LFN Q     D WI S    + LL +AK   
Sbjct: 96  HGTESKLSALAAESVYKQDPQAYWNFHKELFNAQPENHDDPWITS----EKLLEIAKTYT 151

Query: 165 FSKN--DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
            S N   F+  L  Q   +++   +K  ++D+ +  TP   + G +
Sbjct: 152 PSINATQFEEDLKKQTEQEEVNRDEK-LTQDYGVAQTPSIVVNGTM 196


>gi|159898007|ref|YP_001544254.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159891046|gb|ABX04126.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 250

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 91/211 (43%), Gaps = 25/211 (11%)

Query: 8   IGVLG--GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI--GQK 63
           +GV+G  GI  + + S    ++  S  N  P+P+     +A L A      D     GQ 
Sbjct: 28  LGVIGILGIGFVLVQSL---SKPASVSNTGPMPN-----QAGLNAPVGKTADNYWYKGQS 79

Query: 64  DAPVTMVEYASMTCFHCA----EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           DAPV +  YA   C  C     E     F  L   Y++TGK + I REFPL ++   A +
Sbjct: 80  DAPVKVEIYADYECPACRTLELELAQADFDGL---YVETGKAQVIFREFPLKTIHKSAQL 136

Query: 120 ---LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
              +ARCA  +    +W   + LF+ Q  W  S   +  ++   + AG  +   ++C++ 
Sbjct: 137 TAEIARCAGDQ--NLFWPIHNALFDSQTQWAQSLGPKTQIMAAVEQAGADRQKIESCVDA 194

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
               D I      A E   +  TP  F+ G 
Sbjct: 195 GTYTDVINTAYDAALER-QLQQTPTVFVDGQ 224


>gi|116071982|ref|ZP_01469250.1| hypothetical protein BL107_07519 [Synechococcus sp. BL107]
 gi|116065605|gb|EAU71363.1| hypothetical protein BL107_07519 [Synechococcus sp. BL107]
          Length = 242

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 73/169 (43%), Gaps = 10/169 (5%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           + S+G   AP+T+VE++   C +C +FH      L+ +YI+TG +R+I ++ PL      
Sbjct: 64  EPSLGTARAPLTIVEFSDFECRYCQQFHQTVMPNLKKEYIETGLVRFIHKDLPLPFHRQA 123

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
               A          YW     LF+ Q   +  K     ++ +A+  G   N    C+N 
Sbjct: 124 LPAAAAARCAGEQNKYWTTYGALFDGQ-SCLQCK----GVVAIAREQGVDANTLQACMNR 178

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGG----NLYLGDMSEGVFSKI 221
                 I A    A +   I +TP F IG     N + G++ EG    I
Sbjct: 179 AATKALINANVSEA-QLHGIRATPTFVIGPTRTDNSHRGEIVEGAMPWI 226


>gi|169631363|ref|YP_001705012.1| hypothetical protein MAB_4285 [Mycobacterium abscessus ATCC 19977]
 gi|169243330|emb|CAM64358.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 229

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 93/217 (42%), Gaps = 6/217 (2%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVT 68
           G+LG +V++ +A+Y     +  +      P       +L    P  +  +++G  DAPV 
Sbjct: 15  GILG-VVIVALATYLLVDHRSQSTASTDSPTVTGHSSSLARLRP--LDPLALGPVDAPVV 71

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM 128
           ++ Y+   C  CA+F   T   L ++Y+ TGKLR   R+ P+    +V    A  A    
Sbjct: 72  LIIYSDYRCPFCAKFSRDTEPQLIERYVNTGKLRIEWRDLPIFGTQSVQAAKAGRAAAEQ 131

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQNILDDIKAGK 187
            G +W F   ++    D  +++     LL+ A+ A       F T +    +L  ++   
Sbjct: 132 -GRFWEFNRAVYRHAPDRGHAELTDKILLDRAREAEVPDLARFQTAVESDRLLPAVQQDI 190

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           + A       STPVF I     +G     VF  +I+ 
Sbjct: 191 QEAVA-IGAASTPVFLINDQPVVGAQPLDVFISVIEQ 226


>gi|118575427|ref|YP_875170.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
 gi|118193948|gb|ABK76866.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
          Length = 212

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 79/174 (45%), Gaps = 10/174 (5%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +G  DAP+T+VE+    C  C  + + T   + ++YI+TG ++++  +   L   S  A 
Sbjct: 42  VGNADAPITIVEFGDYQCHQCYNWFHNTKPGITEEYIETGMVKFVFVDMAFLGRDSLPAS 101

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSK-NYRDALLNMAKFAGFSKNDFDTCLNDQ 177
           + A CA  +  G YW +  +L+  QD  I+S    R+ L   A   G     FD CL+  
Sbjct: 102 VAAYCAGDQ--GMYWEYHDMLYTLQDPQIDSGWASRERLKAFAFDLGLDPGVFDGCLDSN 159

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFI-----GGNLYLGDMSEGVFSKIIDSMI 226
                +++    A E F +  TP F I          +G     VF  ++DS +
Sbjct: 160 KHQGRVQSNVAEARE-FGVSGTPTFAIIFEDGRTETIVGAQPFSVFKNVLDSTV 212


>gi|94984799|ref|YP_604163.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
 gi|94555080|gb|ABF44994.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
          Length = 228

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 72/164 (43%), Gaps = 21/164 (12%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV------ 113
           +GQ++APVT+V +    C +C  F  +    L  KYI TGK + I   FP  +       
Sbjct: 53  LGQENAPVTLVVFEDFKCPNCKRFEEEFMPELRSKYIDTGKAKLISMNFPFIAAMSNLPV 112

Query: 114 --STVAVMLARCAEKRMDGG---YWGFVSLLFNKQ----DDWINSKNYRDALLNMAKFAG 164
             S +A   A CA   + GG   Y     +LF  Q    + W +    +D         G
Sbjct: 113 DDSKLAAQAAECA--YLQGGSEAYDRMKQILFRAQGAESEVWASKSRLKDL---AGSVEG 167

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             +  F+TCL++      ++A K++A E   +  TP  F+ G L
Sbjct: 168 IDQAKFNTCLDNDETAAAVEADKQQA-EKAGVSGTPSVFVNGKL 210


>gi|228907645|ref|ZP_04071502.1| hypothetical protein bthur0013_18120 [Bacillus thuringiensis IBL
           200]
 gi|228852137|gb|EEM96934.1| hypothetical protein bthur0013_18120 [Bacillus thuringiensis IBL
           200]
          Length = 226

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 79/166 (47%), Gaps = 15/166 (9%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR--YILREFP 109
           P   K  ++G++DAPV+++E+    C  C  +  + F  L+  YI TGK++  Y+   F 
Sbjct: 45  PPIGKQPTLGKEDAPVSIIEFGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLF- 103

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ-----DDWINSKNYRDALLNMAKFAG 164
             + S ++ + A    K+    YW F   LFN Q     D WI      + LL +AK   
Sbjct: 104 HGTESKLSALAAESVYKQDPQAYWSFHKELFNAQPENHDDPWITP----EKLLEIAKTYT 159

Query: 165 FSKN--DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
            S N    +  L  Q   +++   +K  ++D++++ TP   + G +
Sbjct: 160 PSINTTQLEEDLKKQTEQEEVNRDEK-LTQDYSVEQTPSIVVNGTM 204


>gi|319654019|ref|ZP_08008112.1| hypothetical protein HMPREF1013_04731 [Bacillus sp. 2_A_57_CT2]
 gi|317394341|gb|EFV75086.1| hypothetical protein HMPREF1013_04731 [Bacillus sp. 2_A_57_CT2]
          Length = 226

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 76/185 (41%), Gaps = 13/185 (7%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR--YILREFP 109
           PS      +G+ DAPVT+VE+    C  C  +    F  L + Y+ TGK++  YI   F 
Sbjct: 46  PSIEGQPVLGKSDAPVTVVEFGDFKCPACKAWGQNIFPKLVEDYVDTGKVKFSYINVLFH 105

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD------WINSKNYRDALLNMAKFA 163
            D  S +  + A    K+    YW F   LF+ Q D      WI  +  ++     +   
Sbjct: 106 GDE-SKLGSVAAEAVYKQNPDSYWDFNKALFDAQPDEDHDSLWITMEKIKEV---ASAIP 161

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G   N  +  +  Q I+D++        E++ I  TP   + G +            +ID
Sbjct: 162 GIDTNQLEKDIQSQEIIDEVN-NDSALVEEYKIQQTPSIMVNGTMLEDPFDYEKIKSLID 220

Query: 224 SMIQD 228
             ++D
Sbjct: 221 QALED 225


>gi|149908466|ref|ZP_01897129.1| putative membrane protein [Moritella sp. PE36]
 gi|149808629|gb|EDM68564.1| putative membrane protein [Moritella sp. PE36]
          Length = 254

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 86/184 (46%), Gaps = 25/184 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTVA 117
           +G   A + ++E++   C +C  F ++TF  L+  YI  GK++Y+ R+FPL     +  A
Sbjct: 82  LGDAGAQLAIIEFSDYQCPYCKRFIDQTFDKLKANYIDVGKVQYLTRDFPLSFHPKAKGA 141

Query: 118 VMLARCAEKRMDGGYWGFVSLLFN--KQ-DDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
            + A C+ ++    YW   + LFN  KQ  D +  +   D  L+M KF+         CL
Sbjct: 142 AVAANCSLQQ--DAYWPMRTALFNNMKQLGDELYQQTATDLSLDMTKFSD--------CL 191

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIG---------GNLYLGDMSEGVFSKIIDSM 225
           +D   L  ++A     +    I  TP F +G           L +G  S   F  ++D +
Sbjct: 192 SDPQTLSKVEADMALGTS-LGIRGTPSFVVGRIEDNQLVNPQLIVGAQSYETFVALLDGL 250

Query: 226 IQDS 229
           ++++
Sbjct: 251 MKEN 254


>gi|219847445|ref|YP_002461878.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
 gi|219541704|gb|ACL23442.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
          Length = 232

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 67/151 (44%), Gaps = 6/151 (3%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV---STVA 117
           G  DAPV ++ +    C  CA F       LE  YI TGK+++I  E PL ++   +  A
Sbjct: 66  GNPDAPVKVIAFEDYQCPGCAFFTRNLEPILERDYINTGKVQFIYHELPLTNIHPNALPA 125

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
              ARCA  +  G +W     LF  Q  W    +  +     A   G  +  FD+C+   
Sbjct: 126 AEAARCAGDQ--GKFWEMHGQLFANQSIWSQLNSPLNTFSGYAGIIGIDRAAFDSCMQAA 183

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
              + I A  + A+E   + +TP F + G +
Sbjct: 184 THREAILAAAQSAAE-LGVQATPSFSVNGQI 213


>gi|256784583|ref|ZP_05523014.1| hypothetical protein SlivT_08843 [Streptomyces lividans TK24]
          Length = 231

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 73/170 (42%), Gaps = 9/170 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           ++IG+ DAPV ++EY+   C  C  F  +T   L   Y+  G LR   R FP+    +  
Sbjct: 50  LAIGRADAPVVLIEYSDFQCPFCGRFARETKPELLRSYVDKGTLRIEWRNFPIFGEESEQ 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             LA  A  R +  +W F  + + K  +        + L+ MA+ AG +    D      
Sbjct: 110 AALAGWAAGRQN-KFWEFHDVAYGKPRERNTGAFDAENLVAMAREAGIA----DIERFQA 164

Query: 178 NILDDIKAGKKRASED----FAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           ++  D   G  RA ++      + STP F + G   LG      F + ++
Sbjct: 165 DMASDEARGAVRADQEEGYTLGVTSTPAFLVNGRPILGAQPTDTFEEAVE 214


>gi|289768468|ref|ZP_06527846.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gi|289698667|gb|EFD66096.1| conserved hypothetical protein [Streptomyces lividans TK24]
          Length = 270

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 73/170 (42%), Gaps = 9/170 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           ++IG+ DAPV ++EY+   C  C  F  +T   L   Y+  G LR   R FP+    +  
Sbjct: 89  LAIGRADAPVVLIEYSDFQCPFCGRFARETKPELLRSYVDKGTLRIEWRNFPIFGEESEQ 148

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             LA  A  R +  +W F  + + K  +        + L+ MA+ AG +    D      
Sbjct: 149 AALAGWAAGRQN-KFWEFHDVAYGKPRERNTGAFDAENLVAMAREAGIA----DIERFQA 203

Query: 178 NILDDIKAGKKRASED----FAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           ++  D   G  RA ++      + STP F + G   LG      F + ++
Sbjct: 204 DMASDEARGAVRADQEEGYTLGVTSTPAFLVNGRPILGAQPTDTFEEAVE 253


>gi|149186057|ref|ZP_01864371.1| protein-disulfide isomerase [Erythrobacter sp. SD-21]
 gi|148830088|gb|EDL48525.1| protein-disulfide isomerase [Erythrobacter sp. SD-21]
          Length = 248

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 85/209 (40%), Gaps = 42/209 (20%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKT 87
           +G  + E+  PDG      L  AS +      IG  DAP+ +VEYAS TC  CA F    
Sbjct: 33  EGEQIAEIAAPDGS---SWLETASGTEEGGFVIGNPDAPLKLVEYASHTCGACAMFAETG 89

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI 147
              L+++Y+ +G++ Y +R    D +      LARC      G    F +L       W 
Sbjct: 90  SAPLQEEYVASGRVSYEIRPLLRDPLDVTISTLARC------GSPASFHAL---ADQAWA 140

Query: 148 NSKNYRDAL-------------------LNMAKFAGF---------SKNDFDTCLND-QN 178
           +   + DAL                   + +A+ AG          S +   TCL D Q 
Sbjct: 141 SLPEFGDALQSNAGAYEAAMNAPENERFVRIAEAAGLVDFFAARGISADQARTCLADGQA 200

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           I    +   ++AS D  +  TP FF+ G 
Sbjct: 201 ITAMAQKSSEQASAD-GVTGTPTFFLNGQ 228


>gi|161528147|ref|YP_001581973.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339448|gb|ABX12535.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 220

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 79/180 (43%), Gaps = 9/180 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LD 111
           + M    +G  +AP+T+VE+    C  C  + + T   +   YI TGK   +  +   L 
Sbjct: 44  TAMGSPILGDPNAPITIVEFGDYQCHQCYNWFHNTKPTITRDYIDTGKANLVFVDMAFLG 103

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA-GFSKNDF 170
             S+ A     CAE +  G YW +  +L+N Q+  I+     +  L    F+ G     F
Sbjct: 104 RDSSPAAQATYCAEDQ--GMYWEYHDMLYNAQESKIDGGWANNERLKAFAFSMGLDMELF 161

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI----GGNLYLGDMSEGVFSKIIDSMI 226
           ++CL+       ++   ++A  D  +  TP FFI    G     G     VF +++D M+
Sbjct: 162 ESCLDSGKYSKRVQYNTQQA-RDHNVRGTPGFFIVGPDGQQQIGGAQPFSVFKQVLDPMV 220


>gi|167042115|gb|ABZ06849.1| putative DSBA-like thioredoxin domain protein [uncultured marine
           crenarchaeote HF4000_ANIW93E5]
          Length = 224

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 81/175 (46%), Gaps = 10/175 (5%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           ++G + AP+T+VE+    C  C  + + T   + D YI+TGK + I  + P L   S  A
Sbjct: 53  ALGSESAPITIVEFGDYQCESCYYWFHNTRSTIIDNYIETGKAKLIFVDLPFLGRDSKTA 112

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA-GFSKNDFDTCLND 176
              + CAE +  G YW + ++L+  QD   +S       LN   F    + ++F+ C++ 
Sbjct: 113 AQASYCAEDQ--GKYWEYHTMLYTFQDGAPDSGWASQDRLNSFAFTLEMNMDEFNDCMDS 170

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFI-----GGNLYLGDMSEGVFSKIIDSMI 226
                 ++A    A +  A  STP F I         + G     VF+  I+SM+
Sbjct: 171 SKYKIRVQANYHEAVKQGA-QSTPTFIIISSDGTTKKFAGAQPYSVFAATIESML 224


>gi|260753773|ref|YP_003226666.1| protein-disulfide isomerase-like protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553136|gb|ACV76082.1| Protein-disulfide isomerase-like protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 256

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 78/193 (40%), Gaps = 39/193 (20%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV++VEYAS TC HCA+F  + F  L D YI  G ++   R    D       +
Sbjct: 67  MGNPKAPVSLVEYASFTCPHCADFTQEGFPKLRDNYIAKGLVKLEFRNLVRDPFDIALTL 126

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK------------ 167
           LARC   R    ++     LF +Q          D   ++ + AG  +            
Sbjct: 127 LARC---RGAETFFPIADQLFQEQKPMFERIQNADK-ADLQRVAGLPQDQQMAEYIRLTG 182

Query: 168 -NDF-----------DTCLNDQ---NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
            N F           + CL DQ    IL DI++   + +    +  TP+F I G L    
Sbjct: 183 MNPFFGNRGLPTSAQNKCLTDQAAIKILMDIRSIADKQN----VTGTPMFLINGTL---- 234

Query: 213 MSEGVFSKIIDSM 225
              G+ S I D +
Sbjct: 235 QEVGIGSPIWDQL 247


>gi|253574877|ref|ZP_04852217.1| disulfide dehydrogenase D [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251845923|gb|EES73931.1| disulfide dehydrogenase D [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 237

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 77/172 (44%), Gaps = 7/172 (4%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +GQ DAPV +VE+    C  C   +      L   YI  GK+ +     P + S S  A 
Sbjct: 65  LGQADAPVKIVEFGDYQCPSCKHVNELIKPELVKDYIDQGKVAFYFMNLPFIGSDSFTAA 124

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND-- 176
           + A+    + +  +W +   +F +Q +  N     + L+N+AK       D+D    D  
Sbjct: 125 LAAQSVYHQSNDAFWKYFDAIFERQGEENNGWASPEFLVNLAKELELPI-DYDLLQKDIA 183

Query: 177 -QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE-GVFSKIIDSMI 226
                D+++A   R  +   +DSTP FFI G  Y G++ +     K ID+ +
Sbjct: 184 EATYQDEVQAQLARGDK-LGVDSTPTFFINGIEYAGNLGDYETLKKTIDNEL 234


>gi|297566270|ref|YP_003685242.1| DSBA oxidoreductase [Meiothermus silvanus DSM 9946]
 gi|296850719|gb|ADH63734.1| DSBA oxidoreductase [Meiothermus silvanus DSM 9946]
          Length = 236

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 70/171 (40%), Gaps = 19/171 (11%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           AA P+       G   A VT+V++++  C HCA+   +    +   Y+ TGK+RYI R+F
Sbjct: 37  AADPAAGARFVFGSPSAKVTIVDFSNYLCPHCADHALRNVPEIFRDYVDTGKVRYIFRDF 96

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW--INSKNYRDALLNMAKFAGFS 166
           P      V       A       Y  +  +LF  Q  W  ++        +++A   G  
Sbjct: 97  PFTGQDNVIRAGEAAACAADANRYRDYHEVLFRAQRLWGGLSGAALDQFFIDLASQLGIP 156

Query: 167 KNDFDTCLNDQNILDDIKAGKKRA--------SEDFAIDSTPVFFIGGNLY 209
              F  CL         ++G KRA        +   A+  TP FF+ G L+
Sbjct: 157 AGPFAECL---------RSGSKRAGVLADRDLTTQLALRGTPTFFVNGQLF 198


>gi|85709147|ref|ZP_01040213.1| protein-disulfide isomerase [Erythrobacter sp. NAP1]
 gi|85690681|gb|EAQ30684.1| protein-disulfide isomerase [Erythrobacter sp. NAP1]
          Length = 248

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 72/170 (42%), Gaps = 28/170 (16%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DAP+ +VEYAS TC  CA+F   T K    +Y+ TG + +  R    D +      
Sbjct: 61  LGNPDAPIKLVEYASHTCGGCAQFA-ATAKEPIKEYVATGVVSFEQRNLVRDPIDLTIAT 119

Query: 120 LARCAE----KRMDGGYWGFVSLLFNKQDDWINSKN--YRDA--------LLNMAKFAGF 165
           L RC      + +    W  +   FN     +NS N  Y+ A         + +A+ AG 
Sbjct: 120 LVRCGADENMQTLSDMAWAQLPAFFNN----VNSNNAAYQAAGNAPPEQRFIGIAQAAGL 175

Query: 166 ---------SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                    S +    CL+D + ++ I       + +  I+STP F + G
Sbjct: 176 VEFFAARGISADQQRACLSDVSTIESIANNSSEQANELGINSTPTFLLNG 225


>gi|229134023|ref|ZP_04262843.1| hypothetical protein bcere0014_29380 [Bacillus cereus BDRD-ST196]
 gi|228649358|gb|EEL05373.1| hypothetical protein bcere0014_29380 [Bacillus cereus BDRD-ST196]
          Length = 226

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 83/186 (44%), Gaps = 15/186 (8%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR--YILREFP 109
           P   K  ++G++DAPV+++E+    C  C  +  + F  L+  YI TGK++  Y+   F 
Sbjct: 45  PPIGKQPTLGKEDAPVSVIEFGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLF- 103

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ-----DDWINSKNYRDALLNMAKFAG 164
             + S ++ + A    K+    YW F   LFN Q     D WI      + LL +AK   
Sbjct: 104 HGTESKLSALAAESVYKQDPQAYWSFHKELFNAQPENHDDPWITP----EKLLEIAKTYT 159

Query: 165 FSKN--DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            S N    +  L  Q   +++    +  ++D+ ++ TP   + G +            +I
Sbjct: 160 PSINTLQLEEDLKKQTTQEEVNKD-ENLTQDYGVEQTPSIVLNGTMLSDPYDYEQIKNLI 218

Query: 223 DSMIQD 228
           +  ++D
Sbjct: 219 EKTLKD 224


>gi|167043690|gb|ABZ08383.1| putative DSBA-like thioredoxin domain protein [uncultured marine
           crenarchaeote HF4000_APKG2O16]
          Length = 284

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 102/214 (47%), Gaps = 22/214 (10%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
           T     L+E+ I + +   +  +A+       + +G  +AP+TM+E+    C  C +F +
Sbjct: 81  TESTQVLDEITINEIITTKKPTIASFYDNASPI-LGDLNAPLTMIEFGDYQCTFCKKFFD 139

Query: 86  KTFKYLEDKYIKTGKLRYILREFPL---DSVSTVAVMLARCA-EKRMDGGYWGFVSLLFN 141
           +T + +   Y++TGK++ + ++F +   DSV+  A   A CA +++M   +W + S L+N
Sbjct: 140 ETEESILTNYVETGKVKMLFKDFIVVNEDSVN--AASAAHCANDQKM---FWQYHSTLYN 194

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND---QNILDDIKAGKKRASEDFAIDS 198
             D         + L   A   G   + F  C++    + ++D   A  +       +D+
Sbjct: 195 NWDGEGTGWASSEQLHQFASTLGLDMDKFSECMSKSKWKELVDSSHADGRT----LGVDA 250

Query: 199 TPVFFI---GGNLY--LGDMSEGVFSKIIDSMIQ 227
           TP FFI     N+   +G     VF ++ DS+++
Sbjct: 251 TPTFFIIDQNNNVLKIIGAQRYDVFQEVFDSLLE 284


>gi|226226132|ref|YP_002760238.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
 gi|226089323|dbj|BAH37768.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
          Length = 263

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 69/153 (45%), Gaps = 6/153 (3%)

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM---LARCAEKRMDGGYW 133
           C +C  +H+ +   LE  YIKTGK+R+     PL+ +   A      A CA  +  G +W
Sbjct: 94  CPYCKSWHDSSMANLERDYIKTGKIRFAYLHLPLEGIHPHARAESEAAMCAGAQ--GKFW 151

Query: 134 GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASED 193
            + + LF  Q       +    L  +A+        F+ C     I   ++A  ++AS+ 
Sbjct: 152 PYSNALFAAQGTVRTMNDVSPLLTRIAREQSLDLTAFNACRQSPAIRSLVEADIRQASQA 211

Query: 194 FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             + STP F +G  +  G +    F+K ID+ +
Sbjct: 212 -NVQSTPSFVVGEFMLRGALPYPDFAKAIDTAL 243


>gi|161528337|ref|YP_001582163.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339638|gb|ABX12725.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 236

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 77/154 (50%), Gaps = 16/154 (10%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTV 116
           +G  +AP+T+VE+    C  C  F + T   + + Y++TGK+R I +++ +   DS++  
Sbjct: 63  LGDSNAPITLVEFGDYQCHFCNVFFHSTEGDILENYVETGKVRMIFKDYNIIGPDSIN-- 120

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFN----KQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
           A   A CA  +  G +W +  +L+N    + + W +S+N    LL  A+  G   + +  
Sbjct: 121 ASHGAHCANDQ--GMFWEYHDILYNNWTGENNGWASSEN----LLRFAQEIGLDVDTWSE 174

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
           C+ D+     I A  + A     +  TP FF+ G
Sbjct: 175 CMIDRIHSKTIVASNEDA-RSLELTGTPAFFVIG 207


>gi|21224330|ref|NP_630109.1| hypothetical protein SCO5993 [Streptomyces coelicolor A3(2)]
 gi|15020712|emb|CAC44607.1| putative membrane protein [Streptomyces coelicolor A3(2)]
          Length = 270

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 70/165 (42%), Gaps = 9/165 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           ++IG+ DAPV ++EY+   C  C  F  +T   L   Y+  G LR   R FP+    +  
Sbjct: 89  LAIGRADAPVVLIEYSDFQCPFCGRFARETKPELLRSYVDKGTLRIEWRNFPIFGEESEQ 148

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             LA  A  R +  +W F  + + K  +        + L+ MA+ AG +    D      
Sbjct: 149 AALAGWAAGRQN-KFWEFHDVAYGKPRERNTGAFDAENLVAMAREAGIA----DIERFQA 203

Query: 178 NILDDIKAGKKRASED----FAIDSTPVFFIGGNLYLGDMSEGVF 218
           ++  D   G  RA ++      + STP F + G   LG      F
Sbjct: 204 DMASDEARGAVRADQEEGYTLGVTSTPAFLVNGRPILGAQPTDTF 248


>gi|157961599|ref|YP_001501633.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
 gi|157846599|gb|ABV87098.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
          Length = 263

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 82/186 (44%), Gaps = 25/186 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTVA 117
           +G   A + ++E++   C +C  F ++TF  L+  YI TGK++Y+ R+FPL     +  A
Sbjct: 87  LGDTAAQLAIIEFSDYQCPYCKRFIDQTFTKLKSNYIDTGKIQYLTRDFPLGFHPKAKGA 146

Query: 118 VMLARCAEKRMDGGYWGFVSLLF---NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
            + A C+ ++    YW     LF    + DD +  +   +  L+M  FA         CL
Sbjct: 147 AIAANCSLQQ--NAYWPMRDSLFKNMQQLDDALYQQTASNLSLDMTMFAD--------CL 196

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIG---------GNLYLGDMSEGVFSKIIDSM 225
            D+ +   +       S    I  TP F IG           L +G  S   F+ +ID +
Sbjct: 197 IDETVSSKVDQDVAYGSS-LGIRGTPSFVIGRVENGQLISPKLVVGAQSYQTFALLIDEL 255

Query: 226 IQDSTR 231
           + +  +
Sbjct: 256 LANPQK 261


>gi|317124198|ref|YP_004098310.1| DSBA oxidoreductase [Intrasporangium calvum DSM 43043]
 gi|315588286|gb|ADU47583.1| DSBA oxidoreductase [Intrasporangium calvum DSM 43043]
          Length = 255

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 74/172 (43%), Gaps = 16/172 (9%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTV 116
           V++G++DAPV +V Y+   C  C +F   T   L  +Y+  G LR   R+FP L   S  
Sbjct: 82  VALGKEDAPVVLVNYSEFQCPFCGKFARDTKPTLVKEYVDKGILRIEWRDFPYLGPESGT 141

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A    R A ++  G +W F   +F  Q    + K   D L  +A   G     F   L D
Sbjct: 142 AAHAGRAAAEQ--GKFWEFHDAMFADQQPPNSGKLTEDYLAGVAARIGLDVAKFRKDLAD 199

Query: 177 QNILDDIKAGKKRASEDF------AIDSTPVFFIGGNLYLGDMSEGVFSKII 222
             +       + +  +DF       +  TP F + GN  +G      F+++I
Sbjct: 200 PKL-------QAKVDQDFTEGQNIGVTGTPAFLVNGNPVIGAQPTETFTRLI 244


>gi|297560312|ref|YP_003679286.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296844760|gb|ADH66780.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 281

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 81/195 (41%), Gaps = 17/195 (8%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           +F ALLA         ++G+ DAPV MV Y+   C +C  +  +T   L   Y++ G LR
Sbjct: 94  EFGALLARR-DPEDPAAMGEVDAPVVMVAYSDYNCPYCGRWARETQPELM-HYVERGDLR 151

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
              R+FP+ + S+  V  A  A   M GG+W F    F   +     +   + L  +   
Sbjct: 152 IEWRDFPIITGSSETVSHAARAAG-MQGGFWEFHEAYFTHGEK-FEGEALEEVLDGIVAE 209

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA------IDSTPVFFIGGNLYLGDMSEG 216
            G     F+   +   +   +       S DFA      + STP F + G   +G     
Sbjct: 210 LGMDPERFEEDRHGDEVASMV-------SRDFAEAQGIGVTSTPAFLVNGQPLMGAQPLS 262

Query: 217 VFSKIIDSMIQDSTR 231
           VF   I+  + D+ R
Sbjct: 263 VFVSAIEDALADAGR 277


>gi|269838059|ref|YP_003320287.1| DSBA oxidoreductase [Sphaerobacter thermophilus DSM 20745]
 gi|269787322|gb|ACZ39465.1| DSBA oxidoreductase [Sphaerobacter thermophilus DSM 20745]
          Length = 247

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 81/184 (44%), Gaps = 18/184 (9%)

Query: 38  PDGVVDFRALLAASPSTMKDVSI-------GQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
           P G  D   +  A P    D SI       GQ+ APV +VE+       C  F       
Sbjct: 54  PQGSEDVSDIAVAPPP---DASIPTNGRVMGQEGAPVHVVEWGDYQUPGCGYFTRAVKPQ 110

Query: 91  LEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKRMDGGYWGFVSLLF-NKQDDWIN 148
           L  +Y+ TGK+ +  R+F  L + ST A   A CAE +  G +W +   +F N++ +  N
Sbjct: 111 LIQEYVATGKITFEYRDFAFLGAESTRAAEAAFCAEDQ--GKFWQYHDTVFLNQRGE--N 166

Query: 149 SKNYRDALL-NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
              + +A L  MA+  G     F+ C +++    D++A    A E   +  TP   I G 
Sbjct: 167 QGAFSEARLKEMARQVGLDMEAFNECYDNRTHKQDVEAMYNEAKE-AGVTGTPSIMINGQ 225

Query: 208 LYLG 211
           L  G
Sbjct: 226 LLQG 229


>gi|153003349|ref|YP_001377674.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
 gi|152026922|gb|ABS24690.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
          Length = 354

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 80/173 (46%), Gaps = 19/173 (10%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTV 116
           S G + APVT+VE++   C +C    + T K +   Y    K+R + R+FPL   + +  
Sbjct: 191 SKGPQGAPVTIVEFSDFECPYCVRAED-TVKQVLAAY--PDKIRLVYRDFPLPMHARAPK 247

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND---FDTC 173
           A   A CA  +  G YW     LF        S N  D + ++ K+AG  K D   FD C
Sbjct: 248 AAEAAHCAGDQ--GKYWEMHQRLFA-------SSNAID-VPDLKKYAGELKLDQAKFDKC 297

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           L+       ++  +K A E+  +  TP FFI G +  G      F K+ID  +
Sbjct: 298 LDSGEKTQVVEEHRK-AGEEAGVSGTPAFFINGRMLSGAQPLDAFKKVIDQEL 349


>gi|56552571|ref|YP_163410.1| protein-disulfide isomerase-like protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56544145|gb|AAV90299.1| protein-disulfide isomerase-like protein [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 256

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 77/193 (39%), Gaps = 39/193 (20%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV++VEYAS TC HCA+F  + F  L D YI  G ++   R    D       +
Sbjct: 67  MGNPKAPVSLVEYASFTCPHCADFTQEGFPKLRDNYIAKGLVKLEFRNLVRDPFDIALTL 126

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK------------ 167
           LARC   R    ++     LF +Q          D   ++ + AG  +            
Sbjct: 127 LARC---RGAETFFPIADQLFQEQKPMFERIQNADK-ADLQRVAGLPQDQQMAEYIRLTG 182

Query: 168 -NDF-----------DTCLNDQ---NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
            N F           + CL DQ     L DI++   + +    +  TP+F I G L    
Sbjct: 183 MNPFFGNRGLPTSAQNKCLTDQAAIKTLMDIRSIADKQN----VTGTPMFLINGTL---- 234

Query: 213 MSEGVFSKIIDSM 225
              G+ S I D +
Sbjct: 235 QEVGIGSPIWDQL 247


>gi|322437243|ref|YP_004219455.1| putative lipoprotein [Acidobacterium sp. MP5ACTX9]
 gi|321164970|gb|ADW70675.1| putative lipoprotein [Acidobacterium sp. MP5ACTX9]
          Length = 325

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 78/177 (44%), Gaps = 16/177 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--STVAV 118
           G + APV +V +  + C +CA+ H++ F  L  +Y    K+R++ ++FP+     +  A 
Sbjct: 121 GPQGAPVEIVGFDDLECPYCAKMHSQIFPALTQRY--GDKVRFVYKDFPISQHPWAMRAA 178

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINS-KNYRDAL-------LNMAKFAGFSKNDF 170
           +   C   +   GYW  V  +     +   +  N + AL       L+ A      + + 
Sbjct: 179 VDVNCVATQSSQGYWNLVDTIHAHAGELGGTDHNLQKALDSLDKMTLDEAAKEKLKQPEV 238

Query: 171 DTCLNDQNILDDIK-AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + C+  Q   DD K     +  ED  +++TPV FI G  + G        + +DS +
Sbjct: 239 EACIKKQ---DDTKIKASLKVGEDLNVEATPVLFINGEKFEGAYPLEDLYRFVDSAL 292


>gi|229103716|ref|ZP_04234396.1| hypothetical protein bcere0019_28670 [Bacillus cereus Rock3-28]
 gi|228679592|gb|EEL33789.1| hypothetical protein bcere0019_28670 [Bacillus cereus Rock3-28]
          Length = 226

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 15/164 (9%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR--YILREFP 109
           P   K  ++G++DAPV+++ +    C  C  +  + F  L+  YI TGK++  Y+   F 
Sbjct: 45  PPIGKQPTLGKEDAPVSIIAFGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLF- 103

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ-----DDWINSKNYRDALLNMAKFAG 164
             + S ++ + A    K+    YW F   LFN Q     D WI      + LL +AK   
Sbjct: 104 HGTESKLSALAAESVYKQDPQAYWSFHKELFNAQPENHDDPWITP----EKLLEIAKTYT 159

Query: 165 FSKN--DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            S N    +  L  Q   +++   +K  ++D++++ TP   + G
Sbjct: 160 PSINTTQLEEDLKKQTEQEEVNRDEK-LTQDYSVEQTPSIVVNG 202


>gi|221635547|ref|YP_002523423.1| dsba oxidoreductase [Thermomicrobium roseum DSM 5159]
 gi|221158043|gb|ACM07161.1| dsba oxidoreductase [Thermomicrobium roseum DSM 5159]
          Length = 251

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 6/150 (4%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  +APV ++E+    C  C  F  + F  + ++YI TGK+R+  R+F    +   +V 
Sbjct: 86  LGDPNAPVHVIEWGDYQCPACKSFEQRFFPTILEQYIVTGKVRWEFRDFAF--IGKESVR 143

Query: 120 LARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALL-NMAKFAGFSKNDFDTCLNDQ 177
            A  A   +D G +W F + L+  Q    N   + D  L  +A+ AG     F +CL   
Sbjct: 144 AAEAAACALDQGKFWEFHAALYANQTG-ENVGAFTDRRLEEIARVAGLDVGAFRSCLRQG 202

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
              D+++    R ++   + +TP F + G+
Sbjct: 203 KHADEVQQ-MVREAQSLGVRATPSFSVNGS 231


>gi|284042976|ref|YP_003393316.1| Na+/H+ antiporter NhaA [Conexibacter woesei DSM 14684]
 gi|283947197|gb|ADB49941.1| Na+/H+ antiporter NhaA [Conexibacter woesei DSM 14684]
          Length = 624

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 98/229 (42%), Gaps = 21/229 (9%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            RIGVL   VL   A +  +  K +AL    +  G+      L+      +D   G  DA
Sbjct: 415 ARIGVLLAAVLAVGAGWLAF--KLAALLRGEVSAGLPRE---LSPPVDAARDHVRGPLDA 469

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+T+VEYA   C  C        + L  ++     LRY+LR  PL  V   A + A+  E
Sbjct: 470 PLTLVEYADFECPFCGR-ATGMVRELRRRF--GDDLRYVLRHLPLIDVHPHAELAAQAME 526

Query: 126 K-RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
           +  + G +W     LF+ QD+      + D LL  A   G    +    L D   L  ++
Sbjct: 527 EAAVQGRFWELHDKLFDHQDE----LEFED-LLGYAGKIGIDVEELARALQDGRHLARVR 581

Query: 185 AGKKRAS-EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             K  AS E      TP FF+GG  ++G       ++ +   +++S RR
Sbjct: 582 --KDVASAEASGARGTPTFFVGGQRHVGPYD----AETLARELEESRRR 624


>gi|149180935|ref|ZP_01859437.1| BdbD [Bacillus sp. SG-1]
 gi|148851454|gb|EDL65602.1| BdbD [Bacillus sp. SG-1]
          Length = 214

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 72/175 (41%), Gaps = 15/175 (8%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK-- 100
           D    L + P T     IG+KDAP ++VE+    C  C  +    +  L+  +I TGK  
Sbjct: 27  DTDQTLESHPPTANQPMIGKKDAPASVVEFGDFKCPACKAWGEMIYPQLKADFIDTGKAN 86

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD------WINSKNYRD 154
             YI  EF     ST++ + A    K   G YW F   LF +Q        WI      D
Sbjct: 87  FTYINTEF-HGKESTLSALAAESILKNDPGSYWEFHKKLFEEQPADNHDALWITV----D 141

Query: 155 ALLNMA-KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
            L+ +A K      + F   +  Q  ++++        +DF I  TP   I G +
Sbjct: 142 KLVEVAKKTTDIEADQFRQDIEQQTYMEEVNVDSSLV-QDFNIQKTPTIIINGTM 195


>gi|241762188|ref|ZP_04760270.1| protein-disulfide isomerase-like protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373235|gb|EER62854.1| protein-disulfide isomerase-like protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 256

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 77/193 (39%), Gaps = 39/193 (20%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV++VEYAS TC HCA+F  + F  L D YI  G ++   R    D       +
Sbjct: 67  MGNPKAPVSLVEYASFTCPHCADFTQEGFPKLRDNYIAKGLVKLEFRNLVRDPFDIALTL 126

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK------------ 167
           LARC   R    ++     LF +Q          D   ++ + AG  +            
Sbjct: 127 LARC---RGAETFFPIADQLFQEQKPMFERIQNADK-ADLQRVAGLPQDQQMAEYIRLTG 182

Query: 168 -NDF-----------DTCLNDQ---NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
            N F           + CL DQ     L DI++   + +    +  TP+F I G L    
Sbjct: 183 MNPFFGNRGLPTSAQNKCLTDQAAIKTLMDIRSIADKQN----VTGTPMFLINGAL---- 234

Query: 213 MSEGVFSKIIDSM 225
              G+ S I D +
Sbjct: 235 QEVGIGSPIWDQL 247


>gi|117923758|ref|YP_864375.1| DSBA oxidoreductase [Magnetococcus sp. MC-1]
 gi|117607514|gb|ABK42969.1| DSBA oxidoreductase [Magnetococcus sp. MC-1]
          Length = 335

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 81/179 (45%), Gaps = 20/179 (11%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD- 111
           STM   S+G  DAPVT+VE++   C +C        K L+ KY    K++++ R +PL  
Sbjct: 169 STMTP-SLGAADAPVTIVEFSDFECPYCRRVQ-PALKQLKTKY--GDKIQFVFRHYPLSF 224

Query: 112 -SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS---KNYRDALLNMAKFAGFSK 167
             ++ +A   A C E +    +W F   LF +  D   +   K   D  L+MA F    K
Sbjct: 225 HKLAPLASKAAMCGEDQQQ--FWAFHDALFEEGVDLSRAGLDKVAADLKLDMALF----K 278

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           N  D+  ++  +  D+  G     +   +  TP FFI G    G +      K+++  +
Sbjct: 279 NCLDSNKHEAKLDADLTEG-----QSLGVTGTPTFFINGRKSSGALPYSTLEKMVEQEL 332


>gi|326333325|ref|ZP_08199572.1| DSBA thioredoxin domain protein [Nocardioidaceae bacterium Broad-1]
 gi|325948969|gb|EGD41062.1| DSBA thioredoxin domain protein [Nocardioidaceae bacterium Broad-1]
          Length = 249

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 78/173 (45%), Gaps = 4/173 (2%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTV 116
           +++G  DAPV M+ Y+   C  C ++   T   L +KY+ +G LR   R+FP L   ST 
Sbjct: 75  MALGDVDAPVVMISYSEFQCPFCGKYARDTEPILVEKYVDSGVLRIEWRDFPYLGPESTT 134

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A    R A  +    +W F  L+++ Q    + K   D L+++A       N+F   +  
Sbjct: 135 AAQAGRAAAAQGK--FWEFSKLMYDNQLPPNSGKLTEDYLVSIADDLDLDTNEFRKDMVA 192

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +   D IK       +   +  TP F I G   +G     VF + I+   +++
Sbjct: 193 RGTKDAIKQDLAEG-QAIGVTGTPAFIINGVPVIGAQPTEVFEQAIEKAAEET 244


>gi|325284363|ref|YP_004256903.1| DSBA oxidoreductase [Deinococcus proteolyticus MRP]
 gi|324316427|gb|ADY27540.1| DSBA oxidoreductase [Deinococcus proteolyticus MRP]
          Length = 216

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 66/148 (44%), Gaps = 5/148 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DA VT+VE+    C  CA         ++ KY   G++R + R FPL S ST+A  
Sbjct: 52  LGPADAKVTIVEFFDPECESCAAVEPALMDVMQ-KY--NGEVRLVARYFPLHSNSTLAAG 108

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQN 178
           L   A +      W     LF KQ +W   +  + D  L+ A+  G  ++     +    
Sbjct: 109 LIEAAAQDSADKRWRMRDYLFQKQREWGEQQTAQTDKFLDYAEDMGLDRSKAQATMESAA 168

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGG 206
           +  D+ A  ++  E   +  TP FF+ G
Sbjct: 169 VR-DLLARDRKDGEAVGVTGTPTFFVNG 195


>gi|256831273|ref|YP_003160000.1| DSBA oxidoreductase [Jonesia denitrificans DSM 20603]
 gi|256684804|gb|ACV07697.1| DSBA oxidoreductase [Jonesia denitrificans DSM 20603]
          Length = 299

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 80/172 (46%), Gaps = 7/172 (4%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV MV ++   C +CA++ N T   LE+ Y+  G LR   R+  +   ++  
Sbjct: 132 LAVGPVDAPVVMVVFSDYQCPYCAKWSNDTLTVLEN-YVDAGDLRVEWRDVNIFGENSER 190

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY--RDALLNMAKFAGFSKNDFDTCLN 175
              A  A  +  G +  +   LF   +  I+S+     D L+ +A   G   + F   L 
Sbjct: 191 AARASYAAGQQ-GQFLAYHHALFPGGE--ISSEQVLSEDGLIALAGDLGLDTDQFTKDLT 247

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            ++  +++ A   +   D    STP F +GG   +G     VF+  ID+ +Q
Sbjct: 248 SKDTAEEV-AKNAQLGLDLGAYSTPAFLVGGQPIVGAQPTDVFTSAIDTALQ 298


>gi|94496123|ref|ZP_01302701.1| protein-disulfide isomerase [Sphingomonas sp. SKA58]
 gi|94424302|gb|EAT09325.1| protein-disulfide isomerase [Sphingomonas sp. SKA58]
          Length = 221

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 67/170 (39%), Gaps = 29/170 (17%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   AP  +VEY S TC HCA F ++    L   Y+K GK+   +R    D     A +
Sbjct: 38  MGNPAAPTKLVEYVSYTCSHCAHFVSEASAPLRTDYVKGGKVGVEVRNAVRDKYDLTAAL 97

Query: 120 LARCAEKRMDGG---YWGFVSLLFNKQDDWINS-KNY-RDA------------------L 156
           LARC      GG   + G    LF  Q  WI   ++Y RDA                  L
Sbjct: 98  LARC------GGPTKFMGNHEALFANQSAWITQVESYDRDAQKPADQIPALQDIGQKTGL 151

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
             +    GF+    + C+ +   +  + A    A     I  TP F I G
Sbjct: 152 YALMNKRGFTNAQLNACIANPQSMKQVLAMTDEAWTKVKITGTPGFTING 201


>gi|283853886|ref|ZP_06371100.1| DSBA oxidoreductase [Desulfovibrio sp. FW1012B]
 gi|283570728|gb|EFC18774.1| DSBA oxidoreductase [Desulfovibrio sp. FW1012B]
          Length = 262

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 69/154 (44%), Gaps = 6/154 (3%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
            S+G ++APVT+VEY+   C  CA+      K LE      G++R + + F        A
Sbjct: 89  ASLGPQNAPVTIVEYSDFLCHFCAQAAGTVQKLLER---HPGEVRLVFKHFATGKNDVRA 145

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            +       +     W F+ + F++Q D   ++   +AL  MAK  G  +      L  +
Sbjct: 146 ALYFEALNLQDPKKAWAFMEMAFSRQKDV--AEKGEEALAAMAKELGADQKRLAEDLKRK 203

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           ++ D I +  K A  +F  + TPVF + G    G
Sbjct: 204 DLADRIDSDVKEAR-NFGFEGTPVFLVNGAPVRG 236


>gi|328950848|ref|YP_004368183.1| DSBA oxidoreductase [Marinithermus hydrothermalis DSM 14884]
 gi|328451172|gb|AEB12073.1| DSBA oxidoreductase [Marinithermus hydrothermalis DSM 14884]
          Length = 301

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 63/164 (38%), Gaps = 16/164 (9%)

Query: 48  LAASPSTMKDVSIGQK-----DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           L+  P  + +   G         PV + EY+   C  CA  H +    L+ +YI TG  R
Sbjct: 124 LSVGPVMVPETQFGPARHVLGSGPVAIREYSDFECPFCARLHREVLPELKARYITTGLAR 183

Query: 103 YILREFPLDSVSTVAV-MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
           +  R FPL  +   A+            G +W F   LF      +   +Y    L  A+
Sbjct: 184 FEYRHFPLYRIHREAIPAAEASECAAEQGAFWAFHDTLFT-----LGVGDY----LKAAQ 234

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            AG     F TC  ++     ++A    A E   +  TP  F+G
Sbjct: 235 AAGLDLEAFKTCYAERRYRARVEAALAEA-ERLGLRGTPTVFVG 277


>gi|120406500|ref|YP_956329.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
 gi|119959318|gb|ABM16323.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
          Length = 248

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 78/188 (41%), Gaps = 4/188 (2%)

Query: 38  PDGVVDFRALLAASPSTMKD-VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
           P G VD    L+    T  D ++ G   APV MV +A   C  CA+F   T   L ++++
Sbjct: 57  PGGQVDAVTALSVERRTTGDPLAQGDPAAPVVMVMFADYRCPFCAKFSRDTEPDLVERFV 116

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
             G LR   R+ P+    ++    A  A     G +W F   +F    D  ++    DAL
Sbjct: 117 DQGVLRLEWRDMPIFGEQSMRAARAGRAAAEQ-GKFWEFNHEVFAMSPDRGHADLNEDAL 175

Query: 157 LNMAKFAGFSKND-FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           +  A+ AG    D F   +        I A   + S    + STP F I G   LG    
Sbjct: 176 VGFAEKAGVPDIDKFAASMRGNEFDAAIDADLAQGSS-IGVPSTPAFVINGEPVLGAQPT 234

Query: 216 GVFSKIID 223
             F ++ID
Sbjct: 235 EEFVRVID 242


>gi|291442026|ref|ZP_06581416.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
 gi|291344921|gb|EFE71877.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
          Length = 261

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 74/180 (41%), Gaps = 11/180 (6%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV ++EY+   C  C  F  +T   L   Y+  G LR   R FP+    +  
Sbjct: 83  LALGSPDAPVVLIEYSDFQCPFCGRFARETEPDLVRDYVDKGILRIEWRNFPVFGAESDQ 142

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS-----KNDFDT 172
              A  A  + +  +W F    + +           D L++MA+ AG       + D  +
Sbjct: 143 AARAGWAAGQQN-RFWQFHDEAYAEPRRRNAGDFGEDNLISMARKAGIQDLARFEKDMVS 201

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
               Q I  D + G         + STP F I G   LG     VF+ +ID   + + ++
Sbjct: 202 DAAHQAIARDSEEGYG-----IGVTSTPAFLINGRPVLGAQPTDVFTDLIDEAAEQARQQ 256


>gi|55376475|ref|YP_134327.1| DSBA-like thioredoxin [Haloarcula marismortui ATCC 43049]
 gi|55229200|gb|AAV44621.1| DSBA-like thioredoxin [Haloarcula marismortui ATCC 43049]
          Length = 328

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 70/187 (37%), Gaps = 26/187 (13%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
           A+   PIPD   DFR             ++G  DA V +  + S  C +CA+F  +    
Sbjct: 134 AVTTAPIPDSPGDFRY-----------ATMGSADADVMVTYFGSWKCPYCAQFSTEMLSQ 182

Query: 91  LEDKYIKTGKLRYILREF------PLDSVSTVAVMLARCAEKRMD-GGYWGFVSLLFNKQ 143
           L   Y++ G +    R        P       A   A  A    D   YW F   +F  Q
Sbjct: 183 LVTDYVEPGTIALEFRNLAYIGGDPFLGPDAPAAGQAGLAVWNTDPASYWAFHEYVFGNQ 242

Query: 144 ----DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
               D W  ++     L+  A+ AG S+         +N  DD      RA+ D  +D+T
Sbjct: 243 PPESDQWATAER----LVEFAQAAGVSETASVRTAIQENQYDDALRATDRAASDVGVDAT 298

Query: 200 PVFFIGG 206
           P   I G
Sbjct: 299 PTLLIDG 305


>gi|239933637|ref|ZP_04690590.1| hypothetical protein SghaA1_35750 [Streptomyces ghanaensis ATCC
           14672]
          Length = 235

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 74/180 (41%), Gaps = 11/180 (6%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV ++EY+   C  C  F  +T   L   Y+  G LR   R FP+    +  
Sbjct: 57  LALGSPDAPVVLIEYSDFQCPFCGRFARETEPDLVRDYVDKGILRIEWRNFPVFGAESDQ 116

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS-----KNDFDT 172
              A  A  + +  +W F    + +           D L++MA+ AG       + D  +
Sbjct: 117 AARAGWAAGQQN-RFWQFHDEAYAEPRRRNAGDFGEDNLISMARKAGIQDLARFEKDMVS 175

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
               Q I  D + G         + STP F I G   LG     VF+ +ID   + + ++
Sbjct: 176 DAAHQAIARDSEEGYG-----IGVTSTPAFLINGRPVLGAQPTDVFTDLIDEAAEQARQQ 230


>gi|254293429|ref|YP_003059452.1| DsbA oxidoreductase [Hirschia baltica ATCC 49814]
 gi|254041960|gb|ACT58755.1| DsbA oxidoreductase [Hirschia baltica ATCC 49814]
          Length = 236

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 77/180 (42%), Gaps = 8/180 (4%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           DV +G  DA V +VEYAS  C HC  FH      ++  +I+ G +  I R+ P       
Sbjct: 43  DVILGNADAKVQIVEYASTACGHCRTFHKTILPNIKKDFIENGSVSLIYRDLPTPPAQLA 102

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL----NMAKFAGFSKNDFDT 172
           A   A       D  Y+  +  +F  Q +  ++       L     +    G S+     
Sbjct: 103 AAGAALARCAGKD-EYYKVLDDVFTSQGEIFDAARSAGGALPAYNEIGARHGMSEETVKA 161

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-NLYLGDMS-EGVFSKIIDSMIQDST 230
           C+    +L++I      A +   + STP  FI G  +   DMS EG+ + + D++  ++T
Sbjct: 162 CVTSTEVLNEISRTSDLA-QAAGVTSTPTLFIDGVKVEAKDMSNEGIAALLNDALGIETT 220


>gi|328883897|emb|CCA57136.1| Protein-disulfide isomerase [Streptomyces venezuelae ATCC 10712]
          Length = 283

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 75/173 (43%), Gaps = 17/173 (9%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G+ DAPV ++EYA   C +C +F   T   L  KY+ +G LR   R FP+    + A
Sbjct: 88  LALGRADAPVVLIEYADFKCGYCGKFARDTEPVLVKKYVDSGVLRIEWRNFPIFGEESEA 147

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAG------FSKNDF 170
           V  A  A  +  G +W F    +    +    K + +D L  +AK AG      F+K D 
Sbjct: 148 VARASWAAGQQ-GRFWEFHKAAYA---EGAKEKGFGKDRLAALAKEAGVPDAARFAK-DS 202

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           +       +  D + G           STP F I G    G      F++ I+
Sbjct: 203 EGAPARAAVSADQEQGY-----SLGATSTPSFLINGRPIAGAQPLETFTETIE 250


>gi|260906412|ref|ZP_05914734.1| protein-disulfide isomerase [Brevibacterium linens BL2]
          Length = 250

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 77/171 (45%), Gaps = 3/171 (1%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G+ DAPVT+V ++   C +CA ++ +T   + D Y+  G LR  +R+  +    +   
Sbjct: 81  ALGEVDAPVTLVMFSDYQCPYCASWNEETLPAMMD-YVDKGDLRIEMRDLAVFGEES-ER 138

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                    + G YW F + +F+  +    S+   D+L++ A+  G     F   +N  +
Sbjct: 139 AARAAYAAGLQGKYWEFHNAMFDGGEHPPKSELDDDSLVSAAEDLGLDPTKFKGDMNSVD 198

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             ++  A  +       + STP F IGG   +G      F   +D  + ++
Sbjct: 199 AHEEFDATAQEGYS-LGVASTPTFVIGGKPLVGAQPTKAFVGSVDDALAEA 248


>gi|326775696|ref|ZP_08234961.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
 gi|326656029|gb|EGE40875.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
          Length = 249

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 68/165 (41%), Gaps = 9/165 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVS 114
           +++G+ DAPV M+EY+   C  C  F  +T   L   Y+  G LR   R FP+   +S  
Sbjct: 77  LAVGRADAPVVMIEYSDFQCPFCGRFARETEPELIRSYVDKGVLRIEWRNFPVFGEESEQ 136

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTC 173
                 A   +K+    +W F  + F +  +        D L+ MA+ AG      F + 
Sbjct: 137 AARAAWAAGQQKK----FWDFHEVAFGEPRERNQGDFSTDKLVGMAREAGVGDIGRFRSD 192

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
           +      D ++  ++       + STP F I G   LG      F
Sbjct: 193 MASGAAHDAVRKDREEGY-GLGVTSTPAFLINGTPVLGAQPTATF 236


>gi|313902960|ref|ZP_07836355.1| DSBA oxidoreductase [Thermaerobacter subterraneus DSM 13965]
 gi|313466684|gb|EFR62203.1| DSBA oxidoreductase [Thermaerobacter subterraneus DSM 13965]
          Length = 302

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 20/183 (10%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DS 112
           +  ++G   APVT+VE+A   C +C EF    F   ++ YI TGK+R+    +P    DS
Sbjct: 103 RQPALGSASAPVTVVEFADFKCPYCREFTLNEFPRFKEAYIDTGKVRFYFINYPFIGPDS 162

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            +    M A  A+     G W F+  +   Q          + L+++A+ A         
Sbjct: 163 DTAAQAMEAVYAQSPE--GVWAFIDRVMQLQGPEDQQWATPEFLVDVARQA-------VP 213

Query: 173 CLNDQNILDDIKAGKKRASED--------FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            ++ Q +LDD+++G+     D          +  TP  F+ G        EG+ + +  +
Sbjct: 214 GIDAQRLLDDLRSGRYAGEVDADRAIAVRAGVRGTPSVFVNGKFVENWSFEGLKAAVDQA 273

Query: 225 MIQ 227
           + +
Sbjct: 274 LAE 276


>gi|182435058|ref|YP_001822777.1| hypothetical protein SGR_1265 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178463574|dbj|BAG18094.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 249

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 68/165 (41%), Gaps = 9/165 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVS 114
           +++G+ DAPV M+EY+   C  C  F  +T   L   Y+  G LR   R FP+   +S  
Sbjct: 77  LAVGRADAPVVMIEYSDFQCPFCGRFARETEPELIRSYVDKGVLRIEWRNFPVFGEESEQ 136

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTC 173
                 A   +K+    +W F  + F +  +        D L+ MA+ AG      F + 
Sbjct: 137 AARAAWAAGQQKK----FWDFHEVAFGEPRERNQGDFSTDKLVGMAREAGVGDIGRFRSD 192

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
           +      D ++  ++       + STP F I G   LG      F
Sbjct: 193 MASGAAHDAVRKDREEGY-GLGVTSTPAFLINGTPVLGAQPTATF 236


>gi|297193464|ref|ZP_06910862.1| DSBA oxidoreductase [Streptomyces pristinaespiralis ATCC 25486]
 gi|297151790|gb|EDY62169.2| DSBA oxidoreductase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 172

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 74/174 (42%), Gaps = 15/174 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G+ DAPV M+EYA   C +C +F   T   L  KY++ G LR   R FP+    + A  
Sbjct: 1   MGRADAPVVMIEYADFQCGYCGKFARDTEPELIKKYVEDGTLRIEWRNFPIFGEESEAAA 60

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFS-----KNDFDTC 173
            A  A  R  G +W F +  + +       K +  D L  +A+ AG +       D D+ 
Sbjct: 61  RAAWAAGRQ-GRFWEFHAAAYAQG---AKEKGFGEDRLQALAREAGVADPGRFAEDLDSD 116

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              Q +  D     +  +      STP F I G    G      F++ I++  Q
Sbjct: 117 AARQAVRKD-----QEEAYGLGATSTPSFLINGRPVAGAQPMETFTEAIEAAKQ 165


>gi|161528651|ref|YP_001582477.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339952|gb|ABX13039.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 221

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 78/176 (44%), Gaps = 17/176 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +G  +AP+T++E+    C +C ++   T   +   YI TGK+  +  +   L   S  A 
Sbjct: 52  LGSPNAPITIIEFGDYQCSNCKKWFLDTKPDIMTNYIDTGKVNLVFVDIAFLGKDSGPAS 111

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
           +   CAE++  G YW +   L++ Q    + W NS    D+L   A   G +   F +CL
Sbjct: 112 VATYCAEEQ--GKYWEYHGFLYSNQMSIDNGWANS----DSLKGYANNLGLNMEMFVSCL 165

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-----NLYLGDMSEGVFSKIIDSM 225
           + +     ++     +  +  +  TP FF+ G         G     VF K I+SM
Sbjct: 166 DSEKYSKRVQFNTDESKRN-GVTGTPTFFVIGPNGEQEKIAGPQPYTVFEKTIESM 220


>gi|302562652|ref|ZP_07314994.1| DSBA oxidoreductase [Streptomyces griseoflavus Tu4000]
 gi|302480270|gb|EFL43363.1| DSBA oxidoreductase [Streptomyces griseoflavus Tu4000]
          Length = 258

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 69/170 (40%), Gaps = 11/170 (6%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV M+EY+   C  C  F  +T + L   +++ G LR   R FP+    +  
Sbjct: 83  LAVGPVDAPVVMIEYSDFQCPFCGRFARETKQELLRTHVEKGVLRIEWRNFPIFGEESER 142

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS-----KNDFDT 172
              A        G +W F   L+ +  +    +  +  L+  AK AG +     + D ++
Sbjct: 143 AARA-AWAAGRQGAFWEFHDRLYAEPRERNTGEFTQTELVAHAKAAGVADLTRFREDMES 201

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
               Q +  D   G         + STP F + G   LG      F K I
Sbjct: 202 DQARQAVDRDRAEGYT-----LGVTSTPAFLVNGTPILGAQPTDAFDKAI 246


>gi|77454799|ref|YP_345667.1| putative disulfide bond formation protein [Rhodococcus erythropolis
           PR4]
 gi|77019799|dbj|BAE46175.1| putative thiol-disulfide oxidoreductase [Rhodococcus erythropolis
           PR4]
          Length = 244

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 71/167 (42%), Gaps = 1/167 (0%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           ++IG  DAPV M+ ++   C  CA+F  +T   L D+Y+  G LR   R+ P+    +  
Sbjct: 75  MAIGAVDAPVVMIAFSDFRCPFCAQFSRETEPQLIDRYVDEGTLRIEWRDLPIFGQQSFD 134

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
              A  A    D  +W F + ++    +  ++    +AL   A+ AG    +  T     
Sbjct: 135 AARAGRAAAAQD-KFWEFTNAVYAGAPETGHADLTIEALEAYAQQAGVPDLERFTTEATG 193

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
              D         ++   I +TP F + G+  LG      F  +ID+
Sbjct: 194 TSFDSAITSDSDEAQSLGIPATPAFSVNGDPVLGAQPLSTFVDLIDT 240


>gi|300934216|ref|ZP_07149472.1| hypothetical protein CresD4_09109 [Corynebacterium resistens DSM
           45100]
          Length = 317

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 76/180 (42%), Gaps = 22/180 (12%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           +IG  DAPV + E+A M C  CA FHN+T   +   Y+  G +R    + P++  + V  
Sbjct: 134 AIGAIDAPVVISEFADMECPFCASFHNETRSKIVQNYVDKGLVRLEWNDLPINGKNAVEG 193

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAG------FSKN--- 168
             A  A  +  G +  F+  L+    D      Y+ +  +  A+ AG      F K+   
Sbjct: 194 AKAGRAAAKQ-GKFQEFMDQLYTASKDKQGHPGYKIEDFVKFAEAAGVPDIEKFRKDATS 252

Query: 169 -DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            +FD  +N+           ++      +  TP F +G     G     VF K+ID  ++
Sbjct: 253 KEFDKPVNE----------ARQYGTSIGVSGTPAFVVGTKFVSGAQPWDVFKKVIDEELE 302


>gi|255530443|ref|YP_003090815.1| DSBA oxidoreductase [Pedobacter heparinus DSM 2366]
 gi|255343427|gb|ACU02753.1| DSBA oxidoreductase [Pedobacter heparinus DSM 2366]
          Length = 173

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 73/165 (44%), Gaps = 10/165 (6%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           L   P    D  IG  DA V +VEY    C HCA  H  T + L+   +   ++R++ R 
Sbjct: 4   LLKPPVGPGDHVIGHADAAVEIVEYGDFQCPHCAAAHPVTKEILK---VFGDQVRFVFRN 60

Query: 108 FPL-DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
           FPL +S     +         +   YW    ++F  Q     S +Y D+L  +A   G +
Sbjct: 61  FPLAESHRYATIAAIAAEAAGLQHKYWEMHDMIFEHQ----ASLSY-DSLFVLAGKLGLN 115

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
              F+  L ++ + D +++  +       ++ TP FF+ GN + G
Sbjct: 116 PEQFERDLQNEALRDKVESDFESGIRS-GVNGTPSFFVNGNKFDG 159


>gi|88813278|ref|ZP_01128517.1| hypothetical protein NB231_07262 [Nitrococcus mobilis Nb-231]
 gi|88789450|gb|EAR20578.1| hypothetical protein NB231_07262 [Nitrococcus mobilis Nb-231]
          Length = 324

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 81/189 (42%), Gaps = 15/189 (7%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P    D  +G + AP+T++EY+   C +C  FH    + +E      GK+ ++ R FPL 
Sbjct: 130 PIQPDDHVLGDRSAPITLIEYSDYACPYCKRFHATAHRIVEH---YQGKVNWVYRHFPLS 186

Query: 112 SVSTVAVMLARCAEKRM----DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
           S +  A   A  AE       +  +W F   +F ++     + +  + L ++A   G  +
Sbjct: 187 SHNPGAERAAAGAECAAELGGNAAFWAFSDRIFQRERSTEGAFSAGE-LASLAAELGLVR 245

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKI 221
             F  CL+ +     ++A      E   I  TP  F+  N        +G      F+++
Sbjct: 246 GQFKRCLDSERTRAAVRADVD-GGEQAGITGTPANFVYDNSSGATIAMVGARPYEQFTRV 304

Query: 222 IDSMIQDST 230
           ID ++  S+
Sbjct: 305 IDQLLARSS 313


>gi|289642294|ref|ZP_06474443.1| Na+/H+ antiporter NhaA [Frankia symbiont of Datisca glomerata]
 gi|289507929|gb|EFD28879.1| Na+/H+ antiporter NhaA [Frankia symbiont of Datisca glomerata]
          Length = 627

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 67/179 (37%), Gaps = 23/179 (12%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D   G  DAPVT+VEY    C +C        + L D     G LRY+ R  PL  V  
Sbjct: 461 RDRIRGPLDAPVTLVEYGDFECPYCGRAEAVVRELLAD----FGDLRYVWRHLPLTKVHP 516

Query: 116 -VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                          G +W    LLF++Q    ++   RD L    ++AG    D +   
Sbjct: 517 HAEYAAIAVEAAAEQGAFWEMHDLLFDRQ----SALTVRDLL----RYAGELGLDLERFR 568

Query: 175 NDQNILDDIKAGKKRASEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            D       +AG  R   D A      +  TP FFI G  + G       +  I +  Q
Sbjct: 569 ADLR----ARAGADRVERDIASADVSDVSGTPTFFINGRRHHGAYDAATLTLAITAARQ 623


>gi|309792603|ref|ZP_07687065.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
 gi|308225417|gb|EFO79183.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
          Length = 233

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 87/224 (38%), Gaps = 14/224 (6%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGS----ALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           T  IG+   +V+L + S     R  +    A N  PI   V D  A   A P+     + 
Sbjct: 6   TWMIGIGSLLVILLLTSVASLGRNATEQRNANNLEPII--VSDHPAPPNAEPNGR---AW 60

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAP+ ++EYA   C  C  F       +   +  TGK+R+ +R  P           
Sbjct: 61  GPVDAPIQVIEYADYECESCGYFARTYEAEVIAAFAATGKVRFEIRNAPFHGEGARNAAA 120

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINS--KNYRDALLN-MAKFAGFSKNDFDTCLNDQ 177
           A       D  +W     LF  Q     S  + +  A LN MA   G +   F+ CL   
Sbjct: 121 AAYCAAEQD-AFWPLHETLFLNQPTVHGSGAQVFSHARLNEMAAQLGLNSAAFEQCLGSG 179

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
                ++A     S    +  TP FFI G ++ G +S   F +I
Sbjct: 180 TYTAQVEADYAETSR-VGVTGTPTFFINGRMFPGILSTDDFRRI 222


>gi|115372964|ref|ZP_01460268.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310818669|ref|YP_003951027.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|115370042|gb|EAU68973.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309391741|gb|ADO69200.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 424

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 71/173 (41%), Gaps = 17/173 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPVT+V ++   C  C+   N T K LE +Y   GKLR   +  PL   +   +  
Sbjct: 260 GPSDAPVTLVAFSDFECPFCSRAAN-TVKQLEGEY--QGKLRVAFKHQPLPRHTNAKLAA 316

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQD--DWINSKNYRDAL-LNMAKF-AGFSKNDFDTCLND 176
                    G +W +   LF  Q   D    + Y + L L+M KF A    N FD     
Sbjct: 317 TASLAAHEQGKFWEYHDKLFANQTALDRPALERYAEELKLDMGKFKAALDSNKFDA---- 372

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             I  D   G++          TP FF+ G   +G      F ++ID  ++ +
Sbjct: 373 -QISADSAQGQQ-----IGAAGTPTFFVNGRPIVGAKPIENFRRVIDDELRKA 419



 Score = 41.6 bits (96), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 67/173 (38%), Gaps = 23/173 (13%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTVAV 118
           G  DA VT+VE+    C  C+       + LED     G+LR ++++ PL     +  A 
Sbjct: 56  GPADALVTLVEFTDFQCPFCSRASASVKQVLED---YDGQLRVVIKQHPLAFHPRARPAA 112

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM-AKFAGFS----KNDFDTC 173
           + +  A ++  G +W +   LF       N K   DA L   AK  G      K D    
Sbjct: 113 LASLAAHEQ--GKFWEYHDKLF------ANQKALDDASLETYAKEVGLDIKRWKKDMAAA 164

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
              Q +  D        +       TP FF+ G  + G     VF  +I+  +
Sbjct: 165 KLAQAVDRDTA-----LAVSLGAGGTPGFFVNGRFFSGAQPIEVFRAVIEEEL 212


>gi|149919899|ref|ZP_01908374.1| thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149819172|gb|EDM78606.1| thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 481

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 87/187 (46%), Gaps = 24/187 (12%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
           FR  ++ SPS       G  DAPVT+V ++   C +C E    T   +E +Y   G++R+
Sbjct: 80  FRIDVSDSPSR------GPADAPVTIVMFSDFECPYCDEAL-ATVASVEAEY--AGQIRF 130

Query: 104 ILREFPLDSVSTV--AVMLARCAEKRMDGGYWGFVSLLFNKQ--DDWINSKNYRDALLNM 159
           + +  PL++      A ++   A  R  G +W +   +F+ +  D+    +   +  L+ 
Sbjct: 131 VYKAMPLNTHPNALTAALIGHSA--RAQGKFWEWHDRVFSGRGIDELTLDRYIAELELDR 188

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
            +       + D       +  D++A K+       + STPVFFI G +  G  S+GVFS
Sbjct: 189 ERV----TRELDELAYAPAVRADLRAAKR-----LRLRSTPVFFINGRMLAGARSKGVFS 239

Query: 220 KIIDSMI 226
            +++  +
Sbjct: 240 HMVEQEL 246



 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 63/155 (40%), Gaps = 17/155 (10%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAP+T+V ++   C  CA  H  T + L  +Y    ++R++ + FPL      A+  
Sbjct: 300 GPADAPITIVAFSDFQCPFCARGH-ATMEALRARY--GDEVRFVFKHFPLPGHPLGALAS 356

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL----ND 176
                   D  +W F   +F        ++     LL + +  G  +   +  +    ND
Sbjct: 357 RASFAATSDEQFWAFHDAVFA-----TGARYEAQDLLRIGRELGMDQVALEEAMLGEQND 411

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             I  D++ G     E   +  TP +FI G   +G
Sbjct: 412 ATIEADLELG-----EALGLTGTPAYFINGRPIVG 441


>gi|291445961|ref|ZP_06585351.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291348908|gb|EFE75812.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 240

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 71/179 (39%), Gaps = 37/179 (20%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVS 114
           ++IG  DAPV ++EYA   C +C +F   T   L +KY+K G LR   R FP+   +S +
Sbjct: 58  LAIGPADAPVVLIEYADFKCGYCGKFARDTEPELIEKYVKDGTLRIEWRNFPIFGEESEN 117

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                 A   + R    +W F                +R A    AK  GF K+      
Sbjct: 118 AARGAWAAGQQNR----FWEF----------------HRAAYAEGAKEKGFGKDRVKALA 157

Query: 175 NDQNILD------DIKAGKKRAS------EDFAID--STPVFFIGGNLYLGDMSEGVFS 219
            +  + D      D+     RAS      + + I   STP F I G    G   +  F+
Sbjct: 158 EEAGVKDLDRFMKDLDGDAARASVKKDQEQAYGIGATSTPSFLINGRPIAGAQPDETFT 216


>gi|332187400|ref|ZP_08389138.1| putative lipoprotein [Sphingomonas sp. S17]
 gi|332012561|gb|EGI54628.1| putative lipoprotein [Sphingomonas sp. S17]
          Length = 246

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 82/210 (39%), Gaps = 25/210 (11%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
           T   S L  +P P G  D+  ++     T +   +G  +AP+ +VEY S  C  C  F  
Sbjct: 28  TPAASPLPAVPAPAGQ-DWTQVVH---KTDEGYVMGNPNAPIKLVEYGSRLCPACGAFAR 83

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTV-AVMLARCAE--------KRMDGGYWGF- 135
           + F+ L + Y+K+GK+ +  REF +     +   +L  C          ++M     GF 
Sbjct: 84  EGFEPLTNNYVKSGKVSWEFREFLIHGAPDLPPALLGICQGETIFFPLLEQMYQAQQGFN 143

Query: 136 -----------VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                        L   K  D I +   +  L+N  K  G  +     CL D   +D + 
Sbjct: 144 DKLQAMPPAMQQQLQNAKPVDAIKAMAEQMDLINFVKQRGIPEAKARQCLADMTQIDRLT 203

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
              +    D  +  TP F + G    G +S
Sbjct: 204 KQTQDRGADGTVTGTPTFILNGQPLKGAIS 233


>gi|239942505|ref|ZP_04694442.1| hypothetical protein SrosN15_16018 [Streptomyces roseosporus NRRL
           15998]
 gi|239988969|ref|ZP_04709633.1| hypothetical protein SrosN1_16785 [Streptomyces roseosporus NRRL
           11379]
          Length = 266

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 71/179 (39%), Gaps = 37/179 (20%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVS 114
           ++IG  DAPV ++EYA   C +C +F   T   L +KY+K G LR   R FP+   +S +
Sbjct: 84  LAIGPADAPVVLIEYADFKCGYCGKFARDTEPELIEKYVKDGTLRIEWRNFPIFGEESEN 143

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                 A   + R    +W F                +R A    AK  GF K+      
Sbjct: 144 AARGAWAAGQQNR----FWEF----------------HRAAYAEGAKEKGFGKDRVKALA 183

Query: 175 NDQNILD------DIKAGKKRAS------EDFAID--STPVFFIGGNLYLGDMSEGVFS 219
            +  + D      D+     RAS      + + I   STP F I G    G   +  F+
Sbjct: 184 EEAGVKDLDRFMKDLDGDAARASVKKDQEQAYGIGATSTPSFLINGRPIAGAQPDETFT 242


>gi|307296241|ref|ZP_07576068.1| protein-disulfide isomerase [Sphingobium chlorophenolicum L-1]
 gi|306878043|gb|EFN09266.1| protein-disulfide isomerase [Sphingobium chlorophenolicum L-1]
          Length = 244

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 75/168 (44%), Gaps = 23/168 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   A V ++EY S TC HC +F  ++ + ++ + + +GK+ +  R +  D +     +
Sbjct: 58  MGNPQAKVKLIEYGSYTCSHCRDFAAESAEEIK-QIVDSGKMSFEFRNYVRDPIDISTSL 116

Query: 120 LARCAEK----RMDGGYWGFVSLLFNKQDDWINSKNYRD-----------------ALLN 158
           LARC  K     +   ++   + +F K    +  + Y+                   L++
Sbjct: 117 LARCGGKDIFYPLSDQFFANQNAMFEKAQA-LGDEKYKALMSAPPAERFGQLAQAIGLVD 175

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            AK  G +++    CL D    + +  G + A++ + I+ TP F + G
Sbjct: 176 FAKQRGIAEDQAKQCLADTAAAEKLAKGVEEANQQYKIEGTPSFILNG 223


>gi|149922960|ref|ZP_01911380.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149816211|gb|EDM75718.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 545

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 82/216 (37%), Gaps = 28/216 (12%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEY 72
           G V   IA Y+          + P PDG   +R  L        +   G  DA VT++E+
Sbjct: 99  GFVATLIAGYYVGQWARLKFGDKPQPDGGDRYRVELRGD-----EPQKGPDDALVTIIEF 153

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGY 132
           A   C +C E   +      D Y   G +R I + +PL      A            G +
Sbjct: 154 ADFQCPYC-EQSVEPLAAAMDSY--EGDVRLIFKHYPLPGHRLAAPAAYTSWAAHQQGEF 210

Query: 133 WGFVSLLFNKQD------DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
           W F   LF  +       DWI     ++  L+  KF      D ++      + +D+ AG
Sbjct: 211 WIFHDRLFAAKSAIDDTPDWI-----KELGLDAEKFG----RDMESLDARSAVDEDMAAG 261

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            K       +  TP F + G++Y G   E  + KII
Sbjct: 262 GK-----VGVTGTPAFLVNGHMYRGKRDELGWKKII 292



 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 79/202 (39%), Gaps = 23/202 (11%)

Query: 27  RKGSALNELP-IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
           RK +     P  PD V  +   +  +P+       G  DA VT+VE+A   C +C     
Sbjct: 331 RKAAPKKRRPGEPDDVSVYAVPITGAPAK------GPADALVTVVEFADYHCPYCVRVKT 384

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQD 144
              K  E        +R + R+ PL ++   A   +R A      G +W     LF  Q 
Sbjct: 385 AVDKLAE---TYPNDVRVVYRQRPL-AMHPNARDASRAALAAHQQGKFWEMHDKLFLHQA 440

Query: 145 DWINS--KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
             ++   K   +  L++ KF      D+D       +  D++  ++     F I  TP F
Sbjct: 441 QTLDEFEKLAAELGLDVEKFV----TDYDGEAVAAALQSDLEVAQR-----FGISGTPAF 491

Query: 203 FIGGNLYLGDMSEGVFSKIIDS 224
           F+ G    G  S  VF ++ + 
Sbjct: 492 FVNGRYLSGAQSFAVFEQVFEE 513


>gi|183220282|ref|YP_001838278.1| putative DSBA oxidoreductase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910400|ref|YP_001961955.1| protein-disulfide isomerase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167775076|gb|ABZ93377.1| Protein-disulfide isomerase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167778704|gb|ABZ97002.1| Putative DSBA oxidoreductase; putative membrane protein; putative
           signal peptide [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 410

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 78/182 (42%), Gaps = 22/182 (12%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD-------- 111
           IG+KDAP+T+V+YA   C HC    +     L +     G ++ + + FPLD        
Sbjct: 235 IGKKDAPITIVKYADYNCGHCLHTSHILHTVLSE---YDGMVKVVYKNFPLDGSCNRLMQ 291

Query: 112 -----SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
                + S VA M A CA+K+  G +      L++  +  +       +++N+    G +
Sbjct: 292 QPRPGASSCVAAMAAICADKQ--GKFEPMYRGLYDNLEKGVAHSG--ASVVNLGNLIGLN 347

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK-IIDSM 225
            N    C+  +   + + A    A E   I STP  +I            VF K +++ +
Sbjct: 348 VNSLKACMASKEAQNQLNAEIDEA-EKLNIQSTPSLYINDRRIESGTPNPVFLKTLLEQI 406

Query: 226 IQ 227
           IQ
Sbjct: 407 IQ 408


>gi|212212660|ref|YP_002303596.1| thiol:disulfide interchange protein [Coxiella burnetii CbuG_Q212]
 gi|212011070|gb|ACJ18451.1| thiol:disulfide interchange protein [Coxiella burnetii CbuG_Q212]
          Length = 199

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 82/190 (43%), Gaps = 9/190 (4%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           AL A +  T    ++G   APV +V +  + C +CA F+ +    ++ KYI TG  +YIL
Sbjct: 13  ALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYIL 72

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
                   S  A   A C  K+    ++ FVS L+ +Q D   +      LL  A+ +  
Sbjct: 73  ITLAFLPGSPPAGNAALCLYKQNKNYFFPFVSYLYQRQPDETQNWATIPRLLQFARNSVP 132

Query: 166 SKN--DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-NLYLGDMSEGVFSKII 222
             N      C+        ++   K A +     +TP  ++ G N+      E +  K +
Sbjct: 133 QANMKQLSNCIFSSRYSGALQKNLKIAEKTMNPVATPAVYVNGVNV------EPLTQKRL 186

Query: 223 DSMIQDSTRR 232
           +++I+ +  R
Sbjct: 187 EALIKGARSR 196


>gi|182437678|ref|YP_001825397.1| hypothetical protein SGR_3885 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178466194|dbj|BAG20714.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 265

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 74/167 (44%), Gaps = 15/167 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVS 114
           +++G+ DAPV ++EYA   C +C +F   T   L ++Y+K G LR   R FP+   +S +
Sbjct: 82  LAVGRADAPVVLIEYADFKCGYCGKFARDTEPELIEQYVKDGTLRIEWRNFPIFGEESEN 141

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTC 173
                 A   + R    +W F    +    +    K + +D +  +A+ AG    D D  
Sbjct: 142 AARGAWAAGQQNR----FWEFHGAAYA---EGAKEKGFGKDRVKALAEEAGV--KDLDRF 192

Query: 174 LNDQNILDDIKAGKKRASEDFAID--STPVFFIGGNLYLGDMSEGVF 218
           + D +      A KK   + + I   STP F I G    G   +  F
Sbjct: 193 MKDLDGDAARAAVKKDQEQAYGIGATSTPSFLINGRPIAGAQPDETF 239


>gi|226356208|ref|YP_002785948.1| disulfide oxidoreductase DsbA-Com1-like DsbA family [Deinococcus
           deserti VCD115]
 gi|226318198|gb|ACO46194.1| putative disulfide oxidoreductase precursor, DsbA-Com1-like, DsbA
           family [Deinococcus deserti VCD115]
          Length = 235

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 67/160 (41%), Gaps = 19/160 (11%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR-YIL--------REFPLD 111
           G  +APV++V      C  C  F       L  KY++TGK + Y +        R  P D
Sbjct: 55  GLAEAPVSVVVVEDFKCPVCKTFEETIAPELTSKYVQTGKAKLYTVVWPFLAEARRLPTD 114

Query: 112 SVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDD----WINSKNYRDALLNMAKFAGFS 166
             S +A   ARC  ++  +  +  F S+LF  Q D    W      ++   N+    G  
Sbjct: 115 D-SKLAAQAARCVYDQGGNKAFGSFKSILFRAQGDEGTVWATKARLKELAANV---EGLD 170

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
              F TCL D +    +   +K+  ED  ++ TP  F+ G
Sbjct: 171 TGKFATCL-DTDATASLVEAEKKMVEDARVNHTPTVFVNG 209


>gi|326778314|ref|ZP_08237579.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
 gi|326658647|gb|EGE43493.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
          Length = 264

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 74/167 (44%), Gaps = 15/167 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVS 114
           +++G+ DAPV ++EYA   C +C +F   T   L ++Y+K G LR   R FP+   +S +
Sbjct: 81  LAVGRADAPVVLIEYADFKCGYCGKFARDTEPKLIEQYVKDGTLRIEWRNFPIFGEESEN 140

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTC 173
                 A   + R    +W F    +    +    K + +D +  +A+ AG    D D  
Sbjct: 141 AARGAWAAGQQNR----FWEFHGAAYA---EGAKEKGFGKDRVKALAEEAGV--KDLDRF 191

Query: 174 LNDQNILDDIKAGKKRASEDFAID--STPVFFIGGNLYLGDMSEGVF 218
           + D +      A KK   + + I   STP F I G    G   +  F
Sbjct: 192 MKDLDGDAARAAVKKDQEQAYGIGATSTPSFLINGRPIAGAQPDETF 238


>gi|282863527|ref|ZP_06272586.1| DSBA oxidoreductase [Streptomyces sp. ACTE]
 gi|282561862|gb|EFB67405.1| DSBA oxidoreductase [Streptomyces sp. ACTE]
          Length = 255

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 70/166 (42%), Gaps = 9/166 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           ++ G+ DAPV ++EYA   C +C +F   T   L +KY++ G LR   R FP+    + A
Sbjct: 73  LAQGRTDAPVVLIEYADFKCGYCGKFARDTEPELVEKYVQDGTLRIEWRNFPIFGKESEA 132

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLND 176
              A  A  +  G +W F    +    D    K +  D L  +A  AG    D D    D
Sbjct: 133 AARASWAAGQQ-GRFWEFHRAAYA---DGAKEKGFGEDRLRALAHEAGI--EDLDRFARD 186

Query: 177 QNILDDIKAGKKRASEDFAID--STPVFFIGGNLYLGDMSEGVFSK 220
                   A  +   + + I   STP F I G    G     VF++
Sbjct: 187 TESTAATDAVARDQEQAYGIGATSTPSFLINGRPVAGAQPLSVFTR 232


>gi|116620575|ref|YP_822731.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116223737|gb|ABJ82446.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 318

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 78/186 (41%), Gaps = 34/186 (18%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV---ST 115
           ++G   APV +V ++ + C HC        + L   Y K  ++R   ++FPL+ +   + 
Sbjct: 114 ALGTPGAPVQIVAFSDLQCPHCKTEAQMLRENLIKNYPK--EVRLYFKDFPLEGLHPWAK 171

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
            A M  RC  ++    +W +   +F+KQ+  +  +N +D +L  AK              
Sbjct: 172 AAAMAGRCVFQQNADAFWDYHDFVFSKQES-LTPENLKDQILAWAK-------------- 216

Query: 176 DQNILDDIKAG------------KKRASEDFAID--STPVFFIGGNLYLGDMSEGVFSKI 221
           D   LD +K G            +K   +  A+D  STP  FI G      +       I
Sbjct: 217 DNKSLDSVKLGACIDSKATQAEVEKEMEDGRALDISSTPTLFINGRRIGQSIDWANLKTI 276

Query: 222 IDSMIQ 227
           IDS I+
Sbjct: 277 IDSEIE 282


>gi|116751066|ref|YP_847753.1| DSBA oxidoreductase [Syntrophobacter fumaroxidans MPOB]
 gi|116700130|gb|ABK19318.1| DSBA oxidoreductase [Syntrophobacter fumaroxidans MPOB]
          Length = 339

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 77/173 (44%), Gaps = 19/173 (10%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG---KLRYILREFPL--DSV 113
           S+G  DAPVT+VE++   C  C             K +K+    ++R + +++PL     
Sbjct: 174 SLGPADAPVTLVEFSDYQCPACRATQEGV------KKVKSHFGDRVRLVFKDYPLKRHKN 227

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           + +A   ARCA  +    +W +  +LF  + +   ++     L   A+  G S   FD C
Sbjct: 228 AHLAAQAARCAGDQ--SRFWDYQDVLFAWEQELDVTQ-----LKRFARDLGLSTRMFDEC 280

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           L+       ++   + A     +D TP F + G L +G  S   F KII+  +
Sbjct: 281 LDSGKYKTAVERDVEEAVR-IGVDRTPSFIVNGKLIVGGPSFERFEKIIEEEL 332


>gi|297560316|ref|YP_003679290.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296844764|gb|ADH66784.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 241

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 81/179 (45%), Gaps = 13/179 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DAPV ++ Y+   C  CA++ ++T   L + Y+  G +R   REFP   +   + 
Sbjct: 70  AMGTADAPVVLIVYSDYLCPFCADWVHRTQPELVEAYVAPGLVRIEWREFPY--LGEGSR 127

Query: 119 MLARCAEKRMDGG-YWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKN----DFDT 172
           +LAR A    +   +W + + ++   +D+  ++   R ++ + A+  G   +    D D 
Sbjct: 128 LLARGAVAAGNQDRFWEYHARVYAAPEDFTGDADEVRASMRDAAEEIGLDTDAFARDLDA 187

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
                 +  D   G+     D  +   P F + G+  LG      F+  ID+ ++ + R
Sbjct: 188 AEAGAAVERDFTEGQ-----DMGMSGAPAFLVNGDPVLGAQPLEAFTDSIDAALRAAGR 241


>gi|322369802|ref|ZP_08044365.1| DSBA oxidoreductase [Haladaptatus paucihalophilus DX253]
 gi|320550720|gb|EFW92371.1| DSBA oxidoreductase [Haladaptatus paucihalophilus DX253]
          Length = 182

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 17/157 (10%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +G  DAP+ M  +    C  C  F    F  L   ++++  +R +  E P L   S  A 
Sbjct: 1   MGDLDAPIDMYYWCDYQCPFCRRFEQNAFPKLIRNHVQSRTVRVVFIELPYLGEASMTAA 60

Query: 119 MLARCAEKRMDG----GYWGFVSLLFNKQ----DDWINSKNYRDALLNMAKFA-GFSKND 169
           ++ RC  +++ G     YW + S LF+KQ     +W + +N    LL + K   G   + 
Sbjct: 61  VMDRCVWRQVRGDTPQAYWRWHSTLFDKQGSENSEWASKEN----LLEITKTVDGVDASA 116

Query: 170 FDTCLND-QNILD-DIKAGKKRASEDFAIDSTPVFFI 204
            DTC+   +N ++  I     +AS+ F I  TP F +
Sbjct: 117 VDTCVRTYRNAIEAPINEDIDQASQ-FGIRRTPAFIL 152


>gi|156741356|ref|YP_001431485.1| protein-disulfide isomerase-like protein [Roseiflexus castenholzii
           DSM 13941]
 gi|156232684|gb|ABU57467.1| protein-disulfide isomerase-like protein [Roseiflexus castenholzii
           DSM 13941]
          Length = 275

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 75/183 (40%), Gaps = 23/183 (12%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS--VSTVA 117
           +G  +AP+ ++EY+   C  CA F       L  +YI+TGK+ Y+ R+ PL       +A
Sbjct: 47  LGDPNAPIVIIEYSDYECPACASFVRDAKPQLIAEYIETGKVYYLYRDNPLPQHPAGRIA 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDD--WINSKNYRDALLNM-AKFAGFSKNDFDTCL 174
            + A CA ++  G +W     LF    D  W    +  + +        G        C+
Sbjct: 107 AIYAHCAVRQ--GQFWPMHRRLFQGYIDGEWGGDPSASERVFRRYGDELGLDSGALQECV 164

Query: 175 ND----QNILDDIKAGKKRASEDFAIDSTPVFFI-------GGNLYLGDMSEGVFSKIID 223
            D    Q I  DI+  + R      +  TP + +        G++  G  S G +  ++D
Sbjct: 165 RDPTTEQAIAADIEEARNR-----GLRGTPAYILRWPGGPERGDVLTGAQSFGTWRALLD 219

Query: 224 SMI 226
             +
Sbjct: 220 ERL 222


>gi|103487750|ref|YP_617311.1| protein-disulfide isomerase [Sphingopyxis alaskensis RB2256]
 gi|98977827|gb|ABF53978.1| protein-disulfide isomerase [Sphingopyxis alaskensis RB2256]
          Length = 245

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 73/188 (38%), Gaps = 25/188 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  +AP+ + E+ + TC HCA+F   + + L+  ++ TG++ Y L  F L  +  +A  
Sbjct: 58  MGNPEAPIKLEEFGAFTCGHCAQFAKDSHEELKRDFVDTGRVSYKLTPFMLHPIDAIAGA 117

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA-------KFAGFSK----- 167
           + +C        ++      F + D +I   +     +  A       +F   +K     
Sbjct: 118 IVKCTGPDR---FFPLADATFLEHDAFIAGASKPQPGIEAAMQLPPAQRFIALAKTWGID 174

Query: 168 ----------NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
                          CL     ++ ++ G     E + I  TP F I G +  G  + G 
Sbjct: 175 QFYQQRGVPATTIQQCLGKVENVEAVEKGTNAGIEKYQITGTPTFVINGQVAEGIAAWGP 234

Query: 218 FSKIIDSM 225
               + +M
Sbjct: 235 LRDRLRTM 242


>gi|330468867|ref|YP_004406610.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
 gi|328811838|gb|AEB46010.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
          Length = 241

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 72/172 (41%), Gaps = 8/172 (4%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVST 115
           V++G+ DAPV ++EYA   C  C +   +T   L  +Y+  G +R   R+ P   D    
Sbjct: 72  VALGEPDAPVVVIEYADFQCPFCGKHARETAPRLIREYVDRGLVRIEWRDLPYLGDESRA 131

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL-NMAKFAGFSKNDFDTCL 174
            A      A +   G +W F   L+ KQ   +NS    DA L ++A   G     FD   
Sbjct: 132 AASAARAAAAQ---GRFWEFHDALYAKQRR-VNSGALNDAALRDIASRLGLDLARFDADR 187

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
                 + I   ++ A+    +  TP F +G    +G      F + ID  +
Sbjct: 188 ASAVTREAIDRDQREAAS-MGLTGTPAFIVGDTPIIGAQPYESFKQAIDEQL 238


>gi|161831442|ref|YP_001596817.1| putative disulfide bond formation protein D [Coxiella burnetii RSA
           331]
 gi|161763309|gb|ABX78951.1| putative disulfide bond formation protein D [Coxiella burnetii RSA
           331]
          Length = 218

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 9/190 (4%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           AL A +  T    ++G   APV +V +  + C +CA F+ +    ++ KYI TG  +YIL
Sbjct: 32  ALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYIL 91

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
                   S  A   A C  K+    ++ FVS L+  Q D   +      LL  A+ +  
Sbjct: 92  ITLAFLPGSPPAGNAALCLYKQNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVP 151

Query: 166 SKN--DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-NLYLGDMSEGVFSKII 222
             N      C+        ++   K A +     +TP  ++ G N+      E +  K +
Sbjct: 152 QANMKQLSNCIFSSRYSGALQKNLKIAEKTMNPVATPAVYVNGVNV------EPLTQKRL 205

Query: 223 DSMIQDSTRR 232
           +++I+ +  R
Sbjct: 206 EALIKGARSR 215


>gi|294010076|ref|YP_003543536.1| protein-disulfide isomerase [Sphingobium japonicum UT26S]
 gi|292673406|dbj|BAI94924.1| protein-disulfide isomerase [Sphingobium japonicum UT26S]
          Length = 244

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 73/168 (43%), Gaps = 23/168 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DA V +VEY S TC HC +F  ++ + +  + + +GK+ +  R +  D +     +
Sbjct: 58  MGNPDAKVKLVEYGSYTCSHCRDFAAESAEEIR-QIVDSGKMSFEFRNYVRDPIDISTAL 116

Query: 120 LARCAEK----RMDGGYWGFVSLLFNKQDDWINSKNYRD-----------------ALLN 158
           LARC  K     +   ++   + +F K    +  + Y+                   L++
Sbjct: 117 LARCGGKDIFYPLSDQFFANQNAMFEKAQA-LGDERYKALMSAPPAQRFGQLAEAIGLVD 175

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            AK  G +++    CL D    + +    + A+  + I+ TP F + G
Sbjct: 176 FAKQRGIAEDQAKQCLADTAAAEKLAKTVEDANRQYKIEGTPTFILNG 223


>gi|153206717|ref|ZP_01945558.1| putative disulfide bond formation protein D [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154706029|ref|YP_001424334.1| thiol:disulfide interchange protein [Coxiella burnetii Dugway
           5J108-111]
 gi|165918535|ref|ZP_02218621.1| putative disulfide bond formation protein D [Coxiella burnetii RSA
           334]
 gi|120577080|gb|EAX33704.1| putative disulfide bond formation protein D [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154355315|gb|ABS76777.1| thiol:disulfide interchange protein [Coxiella burnetii Dugway
           5J108-111]
 gi|165917781|gb|EDR36385.1| putative disulfide bond formation protein D [Coxiella burnetii RSA
           334]
          Length = 218

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 9/190 (4%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           AL A +  T    ++G   APV +V +  + C +CA F+ +    ++ KYI TG  +YIL
Sbjct: 32  ALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYIL 91

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
                   S  A   A C  K+    ++ FVS L+  Q D   +      LL  A+ +  
Sbjct: 92  ITLAFLPGSPPAGNAALCLYKQNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVP 151

Query: 166 SKN--DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-NLYLGDMSEGVFSKII 222
             N      C+        ++   K A +     +TP  ++ G N+      E +  K +
Sbjct: 152 QANMKQLSNCIFSSRYSGALQKNLKIAEKTMNPVATPAVYVNGVNV------EPLTQKRL 205

Query: 223 DSMIQDSTRR 232
           +++I+ +  R
Sbjct: 206 EALIKGARSR 215


>gi|308271840|emb|CBX28448.1| hypothetical protein N47_G37720 [uncultured Desulfobacterium sp.]
          Length = 252

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 82/188 (43%), Gaps = 18/188 (9%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +DF   ++ + S  K    G  +APV +V +    C +CA+      + L+ KY K  KL
Sbjct: 74  LDFTYKISTAGSPFK----GPSNAPVVLVLFTDFECPYCAQLVPVLDQVLK-KYPKEVKL 128

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
             + + FPL S                 G +W F  LLF K  + +N K   + +    K
Sbjct: 129 --VFKNFPLQSHRYAMNAAIAALAAESQGKFWEFHDLLF-KNYNQLNDKKLEEII----K 181

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID--STPVFFIGGNLYLGDMSEGVFS 219
            AG +K +FD  ++D   +  +   KK   E    D   TP  FI G L L ++S   F 
Sbjct: 182 MAGLNKQEFDKKMHDPQTIQKV---KKDTIEGINADVRGTPSVFINGKL-LKNLSMTEFI 237

Query: 220 KIIDSMIQ 227
           K ID  ++
Sbjct: 238 KAIDKELK 245


>gi|108762810|ref|YP_633122.1| putative lipoprotein [Myxococcus xanthus DK 1622]
 gi|108466690|gb|ABF91875.1| putative lipoprotein [Myxococcus xanthus DK 1622]
          Length = 361

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 79/175 (45%), Gaps = 27/175 (15%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--SVSTVAV 118
           G + APVT+VE++   C  C+   N     ++ +Y    K+R + R FPLD    +  A 
Sbjct: 200 GPEGAPVTIVEFSDFQCPFCSR-ANPALAQVQQEY--GDKVRIVFRHFPLDFHKEAPKAS 256

Query: 119 MLARCAEKRMDGGYWGFVSLLF-NKQDDWINS-KNY-RDALLNMAKFAGFSKNDFDTCLN 175
             + CA  +  G +W    LLF N+Q   ++S K Y  D  L+ AK        F+ CL+
Sbjct: 257 EASLCAGDQ--GKFWEMHDLLFANQQALGVDSLKKYAADLQLDTAK--------FNACLD 306

Query: 176 DQN----ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
                  +  D+  GK+       +  TP FFI G L  G      F  IID+ +
Sbjct: 307 SGEKGAIVQKDLAEGKQA-----GVSGTPAFFINGILLSGAQPFEEFKSIIDAEL 356


>gi|148557585|ref|YP_001265167.1| protein-disulfide isomerase-like protein [Sphingomonas wittichii
           RW1]
 gi|148502775|gb|ABQ71029.1| Protein-disulfide isomerase-like protein [Sphingomonas wittichii
           RW1]
          Length = 241

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 68/171 (39%), Gaps = 24/171 (14%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           + +G   A V +VEY S+TC HCA+   ++   L+  YI  G + + +R    D     A
Sbjct: 54  IVVGNPAAKVKLVEYLSLTCPHCADLSTQSMPALQRDYIAKGLVSFEVRHAVRDGYDFAA 113

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWI------------NSKNYRDALLNMAKFAGF 165
            +L RC        Y   +  LF  Q +W+            + K+  + +  +AK AGF
Sbjct: 114 SLLLRCEPPTR---YLESLEALFATQGNWMEKALTAKDIPGFDGKSGDEKMAAVAKAAGF 170

Query: 166 ---------SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
                    +   +  C+ D    + +      A +   I  TP+  I G 
Sbjct: 171 DAFFAKRGVTPKAYAACMADTKAKEQLGQMAGYAWQRDQIPGTPLVLINGQ 221


>gi|297154110|gb|ADI03822.1| Na+/H+ antiporter NhaA [Streptomyces bingchenggensis BCW-1]
          Length = 626

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 89/231 (38%), Gaps = 51/231 (22%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTM------- 55
           +   +IG+L  ++  F+ S+      G    E          RALL  + + +       
Sbjct: 403 LQDAKIGILSAVLCSFVISWLITRAIGGLPRE-------AQLRALLGKAETIIDLPVPVD 455

Query: 56  --KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
             +D   G +DAPVT+VEY    C  C +      + L D     G +RY+ R  PL  V
Sbjct: 456 PHRDHVRGPRDAPVTVVEYGDYECPFCGQAEPVIRELLGD----FGDVRYVWRHLPLTDV 511

Query: 114 ST-VAVMLARCAEKRMDGGYWGFVSLLFNKQ-----DDWINSKNY-RDALLNMAKFAGFS 166
                +         + GGYW    LL + Q     DD    + Y  D  L++A+F    
Sbjct: 512 HVHAQLAAEAAEAAALQGGYWDMHDLLLSHQGALRFDDL---RGYAADIGLDVARF---- 564

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDF------AIDSTPVFFIGGNLYLG 211
           + D  +           +AG  R +ED        +  TP FF+ G  + G
Sbjct: 565 ERDMRS-----------RAGSARVAEDVESADVGGVAGTPTFFVNGRRHQG 604


>gi|212218367|ref|YP_002305154.1| thiol:disulfide interchange protein [Coxiella burnetii CbuK_Q154]
 gi|215919064|ref|NP_819905.2| putative disulfide bond formation protein D [Coxiella burnetii RSA
           493]
 gi|206583949|gb|AAO90419.2| thiol:disulfide interchange protein [Coxiella burnetii RSA 493]
 gi|212012629|gb|ACJ20009.1| thiol:disulfide interchange protein [Coxiella burnetii CbuK_Q154]
          Length = 199

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 9/190 (4%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           AL A +  T    ++G   APV +V +  + C +CA F+ +    ++ KYI TG  +YIL
Sbjct: 13  ALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYIL 72

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
                   S  A   A C  K+    ++ FVS L+  Q D   +      LL  A+ +  
Sbjct: 73  ITLAFLPGSPPAGNAALCLYKQNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVP 132

Query: 166 SKN--DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-NLYLGDMSEGVFSKII 222
             N      C+        ++   K A +     +TP  ++ G N+      E +  K +
Sbjct: 133 QANMKQLSNCIFSSRYSGALQKNLKIAEKTMNPVATPAVYVNGVNV------EPLTQKRL 186

Query: 223 DSMIQDSTRR 232
           +++I+ +  R
Sbjct: 187 EALIKGARSR 196


>gi|228995855|ref|ZP_04155513.1| disulfide bond formation protein D [Bacillus mycoides Rock3-17]
 gi|229003472|ref|ZP_04161290.1| disulfide bond formation protein D [Bacillus mycoides Rock1-4]
 gi|228757710|gb|EEM06937.1| disulfide bond formation protein D [Bacillus mycoides Rock1-4]
 gi|228763827|gb|EEM12716.1| disulfide bond formation protein D [Bacillus mycoides Rock3-17]
          Length = 219

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 68/157 (43%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G++DAPV +VE+    C  C  +       L+++YI  GK+++    FP +   S + 
Sbjct: 50  SLGKEDAPVKVVEFGDFKCPACRTWDTTVLPRLKEEYINKGKVQFYFINFPFIGKDSNLG 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K    +   F 
Sbjct: 110 AAAGEAIYKQDPESFWTFYDEIYQIQKKDTEEWIT----EELLLNIVKEKLPKVNIEQFK 165

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ +   D ++    RA +   +   P  ++ GNL
Sbjct: 166 KDLHSKETQDKVRKDSDRA-QKLKVQGAPSVYVNGNL 201


>gi|257388371|ref|YP_003178144.1| DSBA oxidoreductase [Halomicrobium mukohataei DSM 12286]
 gi|257170678|gb|ACV48437.1| DSBA oxidoreductase [Halomicrobium mukohataei DSM 12286]
          Length = 218

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 73/174 (41%), Gaps = 12/174 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTVA 117
           G  +A VT+  Y    C HCA F+ + +  +  +Y+ +G +RY   +FPL    SVS  A
Sbjct: 53  GDPEADVTVAVYEDFACPHCATFNQEVYPDIRSEYVDSGAIRYEHHDFPLPVDQSVSLEA 112

Query: 118 VMLARCAEKRM-DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
              AR  +  + D  ++ +  LLF  Q          D   ++A+      +   T   +
Sbjct: 113 PNAARAVQDGVGDEAFFEYADLLFENQGSL-----GPDRYASLAREVDADPSTVKTAAVE 167

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           Q     I+A  +    D  +D TP   + G     + S    S  ID+   DST
Sbjct: 168 QAYEATIEA-DREGGIDAGVDRTPTALVDGEKV--EASYEALSAAIDAAQSDST 218


>gi|239906944|ref|YP_002953685.1| DSBA oxidoreductase family protein [Desulfovibrio magneticus RS-1]
 gi|239796810|dbj|BAH75799.1| DSBA oxidoreductase family protein [Desulfovibrio magneticus RS-1]
          Length = 259

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 6/165 (3%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           V++G ++APVT+VEY+   C  C +    T K + +K  +   +R + + F     S  A
Sbjct: 88  VALGPQNAPVTIVEYSDFLCHFCGQASG-TVKSVMEK--RPDDVRLVFKHFATGKNSVRA 144

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            +      ++     W F+  +F +Q D     +  + L  +AK  G         +  +
Sbjct: 145 ALYFEAIAQQDAKKAWNFMDKVFARQKDVAEKGD--EVLDAIAKEVGADAKKLAEDVKSK 202

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            + D + A  K A  DF  + TPVF I G    G +   VF + +
Sbjct: 203 ALADRVAADTKEA-RDFGFEGTPVFLINGAPVRGAVPYEVFDEFV 246


>gi|313680135|ref|YP_004057874.1| dsba oxidoreductase [Oceanithermus profundus DSM 14977]
 gi|313152850|gb|ADR36701.1| DSBA oxidoreductase [Oceanithermus profundus DSM 14977]
          Length = 306

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 68/167 (40%), Gaps = 11/167 (6%)

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV-MLARCA 124
           PVT+ EY+   C  C    N+    ++ +Y++TG+ R+  R FPL  +   AV       
Sbjct: 150 PVTIREYSDFECPACQALFNRALAQIKARYVETGRARFEYRHFPLFEIHKQAVPAAEASE 209

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                G +W +   LF +     +  NY    + +AK        F  C+ ++   D ++
Sbjct: 210 CAAAQGAFWTYHDALFEE-----DVGNY----VGLAKQLDLDVGRFAECVANRTYRDVVE 260

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           A +  A +   +  TP  F+G  L       G + + +      + R
Sbjct: 261 AHRAEA-DRLGLRGTPSVFVGPFLLPNPFDVGSYDRYLRMAAAQAER 306


>gi|294813944|ref|ZP_06772587.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|326442355|ref|ZP_08217089.1| hypothetical protein SclaA2_14874 [Streptomyces clavuligerus ATCC
           27064]
 gi|294326543|gb|EFG08186.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
          Length = 293

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 73/171 (42%), Gaps = 9/171 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G+ DAPV ++EYA   C  C +F   T   L +KY+ +G LR   R FP+   +   
Sbjct: 81  LAVGRADAPVVLIEYADFKCGFCGKFARDTEPGLIEKYVDSGVLRIEWRNFPI-FGAESE 139

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLND 176
                       G +W F +  +    D    K +  + L  +A+ AG    D D    D
Sbjct: 140 AAARAAWAAGRQGRFWQFHAAAYA---DGSKEKGFGEERLKELAEEAGV--KDADRFARD 194

Query: 177 QNILDDIKAGKKRASEDFAI--DSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            +  +   A +K   E + +   STP F + G    G      F++ I++ 
Sbjct: 195 LDSAEAKAAVRKDQEEAYQLGASSTPSFLVNGRPIAGAQPMETFTEAIEAA 245


>gi|284047208|ref|YP_003397548.1| hypothetical protein Cwoe_5772 [Conexibacter woesei DSM 14684]
 gi|283951429|gb|ADB54173.1| conserved hypothetical protein [Conexibacter woesei DSM 14684]
          Length = 270

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 24/192 (12%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSV 113
            +  S+G   APVT+VE+A + C +C +F  +    + + Y+KTG+++   R    L + 
Sbjct: 88  QRGTSLGDPRAPVTLVEFADLQCPYCRDFSLQVLPSIVNDYVKTGRVKLEFRNLAFLGTD 147

Query: 114 STVAVMLARCA--EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
           ST    +A     + R+    + F+ + +  Q +  NS    D  L     A     D  
Sbjct: 148 STRGAQMAEAVGLQNRL----YEFIDIFYANQGEE-NSGYVTDEFLTRTAGA-IPGVDVQ 201

Query: 172 TCLND------QNILDDIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFS 219
             ++D      Q +L D    ++ A+  F   STP F IG        L +  +S   F 
Sbjct: 202 RAMDDRGTARVQRLLTD---AQEEATAAFPQLSTPSFLIGPTGGTLEPLEVEQLSADAFK 258

Query: 220 KIIDSMIQDSTR 231
           + ID +I+ + R
Sbjct: 259 ERIDPVIERNAR 270


>gi|115374181|ref|ZP_01461468.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310820898|ref|YP_003953256.1| DSBA-like thioredoxin domain-containing protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115368848|gb|EAU67796.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309393970|gb|ADO71429.1| DSBA-like thioredoxin domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 656

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 71/173 (41%), Gaps = 17/173 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APVT+V ++   C  C+     T K LE+ Y   GK+R   +  PL   +      
Sbjct: 487 GPANAPVTIVAFSDFECPFCSRV-VPTLKQLEEGY--KGKIRVAFKNQPLPFHANAKPAA 543

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQD--DWINSKNYRDAL-LNMAKF-AGFSKNDFDTCLND 176
           A        G +W +   LF  Q   D  + + Y + L L+M KF A    N FD     
Sbjct: 544 AAALAAHEQGKFWEYHDKLFANQKALDRASLERYAEELKLDMGKFKAALDSNKFDA---- 599

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             I  D   G +        + TP FFI G   +G      F ++ID  ++ +
Sbjct: 600 -QITADSTEGTR-----VGANGTPTFFINGRTLVGAQPADAFKRVIDEELKKA 646



 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 67/165 (40%), Gaps = 11/165 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DA VTMVE++   C  C+   + T K L+++Y    KLR ++++ PL          
Sbjct: 68  GSPDALVTMVEFSDYQCPFCSR-ADATVKKLQEEY--GNKLRVVMKQNPLSFHPRAKPAA 124

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-LLNMAKFAGFSKNDFDTCLNDQNI 179
                    G YW +   LF       N++   DA L   A   G   N +   L+ ++ 
Sbjct: 125 LGALAAGEQGKYWEYHDKLF------ANARALEDADLEKYASEIGLDVNRWKKDLSKESF 178

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
              I   +  A +    + TP FFI G L  G      F  +ID 
Sbjct: 179 QQIITRDQTLAGQ-LGANGTPAFFINGRLLSGAQPLERFKALIDE 222



 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 62/166 (37%), Gaps = 9/166 (5%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           + G KDA VT+VE++   C  C      T   +++ Y K   +R + R  PL   S+  +
Sbjct: 276 AFGPKDAKVTIVEWSDFECPFCGRVM-PTLAKIKETYGKD--VRVVFRHQPLPFHSSAKL 332

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                      G +W F   LF+ Q         R +L   A+      N F   L+   
Sbjct: 333 AAEASMAAHEQGKFWEFHDKLFSNQKALD-----RASLEKYAQELKLDVNKFKAALDSGK 387

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
               ++A    A      + TP FFI G   +G      F   ID 
Sbjct: 388 FRAKVEA-DSTAGSAVGANGTPTFFINGRQLVGAQPFESFKAAIDE 432


>gi|159037284|ref|YP_001536537.1| Na+/H+ antiporter NhaA [Salinispora arenicola CNS-205]
 gi|189029143|sp|A8LVS8|NHAA1_SALAI RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|157916119|gb|ABV97546.1| Na+/H+ antiporter NhaA [Salinispora arenicola CNS-205]
          Length = 652

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 90/214 (42%), Gaps = 31/214 (14%)

Query: 19  IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
           +A+     R+  AL  L + +G++D   ++   P   +D   G ++APVT+VEY    C 
Sbjct: 430 LAARLPPARRARAL--LGVSEGIIDL--MVPVDPD--RDHVRGPREAPVTVVEYGDFECP 483

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD-GGYWGFVS 137
           +C +      + L D       +RY+ R  PL  V   A + A  AE   D G +W    
Sbjct: 484 YCGQAEPAVRELLTDFT----NIRYVWRHLPLTDVHPYAQVAAEAAEAAGDQGAFWEMHD 539

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKN-DFDTCLNDQNILDDIKAGKKRASEDF-- 194
           LL   Q +           L  A   G+++  D D     +++ D  + G  R +ED   
Sbjct: 540 LLLAHQGE-----------LRPADLLGYAERLDLDLDRFREHLAD--RRGAVRIAEDVDG 586

Query: 195 ----AIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
               ++  TP FF+ G  + G  +    S  + S
Sbjct: 587 ADLSSVSGTPTFFVNGRRHHGSYNIEALSAAVTS 620


>gi|320009572|gb|ADW04422.1| DSBA oxidoreductase [Streptomyces flavogriseus ATCC 33331]
          Length = 263

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 66/174 (37%), Gaps = 31/174 (17%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G+ DAPV ++EYA   C +C +F   T   L  +Y+  G LR   R FP+   ++ A   
Sbjct: 87  GRTDAPVVLIEYADFQCGYCGKFARDTEPELIKRYVDDGTLRIEWRNFPIFGDASEAAAR 146

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A  A  R  G +W F                +R A    AK  GF K           + 
Sbjct: 147 ASWAAGRQ-GRFWAF----------------HRAAYAEDAKEKGFGKGRLRALARQAGVK 189

Query: 181 D----DIKAGKKRASEDFAID----------STPVFFIGGNLYLGDMSEGVFSK 220
           D       AG   A+E   +D          STP F + G    G     VF++
Sbjct: 190 DLDRFTRDAGSAAATEAVGVDRQEAYRIGATSTPSFLVNGRPLAGAQPTAVFTQ 243


>gi|301166290|emb|CBW25865.1| putative sodium/proton antiporter [Bacteriovorax marinus SJ]
          Length = 161

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 62/154 (40%), Gaps = 19/154 (12%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DAPV +VE+    C  C  F     K L  KY   GK++  +R  P    S  A+ 
Sbjct: 1   MGPDDAPVKLVEFMDPECESCRMFF-PFVKNLMKKY--EGKIQLTIRYVPFHGNSKFAIA 57

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL-NMAKFAGFSKNDFDTCLNDQN 178
           +   A K+  G YW  + +LF  Q  W N    R  L+ N     G   +       D  
Sbjct: 58  ILESARKQ--GKYWETLEILFKNQPAWGNHHQPRPELIWNYLPMVGLDVDQIKKDYKD-- 113

Query: 179 ILDDIKAGKKRASEDFA------IDSTPVFFIGG 206
                 A  K   +DFA      + +TP FFI G
Sbjct: 114 -----PAWTKIIEQDFADARELGVRATPTFFING 142


>gi|228989666|ref|ZP_04149648.1| disulfide bond formation protein D [Bacillus pseudomycoides DSM
           12442]
 gi|228770000|gb|EEM18582.1| disulfide bond formation protein D [Bacillus pseudomycoides DSM
           12442]
          Length = 219

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G++DAPV +VE+    C  C  +       L+++YI  GK+++    FP +   S + 
Sbjct: 50  SLGKEDAPVKVVEFGDFKCPACRTWDTTVLPRLKEEYINKGKVQFYFINFPFIGKDSNLG 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN    K    +   F 
Sbjct: 110 AAAGEAIYKQDPESFWTFYDEIYQIQKKDTEEWIT----EELLLNTVKEKLPKVNIEQFK 165

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ +   D ++    RA +   +   P  ++ GNL
Sbjct: 166 KDLHSKETQDKVRKDSDRA-QKLKVQGAPSIYVNGNL 201


>gi|291454141|ref|ZP_06593531.1| DSBA oxidoreductase [Streptomyces albus J1074]
 gi|291357090|gb|EFE83992.1| DSBA oxidoreductase [Streptomyces albus J1074]
          Length = 187

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 71/164 (43%), Gaps = 5/164 (3%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV M+EY+   C +C  F  +T   L  + ++ G LR   R FPL    +  
Sbjct: 1   MAVGDVDAPVVMIEYSDFQCPYCGRFARETKPALLREQVEEGVLRIEWRNFPLFGEESER 60

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             LA  A  +  G +W F  L + +     +      A+++MA+ AG    D +    D 
Sbjct: 61  AALAAWAAGQQ-GKFWEFHDLAYAEPRKRNSGAFSEKAVVDMAEKAGV--GDLEQFRKDL 117

Query: 178 NILDDIKAGKKRASE--DFAIDSTPVFFIGGNLYLGDMSEGVFS 219
              +   A ++   E     + STP F + G   LG      F+
Sbjct: 118 GGAEGRAALERDQQEGSGLGVSSTPAFLVNGEPILGAQPGSTFT 161


>gi|239982296|ref|ZP_04704820.1| hypothetical protein SalbJ_22889 [Streptomyces albus J1074]
          Length = 194

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 71/164 (43%), Gaps = 5/164 (3%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV M+EY+   C +C  F  +T   L  + ++ G LR   R FPL    +  
Sbjct: 8   MAVGDVDAPVVMIEYSDFQCPYCGRFARETKPALLREQVEEGVLRIEWRNFPLFGEESER 67

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             LA  A  +  G +W F  L + +     +      A+++MA+ AG    D +    D 
Sbjct: 68  AALAAWAAGQQ-GKFWEFHDLAYAEPRKRNSGAFSEKAVVDMAEKAGV--GDLEQFRKDL 124

Query: 178 NILDDIKAGKKRASE--DFAIDSTPVFFIGGNLYLGDMSEGVFS 219
              +   A ++   E     + STP F + G   LG      F+
Sbjct: 125 GGAEGRAALERDQQEGSGLGVSSTPAFLVNGEPILGAQPGSTFT 168


>gi|145594211|ref|YP_001158508.1| Na+/H+ antiporter NhaA [Salinispora tropica CNB-440]
 gi|189029102|sp|A4X5I0|NHAA3_SALTO RecName: Full=Na(+)/H(+) antiporter nhaA 3; AltName:
           Full=Sodium/proton antiporter nhaA 3
 gi|145303548|gb|ABP54130.1| Na+/H+ antiporter NhaA [Salinispora tropica CNB-440]
          Length = 652

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 81/199 (40%), Gaps = 23/199 (11%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           +G++D   ++   P   +D   G ++APVT+VEYA   C +C +      + L D     
Sbjct: 448 EGIIDL--MVPVDPD--RDHVRGPREAPVTVVEYADFECPYCGQAEPAVRELLVDYT--- 500

Query: 99  GKLRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
             +RY+ R  PL  V   A M           G +W    LL   QD+       R A  
Sbjct: 501 -SVRYVWRHLPLTDVHPYAQMAAEAAEAAAEQGAFWEMHDLLLAHQDE------LRPA-- 551

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA----IDSTPVFFIGGNLYLGDM 213
           ++ ++A   + D D     +++ D   AG+     D A    +  TP FF+ G  + G  
Sbjct: 552 DLLRYA--ERLDLDLDRFREHLADRRGAGRIAQDVDAADLSSVSGTPTFFVNGRRHHGPY 609

Query: 214 SEGVFSKIIDSMIQDSTRR 232
           +    S  + S    +  R
Sbjct: 610 NIEALSAAVMSAFASARLR 628


>gi|254389965|ref|ZP_05005187.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|197703674|gb|EDY49486.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
          Length = 225

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 9/170 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G+ DAPV ++EYA   C  C +F   T   L +KY+ +G LR   R FP+   +   
Sbjct: 13  LAVGRADAPVVLIEYADFKCGFCGKFARDTEPGLIEKYVDSGVLRIEWRNFPI-FGAESE 71

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLND 176
                       G +W F +  +    D    K +  + L  +A+ AG    D D    D
Sbjct: 72  AAARAAWAAGRQGRFWQFHAAAYA---DGSKEKGFGEERLKELAEEAGV--KDADRFARD 126

Query: 177 QNILDDIKAGKKRASEDFAI--DSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            +  +   A +K   E + +   STP F + G    G      F++ I++
Sbjct: 127 LDSAEAKAAVRKDQEEAYQLGASSTPSFLVNGRPIAGAQPMETFTEAIEA 176


>gi|152974300|ref|YP_001373817.1| DSBA oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152023052|gb|ABS20822.1| DSBA oxidoreductase [Bacillus cytotoxicus NVH 391-98]
          Length = 217

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 69/157 (43%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           ++G++DAPV +VE+    C  C  +    F  L++ YI  GK+++    FP +   S + 
Sbjct: 48  ALGKEDAPVKVVEFGDFKCPACRTWDATVFPRLKEDYINKGKVQFYFINFPFIGKDSELG 107

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K    +   F 
Sbjct: 108 AAAGEAIYKQDPDSFWKFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVNVEQFK 163

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + + + ++    RA E   +   P  ++ GNL
Sbjct: 164 KDLHSKEMKEKVRKDFDRA-EKLKVQGAPSVYVNGNL 199


>gi|115374845|ref|ZP_01462119.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115379192|ref|ZP_01466311.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115363812|gb|EAU62928.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115368154|gb|EAU67115.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 248

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 10/179 (5%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           ++A+P T +  S+G  DA VT+  ++   C  CA    +T K L +KY +  ++R + R+
Sbjct: 78  ISATPRT-EAPSLGSADAKVTVEVWSDFECPFCAR-GAETVKALREKYGE--QVRIVFRQ 133

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
            PL S     +           G +W F   LF  QD        R +L  +A       
Sbjct: 134 NPLPSHKNARLAAVASMAAHEQGKFWEFHDALFAHQDTL-----DRASLEKLAGQLNLDV 188

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             F   L D +  ++    ++  S+   + + P FF+ G   LG     VF++ ID  +
Sbjct: 189 ERFQRAL-DSSTWNNYVDMERTESQRRRVTAAPTFFVNGKPLLGAQPLSVFAQTIDEAL 246


>gi|310817656|ref|YP_003950014.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|309390728|gb|ADO68187.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 218

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 10/179 (5%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           ++A+P T +  S+G  DA VT+  ++   C  CA    +T K L +KY +  ++R + R+
Sbjct: 48  ISATPRT-EAPSLGSADAKVTVEVWSDFECPFCAR-GAETVKALREKYGE--QVRIVFRQ 103

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
            PL S     +           G +W F   LF  QD        R +L  +A       
Sbjct: 104 NPLPSHKNARLAAVASMAAHEQGKFWEFHDALFAHQDTL-----DRASLEKLAGQLNLDV 158

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             F   L D +  ++    ++  S+   + + P FF+ G   LG     VF++ ID  +
Sbjct: 159 ERFQRAL-DSSTWNNYVDMERTESQRRRVTAAPTFFVNGKPLLGAQPLSVFAQTIDEAL 216


>gi|219849651|ref|YP_002464084.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
 gi|219543910|gb|ACL25648.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
          Length = 232

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 76/169 (44%), Gaps = 6/169 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DAPVT++ Y+   C  CA +       + + ++ TGK R + R   L  +   + +
Sbjct: 68  LGNPDAPVTIMVYSDFLCTTCAIYTLDLEPQVIEAFVVTGKARLVYRH--LLQLGERSQL 125

Query: 120 LARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           LA  +E   D G +W     L+ + +      N R+  +++A+  G   + F  CL+   
Sbjct: 126 LAEASECAADHGKFWEMRHELYARYNQLYF--NTRETTIDLAQGLGIPADAFSACLDAHT 183

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
               ++A    A+ +  + + PVF IG    +G       +++I+   Q
Sbjct: 184 YRAQVEADYSAATAE-GVFARPVFRIGNETLVGMPRFEALAQVIERAAQ 231


>gi|313126726|ref|YP_004036996.1| protein-disulfide isomerase [Halogeometricum borinquense DSM 11551]
 gi|312293091|gb|ADQ67551.1| protein-disulfide isomerase [Halogeometricum borinquense DSM 11551]
          Length = 222

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (45%), Gaps = 17/172 (9%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVST 115
           ++G +DA VT+  Y    C HCA ++   F  ++  YI TGK+RY   +FP+      S 
Sbjct: 49  TLGPEDADVTVDVYEDFACPHCATYNVDVFPKVKQNYIDTGKIRYRFFDFPIPVSKQWSW 108

Query: 116 VAVMLARCAEKRMDG-GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
              + AR  + R D   Y+ +   LF KQ++ + S  Y   + ++A     ++ D D C 
Sbjct: 109 GGAIAARAVQDRTDDETYFKYAKRLFEKQNE-LTSNGYT-VIHDVA-----NEFDVDGCE 161

Query: 175 NDQNILDDI-----KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
              ++  DI     K+ ++R  E   I  TP   + G    G   E V + I
Sbjct: 162 VMASVEQDIYRSVVKSDRQRGIE-VDIGGTPAIIVNGEHLSGAGWETVKNGI 212


>gi|317122836|ref|YP_004102839.1| DSBA oxidoreductase [Thermaerobacter marianensis DSM 12885]
 gi|315592816|gb|ADU52112.1| DSBA oxidoreductase [Thermaerobacter marianensis DSM 12885]
          Length = 300

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 79/190 (41%), Gaps = 13/190 (6%)

Query: 45  RALLAASPSTM---KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           R    ASP      +   +G   APVT+VE+A   C +C EF    F    + YI TGK+
Sbjct: 75  RGEAPASPDVFQLDRQPMLGSAGAPVTVVEFADFKCPYCREFAMNEFPRFREAYIDTGKV 134

Query: 102 RYILREFPL---DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
           R+    +P    DS +    + A  A+     G W F+  +   Q          + L++
Sbjct: 135 RFYFINYPFIGPDSDTAAQALEAIYAQ--APEGVWAFIDRVMQLQGPEDQQWATPEFLVD 192

Query: 159 MAKFA--GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-E 215
            A+ A  G         L      D ++A +  A     +  TP  F+ G  ++ D S E
Sbjct: 193 AARQAVPGIDAERLAQDLRSGRYRDAVEADRAIARR-VGVQGTPALFVNGR-FVPDWSFE 250

Query: 216 GVFSKIIDSM 225
           G+ + + +++
Sbjct: 251 GLSAAVDEAL 260


>gi|108760353|ref|YP_635417.1| thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108464233|gb|ABF89418.1| thioredoxin domain protein [Myxococcus xanthus DK 1622]
          Length = 439

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 69/171 (40%), Gaps = 9/171 (5%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APVT+V ++   C  CA     T K LE  Y   GKLR   +  PL   +   V  
Sbjct: 278 GPANAPVTVVAFSDFECPFCARV-VPTMKALEAAY--PGKLRVAFKHQPLAQHANAQVAA 334

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
               E    G +W F  +LF  Q      K  R +L + A+  G     F+  L+ +   
Sbjct: 335 EAAMEAHAQGRFWEFHDVLFANQ-----RKLDRASLEHYARQVGLDVGRFNAALDSRKHD 389

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
             + A   +A    A   TP FFI G    G      F  IID  ++ + R
Sbjct: 390 AHVSADVAQAMRVGAT-GTPTFFINGRPVTGARPVEHFRAIIDDELRKAAR 439



 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 74/175 (42%), Gaps = 17/175 (9%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           + G +DA VT+VE++   C  C+   N T K L+++Y +  KLR +++  PL +      
Sbjct: 68  TAGAEDALVTLVEFSDYECPFCSRA-NGTVKQLQERYGR--KLRVVMKHHPLANHPRARP 124

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                      G +W     LF       N +   +A  +M ++A   K   +    +Q+
Sbjct: 125 AALAALAAGEQGKFWEMHEALF------ANPRALSEA--DMERYA--MKVGLNISRWNQD 174

Query: 179 ILDDIKAGKKRASEDFAI----DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             D   A + R  E  A+      TP F++ G    G     VF+ ++D  +  +
Sbjct: 175 RADPRLAERIRQDEALAMRLGATGTPAFYVNGRFISGAQPLEVFTGVVDEELSKA 229


>gi|297622777|ref|YP_003704211.1| DSBA oxidoreductase [Truepera radiovictrix DSM 17093]
 gi|297163957|gb|ADI13668.1| DSBA oxidoreductase [Truepera radiovictrix DSM 17093]
          Length = 223

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 62/152 (40%), Gaps = 8/152 (5%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +G   APV +  +    C  CA F       +E + I+TG+ R     +P L   ST A 
Sbjct: 54  LGDPAAPVEIAVFEDFKCPACAYFDESILPRVERELIETGQARMYFIHYPFLGPDSTTAA 113

Query: 119 MLARCAEKRMDGGYWGFVSLLF----NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
           + + CA ++ +  +W F + +F    N+  +W       D   N         ++   C 
Sbjct: 114 IASECAYRQNEAAFWDFKTYVFRSQGNETQEWATPARLADIARN--NVPALDADELRACT 171

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            ++   + I+A ++  +    +  TP   + G
Sbjct: 172 EEERYAEVIRADRELGNRA-GVRGTPTVLVDG 202


>gi|148657640|ref|YP_001277845.1| protein-disulfide isomerase-like protein [Roseiflexus sp. RS-1]
 gi|148569750|gb|ABQ91895.1| Protein-disulfide isomerase-like protein [Roseiflexus sp. RS-1]
          Length = 284

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 76/200 (38%), Gaps = 19/200 (9%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
           V+     +A + S +    +G   AP+ ++EY+   C  CA F   T   L  +YI+TGK
Sbjct: 37  VIPLAQGVAQAQSDVDPRGLGDPRAPLVIIEYSDYECPACASFVRDTKPQLIAEYIETGK 96

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD--W-INSKNYRDALL 157
           + Y+ R+ PL       V  A        G +W     LF    D  W  N  +      
Sbjct: 97  VYYLYRDNPLPQHPAGRVAAAYAHCAAQQGQFWSMHQRLFQGYIDGEWGGNPSSSERVFQ 156

Query: 158 NMAKFAGFSKNDFDTCL----NDQNILDDIKAGKKRASEDFAIDSTPVFFI-------GG 206
                 G   N    C+     D+ I  D++  + R      +  TP + +        G
Sbjct: 157 RYGDELGLDGNALQQCVRNPATDRAIAADVEEARNR-----GLRGTPAYILRWPGGPERG 211

Query: 207 NLYLGDMSEGVFSKIIDSMI 226
           ++  G  S G +  ++D  +
Sbjct: 212 DVLTGAQSFGTWRYLLDERL 231


>gi|75812802|ref|YP_320419.1| DSBA oxidoreductase [Anabaena variabilis ATCC 29413]
 gi|75705558|gb|ABA25230.1| DSBA oxidoreductase [Anabaena variabilis ATCC 29413]
          Length = 196

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 68/177 (38%), Gaps = 18/177 (10%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
           LP+ D      A    +P   +D   G K+APVT+VEY    C +C   H   F   E +
Sbjct: 11  LPVSDAFSFRDATANGTPEGERDHIRGPKNAPVTLVEYGDYECPYCGRAH---FIVKELQ 67

Query: 95  YIKTGKLRYILREFPLDSVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
            +    +R++ R FPL SV                 G +W   + LF  Q         R
Sbjct: 68  QLTGDLMRFVYRHFPLTSVHPHAEQAAEAAEAAAAQGKFWEMHNHLFEHQQALD-----R 122

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQ----NILDDIKAGKKRASEDFAIDSTPVFFIGG 206
             L+  A   G     F   L +      I +D+ +G +       ++ TP FFI G
Sbjct: 123 KHLIEYAANLGLDVPRFSHELAEHAHAAKIREDLLSGIQS-----GVNGTPTFFING 174


>gi|116619661|ref|YP_821817.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116222823|gb|ABJ81532.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 246

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 67/174 (38%), Gaps = 14/174 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G K AP+T+VEY    C  C  FH   F  L+ +YI TGK+R+  ++ PLD        
Sbjct: 77  LGTKTAPLTIVEYTDYQCPFCQRFHVTAFSELKKQYIDTGKVRFFSKDMPLDFHPNALRA 136

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                       +W    ++    D     K   D ++N A            C++    
Sbjct: 137 AQAARCAAEQKKFWELRDVMGANPD-----KLDIDHIMNFAADLKMDTAALRACVDSGKY 191

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIG--------GNLYLGDMSEGVFSKIIDSM 225
            D ++     A +    + TP F +G        G L +G M   +F   + S+
Sbjct: 192 KDTVQRDVLEAMK-IGANGTPTFIVGKSVGEGVDGELVVGAMPFEMFDAKLKSL 244


>gi|108757235|ref|YP_631407.1| DSBA-like thioredoxin domain-containing protein [Myxococcus xanthus
           DK 1622]
 gi|108461115|gb|ABF86300.1| DSBA-like thioredoxin domain protein [Myxococcus xanthus DK 1622]
          Length = 551

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 70/167 (41%), Gaps = 9/167 (5%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G K+APVT+V ++   C  C+     T K LED+Y   GK++   +  PL   +   +  
Sbjct: 384 GDKNAPVTIVAFSDFECPFCSRVV-PTLKQLEDQY--GGKIKVAFKNQPLPFHANAKLAA 440

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A        G +W +   LF  Q         R +L   A+  G + + F   L+     
Sbjct: 441 AAALAANEQGKFWEYHDKLFANQRALD-----RASLEKYAQELGLNVDKFKAALDQGKFN 495

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             I+A   +AS       TP FFI G   +G      F ++ID  ++
Sbjct: 496 AQIEADMAQAS-SVGASGTPTFFINGRTLVGAQPVDAFKRVIDEELK 541



 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 69/171 (40%), Gaps = 15/171 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S G  +A VT+VE++   C  C+     T   +++ Y K   +R + R  PL       +
Sbjct: 170 SFGPANAKVTIVEWSDFECPFCSRV-GPTLSKIKESYAKD--VRVVFRHQPLPFHPNAKL 226

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQD--DWINSKNYRDAL-LNMAKFAGFSKNDFDTCLN 175
                      G +W +   LF  Q   D  + + Y   L LN+AKF    K   D+   
Sbjct: 227 AAEASHAAHEQGKFWEYHDKLFANQKAMDRASLEKYAQELGLNVAKF----KAALDSGKF 282

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
              +  D+ AG          + TP FFI G  ++G      F ++ID  I
Sbjct: 283 KAKVEADMAAGNA-----VGANGTPTFFINGREFVGAQPFEAFKRVIDEEI 328


>gi|229083781|ref|ZP_04216097.1| disulfide bond formation protein D [Bacillus cereus Rock3-44]
 gi|228699532|gb|EEL52201.1| disulfide bond formation protein D [Bacillus cereus Rock3-44]
          Length = 219

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 68/157 (43%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+KDAPV +VE+    C  C  +       L++ YI   K+++    FP +   S + 
Sbjct: 50  SLGKKDAPVKVVEFGDFKCPACRTWDATVLPRLKEDYINKDKVQFYFINFPFIGKDSDLG 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K    + + F 
Sbjct: 110 AAAGEAIYKQDPESFWTFYDEIYQNQGKDTEEWIT----EELLLNIVKEKLPKVNVDQFK 165

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 166 KDLHSKEIQEKVRKDADRAKK-LKVQGAPSVYVNGNL 201


>gi|294677280|ref|YP_003577895.1| DSBA family oxidoreductase [Rhodobacter capsulatus SB 1003]
 gi|294476100|gb|ADE85488.1| oxidoreductase, DSBA family [Rhodobacter capsulatus SB 1003]
          Length = 248

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 79/167 (47%), Gaps = 18/167 (10%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +  VTMVE+    C +C     K ++ +++   K GK+R++++EFP+  +S  +V+ 
Sbjct: 90  GNPEGDVTMVEFIDYKCTYC----KKAYEVVDEVLKKDGKIRFVVKEFPI--LSDQSVLA 143

Query: 121 AR--CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL---N 175
           AR   A +++ G         + K  D + +      L ++ + A   K D    L   N
Sbjct: 144 ARFAVATRQVAG------DAAYEKVHDALMAVRGDITLDSLQRLAEEQKIDAKAVLAQMN 197

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            + +   ++A  + A E  AI  TP F +GG L  G     V ++I+
Sbjct: 198 SEEVTSVLRANAQLA-ERMAIAGTPAFVVGGQLLRGYAPAEVMAQIV 243


>gi|159039171|ref|YP_001538424.1| DSBA oxidoreductase [Salinispora arenicola CNS-205]
 gi|157918006|gb|ABV99433.1| DSBA oxidoreductase [Salinispora arenicola CNS-205]
          Length = 182

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 73/167 (43%), Gaps = 20/167 (11%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +P T  D   G  DAPVT+VEYA   C  C   +    + L     +  ++R I R FP+
Sbjct: 13  TPVTETDHVRGPVDAPVTLVEYADFQCRFCGVAYANLAELLRQ---RADRVRLIYRHFPI 69

Query: 111 DSVSTVAVMLARCAEKR-MDGGYWGFVSLLFNKQD--DWINSKNYRDALLNMAKFAGFSK 167
            +V   A   A+ AE   + G +W     L+  QD  D ++        L + +  G S 
Sbjct: 70  ANVHPYADDAAQVAEAAGIRGRFWELHDWLYEHQDQLDPVHLS------LGVEQL-GMSA 122

Query: 168 NDFDTCLNDQNILDDIK---AGKKRASEDFAIDSTPVFFIGGNLYLG 211
           ++ D     Q   D ++    G  R+     +D+TP  F+ G+ + G
Sbjct: 123 DEIDAEAGQQAHGDRVRRDFVGGIRS----GVDATPTLFVNGSRHDG 165


>gi|121605311|ref|YP_982640.1| DSBA oxidoreductase [Polaromonas naphthalenivorans CJ2]
 gi|120594280|gb|ABM37719.1| DSBA oxidoreductase [Polaromonas naphthalenivorans CJ2]
          Length = 182

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 71/171 (41%), Gaps = 20/171 (11%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH---NKTFKYLEDKYIKTGKLRYILREF 108
           P    D   G   APVT++EY    C  C + H   N    +  D      +LR++ R F
Sbjct: 13  PDEATDAIRGPAGAPVTLIEYGDFECPSCVQAHGALNILLAHFGD------QLRFVFRHF 66

Query: 109 PLDSVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD-ALLNMAKFAGFS 166
           PL  +     +        R  G +W    LLF       +S++ ++  LL+ A+  G  
Sbjct: 67  PLREIHPHAEMAAEAAEAARAQGKFWPMYDLLFT------HSQHLKEKHLLDYARQVGLD 120

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
              +   +ND   L  ++    + +    + STP F++ G   L D+S G+
Sbjct: 121 IARYQNEMNDHVYLQRVQE-HIQGARHLGVRSTPAFYVNG--VLTDVSFGL 168


>gi|116623613|ref|YP_825769.1| twin-arginine translocation pathway signal [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116226775|gb|ABJ85484.1| twin-arginine translocation pathway signal [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 210

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 67/160 (41%), Gaps = 7/160 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +AASP   K+ ++G  +AP+    Y+   C HC   H      +   Y+K+GK   I RE
Sbjct: 27  IAASPDVDKNKTMGNPNAPLMFELYSDFMCPHCKVMHETILPSIVQDYVKSGKAYLIFRE 86

Query: 108 FPL---DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
           FPL     V + A      A  R+ G Y      LF  Q+ W  +    +A+  +     
Sbjct: 87  FPLQIPQHVYSRAAAALAVAAGRV-GKYQAVNDALFKTQNSWGQTGRLWEAVAPV--LTP 143

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
             +       ND ++L +++    R  +   ++ TP   I
Sbjct: 144 DEQKKVQALANDPSVLAEVQGDVDRGMKA-QVNETPTLMI 182


>gi|94987150|ref|YP_595083.1| protein-disulfide isomerase [Lawsonia intracellularis PHE/MN1-00]
 gi|94731399|emb|CAJ54762.1| Protein-disulfide isomerase [Lawsonia intracellularis PHE/MN1-00]
          Length = 275

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 79/171 (46%), Gaps = 8/171 (4%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTVAV 118
           G   APVT+V ++  TC +C++  +KT + +   Y     ++YI + FPL   ++S  A 
Sbjct: 103 GNPKAPVTIVAFSDFTCLYCSQA-SKTVQQMLIDY--KDNVKYIFKHFPLKGHTISQQAA 159

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           +    A  + +   W    LLF K+D+ +  +N    L    K  G       + LN   
Sbjct: 160 IYFIAASFQSNEKAWALYDLLFQKRDELL--QNGEQTLKQAVKEVGLDIKKLMSDLNKAE 217

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           + + +    K A++   I  TP F +   +  G +   +F++ I+  ++++
Sbjct: 218 VNNILGQDIKDAAQ-LDISGTPYFIVNNLILRGALPPELFTEAINMALKNT 267


>gi|317123225|ref|YP_004097337.1| sodium/proton antiporter, NhaA family [Intrasporangium calvum DSM
           43043]
 gi|315587313|gb|ADU46610.1| sodium/proton antiporter, NhaA family [Intrasporangium calvum DSM
           43043]
          Length = 627

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 71/180 (39%), Gaps = 16/180 (8%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D   G   AP+T+VEYA   C  C      T    E +      LRY++R  PL  V  
Sbjct: 451 RDHVRGSVTAPLTLVEYADFECPFCG---RATGVVAEVRAHFGADLRYVMRHLPLPDVHP 507

Query: 116 VAVMLARCAEKR-MDGGYWGFVSLLFNKQDDWINS--KNYRDAL-LNMAKFAGFSKNDFD 171
            A + A   E     G +W    LLF  Q          Y   L L++ +F      D D
Sbjct: 508 HAELAALAVESAGAQGRFWEMHDLLFEHQGQLETEDLAGYASELGLDVERF----LRDLD 563

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
             ++   I +D+     R++E      TP FF+G   ++G          +++  +D  R
Sbjct: 564 DEVHSDRIREDV-----RSAEASGARGTPTFFVGDQRHVGPYDAQTLIAELEASRRDPAR 618


>gi|294084569|ref|YP_003551327.1| DSBA oxidoreductase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664142|gb|ADE39243.1| DSBA oxidoreductase [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 262

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 90/235 (38%), Gaps = 27/235 (11%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTM---KDV 58
           V+ TT I  LG    +F    F Y+         P P+      A+ A++   +      
Sbjct: 44  VIITTIIAALG----MFAVGAFLYS---------PTPEKTATATAMPASNEVPLIRPHSP 90

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
            IG  DAPVT+VE+    C  C  FH    K +  K+   GK+R +LR       S  A+
Sbjct: 91  VIGSSDAPVTIVEFFDPACESCRAFH-PIVKEILSKF--QGKVRVVLRYAAFHPPSEEAI 147

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
            +   A  R+ G +   +  L   Q  W        ++  + K  G    D +    D  
Sbjct: 148 RVLETA--RIQGKFEAVLERLLETQPKWAPHGREPVSIWELIKETGI---DVERARRDAK 202

Query: 179 ILDDIKAGKKRAS--EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +   +    + A+  +   I  TP FF+ G   L +        ++ S ++ S R
Sbjct: 203 LPGIVAVLNQDAADVKTVGIRGTPTFFVNGK-PLPEFGAQQLHDLVKSEVELSER 256


>gi|229137346|ref|ZP_04265960.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST26]
 gi|228646118|gb|EEL02338.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST26]
          Length = 210

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K      + F 
Sbjct: 101 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVDQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 157 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 192


>gi|303246398|ref|ZP_07332677.1| DSBA oxidoreductase [Desulfovibrio fructosovorans JJ]
 gi|302492108|gb|EFL51983.1| DSBA oxidoreductase [Desulfovibrio fructosovorans JJ]
          Length = 260

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 65/154 (42%), Gaps = 6/154 (3%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
            S+G  +APVT+VEY+   C  CA+  N T K L  K+     +R + + F        A
Sbjct: 88  ASLGPANAPVTIVEYSDFLCHFCAQ-ANGTVKALLKKH--PDDVRLVFKHFATGKNDARA 144

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            +       +     W F+   F  Q+   N  +  +AL  MAK  G   N     L  +
Sbjct: 145 ALYFEAINLQDPKKAWAFMDKAFADQEAVANKGD--EALSAMAKELGVDMNRLAKDLTRK 202

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           ++ + IKA  K A   F    TP+F I G    G
Sbjct: 203 DLAERIKADVKEA-RGFGFAGTPIFLINGAAVRG 235


>gi|294499922|ref|YP_003563622.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium QM B1551]
 gi|294349859|gb|ADE70188.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium QM B1551]
          Length = 235

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 16/181 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +G++ APV +VE+    C  C  F    F  ++  Y+ TGK+++    +  +++ S+ A 
Sbjct: 61  LGKESAPVEVVEFGDYKCPACKNFTESFFPLIQKDYVDTGKVKFYFMNYAFINNDSSRAA 120

Query: 119 MLARCAEKRM-DGGYWGFVSLLFNKQD------DWINSKNYRDALLNMAKFAGFSKNDFD 171
             A    K + +  +W F  LL+ KQ+      D +      D L  ++  A   K    
Sbjct: 121 EFAETVYKELGNDTFWKFHELLYKKQNAADEKKDVLTESYLEDTLKEVSSDADAKK--VA 178

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +   D    D      K A+ D  I  TP  ++GG  +     EG      D M++D+ +
Sbjct: 179 SAFKDGKGKDAFDQDMKTAN-DLGITGTPTIYVGGKKF-----EGKTIDDFDQMVKDAAK 232

Query: 232 R 232
            
Sbjct: 233 E 233


>gi|206974164|ref|ZP_03235081.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217958079|ref|YP_002336623.1| hypothetical protein BCAH187_A0618 [Bacillus cereus AH187]
 gi|206747404|gb|EDZ58794.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217064517|gb|ACJ78767.1| conserved hypothetical protein [Bacillus cereus AH187]
          Length = 216

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K      + F 
Sbjct: 107 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVDQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 163 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 198


>gi|115379912|ref|ZP_01466971.1| disulfide interchange protein [Stigmatella aurantiaca DW4/3-1]
 gi|115363088|gb|EAU62264.1| disulfide interchange protein [Stigmatella aurantiaca DW4/3-1]
          Length = 203

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 72/172 (41%), Gaps = 15/172 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT--GKLRYILREFPLDSVSTV 116
           S G  DAP+T+VE++   C  C+    K  + + D+ +KT  GK++ + R FPL      
Sbjct: 41  SKGPADAPITIVEFSDFQCPFCS----KAIQNV-DEVMKTYEGKVKLVFRHFPLSFHGDA 95

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLN 175
                  A  +    +W F   LF  Q      +N + D L   A   G     F+ CL 
Sbjct: 96  PKAAEAAACAQDQNKFWEFHDKLFASQ------QNLKVDDLKKYATELGLDSARFNECL- 148

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           D N   ++        E   +  TP FFI G    G +    F  IID+ ++
Sbjct: 149 DSNKKAELVKKDMADGEKVGVTGTPAFFINGVALSGAVPASEFKTIIDAELK 200


>gi|42779678|ref|NP_976925.1| hypothetical protein BCE_0598 [Bacillus cereus ATCC 10987]
 gi|42735595|gb|AAS39533.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
          Length = 217

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 48  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 107

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K      + F 
Sbjct: 108 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVDQFK 163

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 164 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 199


>gi|163938469|ref|YP_001643353.1| DSBA oxidoreductase [Bacillus weihenstephanensis KBAB4]
 gi|163860666|gb|ABY41725.1| DSBA oxidoreductase [Bacillus weihenstephanensis KBAB4]
          Length = 217

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 48  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 107

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K    +   F 
Sbjct: 108 AAAGEAIYKQDQDSFWIFYDEIYQNQKKDTEEWIT----EELLLNIVKEKLPKINVEQFK 163

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + + D ++    RA +   +   P  +I GNL
Sbjct: 164 KDLHSKEMKDKVRKDSDRAQK-LKVQGAPSVYINGNL 199


>gi|229028336|ref|ZP_04184466.1| disulfide bond formation protein D [Bacillus cereus AH1271]
 gi|228732980|gb|EEL83832.1| disulfide bond formation protein D [Bacillus cereus AH1271]
          Length = 218

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 49  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 108

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K    +   F 
Sbjct: 109 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVNVEQFK 164

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 165 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 200


>gi|229021177|ref|ZP_04177820.1| disulfide bond formation protein D [Bacillus cereus AH1273]
 gi|229022082|ref|ZP_04178636.1| disulfide bond formation protein D [Bacillus cereus AH1272]
 gi|228739234|gb|EEL89676.1| disulfide bond formation protein D [Bacillus cereus AH1272]
 gi|228740137|gb|EEL90491.1| disulfide bond formation protein D [Bacillus cereus AH1273]
          Length = 210

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K    +   F 
Sbjct: 101 AAAGEAIYKQDQDSFWIFYDEIYQNQKKDTEEWIT----EELLLNIVKEKLPKINVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + + D ++    RA +   +   P  +I GNL
Sbjct: 157 KDLHSKEMKDKVRKDSDRAQK-LKVQGAPSVYINGNL 192


>gi|310822965|ref|YP_003955323.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396037|gb|ADO73496.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 361

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 68/171 (39%), Gaps = 13/171 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT--GKLRYILREFPLDSVSTV 116
           S G  DAP+T+VE++   C  C++          D+ +KT  GK++ + R FPL      
Sbjct: 199 SKGPADAPITIVEFSDFQCPFCSKAIQNV-----DEVMKTYEGKVKLVFRHFPLSFHGDA 253

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
                  A  +    +W F   LF  Q +        D L   A   G     F+ CL D
Sbjct: 254 PKAAEAAACAQDQNKFWEFHDKLFASQQNL-----KVDDLKKYATELGLDSARFNECL-D 307

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            N   ++        E   +  TP FFI G    G +    F  IID+ ++
Sbjct: 308 SNKKAELVKKDMADGEKVGVTGTPAFFINGVALSGAVPASEFKTIIDAELK 358


>gi|229182875|ref|ZP_04310110.1| disulfide bond formation protein D [Bacillus cereus BGSC 6E1]
 gi|228600611|gb|EEK58196.1| disulfide bond formation protein D [Bacillus cereus BGSC 6E1]
          Length = 210

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 101 AAAGEAIYKQDQDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 157 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 192


>gi|118476232|ref|YP_893383.1| thiol-disulfide oxidoreductase [Bacillus thuringiensis str. Al
           Hakam]
 gi|118415457|gb|ABK83876.1| thiol-disulfide oxidoreductase [Bacillus thuringiensis str. Al
           Hakam]
          Length = 218

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 49  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 108

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 109 AAAGEAIYKQDQDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVEQFK 164

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 165 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 200


>gi|94967189|ref|YP_589237.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
 gi|94549239|gb|ABF39163.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
          Length = 313

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 77/184 (41%), Gaps = 22/184 (11%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV---STVA 117
           G KDA VT+V Y    C  CA  H++    L+ +Y    K+R I +++PL  +   +  A
Sbjct: 126 GNKDAKVTIVNYDDFECPFCARMHSELVNVLK-QY--GDKVRIIYKDYPLTEIHPWADRA 182

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-----------LNMAKFAGFS 166
            + + C   +    YW F   + + Q      K    ++           L++ +    +
Sbjct: 183 AVDSNCIASQNTDAYWDFADYVHSNQPAITGKKEEHRSVAAMQEAVDKVTLDIGRKHSLN 242

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAID--STPVFFIGGNLYLGDMSEGVFSKIIDS 224
            +    C+ +Q+   +  A KK  SE   +D  +TP  F+ G    G + E     +I  
Sbjct: 243 VDQLQACIKNQS---ESAALKKSVSEANGLDVSATPTMFVNGEKLEGAIEEDALIDVIKK 299

Query: 225 MIQD 228
            +Q+
Sbjct: 300 HLQE 303


>gi|297572314|ref|YP_003698088.1| DSBA oxidoreductase [Arcanobacterium haemolyticum DSM 20595]
 gi|296932661|gb|ADH93469.1| DSBA oxidoreductase [Arcanobacterium haemolyticum DSM 20595]
          Length = 251

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 71/170 (41%), Gaps = 10/170 (5%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DAPV +  Y+   C HC ++  +T   L+D +I +GK+R      P+    +V +
Sbjct: 85  ALGNVDAPVIIEMYSDYRCGHCRQWSLETLPKLQD-FIDSGKIRIEYNSMPVLGDESVLI 143

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQ 177
             A  A   +   +W +   LF       N+   + +AL  +A   G     F   L D 
Sbjct: 144 AQASHA-AALQNQFWEYHHELF------ANAPEAKPEALTELAGKIGMDTEKFAADLKDP 196

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             +  +   + R +    I  TP F IG +   G      F  II+  +Q
Sbjct: 197 ETVKAVDTERSRGT-SLGITGTPAFLIGYSFVPGAYPADQFIGIINQELQ 245


>gi|153006605|ref|YP_001380930.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
 gi|152030178|gb|ABS27946.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
          Length = 307

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 77/174 (44%), Gaps = 15/174 (8%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D RA LA S     + ++G + APV +VEY+  TC +C  F  +   ++E+     G+++
Sbjct: 126 DRRAKLATSGF---EPALGDEAAPVAIVEYSDFTCPYCRAFRPQLEAFVEE---HAGRVK 179

Query: 103 YILREFPLDSVSTVAVMLARCAE-KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
              + FP++S    A+  A+  E  R  G +W     LF  +          D L + A 
Sbjct: 180 LYFKPFPIES-HEHALEAAQAVEWAREKGFFWQMHDRLFESEGALAV-----DDLADHAS 233

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             G    D    L D      I+A +  A  D  +  TP  F+ G L L D+SE
Sbjct: 234 SLGGDAEDLRAALADGRYRARIQASQVEA-RDAGLRGTPTLFMNGRL-LTDLSE 285


>gi|196046835|ref|ZP_03114057.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|196022370|gb|EDX61055.1| conserved hypothetical protein [Bacillus cereus 03BB108]
          Length = 216

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 107 AAAGEAIYKQDQDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVEQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 163 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 198


>gi|229009968|ref|ZP_04167185.1| disulfide bond formation protein D [Bacillus mycoides DSM 2048]
 gi|229056319|ref|ZP_04195737.1| disulfide bond formation protein D [Bacillus cereus AH603]
 gi|229131478|ref|ZP_04260371.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST196]
 gi|228651978|gb|EEL07922.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST196]
 gi|228720987|gb|EEL72529.1| disulfide bond formation protein D [Bacillus cereus AH603]
 gi|228751306|gb|EEM01115.1| disulfide bond formation protein D [Bacillus mycoides DSM 2048]
          Length = 210

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K    +   F 
Sbjct: 101 AAAGEAIYKQDQDSFWIFYDEIYQNQKKDTEEWIT----EELLLNIVKEKLPKINVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + + D ++    RA +   +   P  +I GNL
Sbjct: 157 KDLHSKEMKDKVRKDSDRAQK-LKVQGAPSVYINGNL 192


>gi|206602211|gb|EDZ38693.1| Probable oxidoreductase [Leptospirillum sp. Group II '5-way CG']
          Length = 254

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 71/168 (42%), Gaps = 8/168 (4%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV---ST 115
           S G+      ++E+    C  C +++       E K ++   +R+     PL ++   + 
Sbjct: 87  SSGKPSNTALVIEFGDDQCPVCRKWNQNE----EQKVLQDPSIRFTYIPMPLVTIHQNAL 142

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQD-DWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
            A M   CA +     +W    LL  + +   ++ K+    L  +A          + C+
Sbjct: 143 KAAMFEMCAYQIRPSSFWTIHDLLNRRVELGSVDEKDLDGVLNGLASSQALPATKMNQCM 202

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           ++Q+ L DI+      +E   I +TP F +GG +  G ++ G   K++
Sbjct: 203 SEQSPLPDIETADNTLTEKTGIPTTPTFIVGGQVKTGYLTYGEIKKLL 250


>gi|225862522|ref|YP_002747900.1| hypothetical protein BCA_0581 [Bacillus cereus 03BB102]
 gi|225788028|gb|ACO28245.1| conserved hypothetical protein [Bacillus cereus 03BB102]
          Length = 217

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 48  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 107

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 108 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVEQFK 163

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 164 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 199


>gi|120401682|ref|YP_951511.1| Na+/H+ antiporter NhaA [Mycobacterium vanbaalenii PYR-1]
 gi|189029136|sp|A1T2V5|NHAA1_MYCVP RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|119954500|gb|ABM11505.1| sodium/proton antiporter, NhaA family [Mycobacterium vanbaalenii
           PYR-1]
          Length = 617

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 82/206 (39%), Gaps = 15/206 (7%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           RIGVL   VL F+  +  +      + +   P   V  + L    P   +D   G+ DAP
Sbjct: 410 RIGVLAASVLAFVFGWAIFR-----ITDWLSPPEPVGLKLLRPVEPD--RDHVRGRYDAP 462

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV-MLARCAE 125
           + +VEY    C  C+     T    E +      L Y+ R FPL+     A         
Sbjct: 463 LVLVEYGDFECPFCS---RATGAIDEVRAHFGDDLLYVWRHFPLERAHPRAFDAARASEA 519

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
             + G +W     LF+ QDD   S  YR A   +A      + D D  ++   +L  +  
Sbjct: 520 AALQGKFWEMAHELFDHQDDLEWSDMYRYA---VAAGCDIEQFDQDVRVHSSKVLHRVTD 576

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLG 211
             + A E   +++TP  F+ G  + G
Sbjct: 577 DAEDA-EAMDLNATPTLFVNGIRHKG 601


>gi|229194859|ref|ZP_04321643.1| disulfide bond formation protein D [Bacillus cereus m1293]
 gi|228588615|gb|EEK46649.1| disulfide bond formation protein D [Bacillus cereus m1293]
          Length = 197

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 28  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 87

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K      + F 
Sbjct: 88  AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVDQFK 143

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 144 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 179


>gi|326772908|ref|ZP_08232192.1| DSBA oxidoreductase [Actinomyces viscosus C505]
 gi|326637540|gb|EGE38442.1| DSBA oxidoreductase [Actinomyces viscosus C505]
          Length = 315

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 64/153 (41%), Gaps = 9/153 (5%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVM 119
           G+ DAPV MV Y+   C  C +F       L +K +K G LR   R+   +   S +   
Sbjct: 124 GKVDAPVVMVIYSDFACPFCTQFAQNVEPEL-NKLVKEGTLRIEWRDLAQISETSPLTAQ 182

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
             R A K+  G +W F   ++   D   +     D+L++ AK AG +  D      D   
Sbjct: 183 AGRAAAKQ--GKFWEFHDAVYAAADPKGHPAYTEDSLVDFAKKAGVA--DLSKFRTDMTA 238

Query: 180 LDDIKAGKKRAS--EDFAIDSTPVFFIGGNLYL 210
            + +KA  +         I  TP F I G  Y+
Sbjct: 239 AETVKAVSESTQHVHSIGIQGTP-FMIVGETYI 270


>gi|222094295|ref|YP_002528354.1| thiol-disulfide oxidoreductase (disulfide bond formation protein d)
           (disulfideoxidoreductase d) [Bacillus cereus Q1]
 gi|221238352|gb|ACM11062.1| probable thiol-disulfide oxidoreductase (disulfide bond formation
           protein D) (disulfideoxidoreductase D) [Bacillus cereus
           Q1]
          Length = 216

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K      + F 
Sbjct: 107 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVDQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 163 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 198


>gi|46206056|ref|ZP_00047759.2| COG1651: Protein-disulfide isomerase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 73

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 35/64 (54%)

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           AGFSK  F+ CL DQ +   I A K R  +   ++STP FFI G  + G +S     K+I
Sbjct: 8   AGFSKEKFEACLKDQKVYSAINAVKTRGLDTLKVESTPTFFINGEKHSGALSIEEMEKVI 67

Query: 223 DSMI 226
             ++
Sbjct: 68  KPLL 71


>gi|301167710|emb|CBW27294.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 351

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 74/169 (43%), Gaps = 11/169 (6%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTVA 117
           +G  DA V ++E++   C  C++        L+ KY    K++ + + FPL   + +  A
Sbjct: 190 MGGADAKVEIIEFSDFQCPFCSKGAG-IINDLKKKY--GNKIKVVFKNFPLPFHNHAKKA 246

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
              A C  ++    +W     +F  Q     +K  R  L+N AK     +  F  CL+  
Sbjct: 247 AEAALCVHEQDKAKFWQMHDAMFADQ-----TKLDRQGLVNSAKSLKIDEAKFTQCLDSG 301

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
                ++A  +   ++  + STP FF+ G +  G      FS++ID  +
Sbjct: 302 KYTAKVEATMEEG-KNVGVKSTPTFFVNGKMINGAHPVETFSELIDQEL 349


>gi|71279308|ref|YP_269413.1| dsbA-like thioredoxin domain-containing protein [Colwellia
           psychrerythraea 34H]
 gi|71145048|gb|AAZ25521.1| dsbA-like thioredoxin domain protein [Colwellia psychrerythraea
           34H]
          Length = 213

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 65/154 (42%), Gaps = 17/154 (11%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S G K A VT+VE+    C  C++F+      L  KY   GK+  ++R  PL   S   V
Sbjct: 48  SKGGKQAKVTIVEFFDPACGTCSQFY-PLINNLVKKY--QGKVNVVMRYAPLHKGSDNVV 104

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSK--NYRDALLNMAKFAGFSKNDFDTCLND 176
            +   A   + G +W  + LLF  Q  W+     N   AL  + K      +  DT    
Sbjct: 105 KMLEAA--HLQGEFWPALELLFANQQRWVEHHVSNPTRALAGI-KTLNVDHDQLDTDWQS 161

Query: 177 QN----ILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            N    I  DIK G     +   + +TP FF+ G
Sbjct: 162 SNIAKIIAQDIKDG-----QTLKVRATPQFFVNG 190


>gi|322369275|ref|ZP_08043840.1| DSBA oxidoreductase [Haladaptatus paucihalophilus DX253]
 gi|320551007|gb|EFW92656.1| DSBA oxidoreductase [Haladaptatus paucihalophilus DX253]
          Length = 258

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 69/141 (48%), Gaps = 12/141 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +G  DA V +  ++   C  C+ F   TF  L + Y++ GK+R+++ E P + S ST A 
Sbjct: 77  LGAPDADVDIYYWSDYQCPFCSRFEQDTFPKLVENYLRPGKIRFVVLELPNIGSASTTAS 136

Query: 119 MLARCAEKRM----DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA-GFSKNDFDTC 173
            +A+C  +++       +  + S +F++Q    +    ++ LL++ +   G      ++C
Sbjct: 137 RMAKCVWRQVRDDSPAAFKRWHSTMFDEQGKPNSGWASKENLLDITRTVDGVDAKAVESC 196

Query: 174 LNDQ------NILDDIKAGKK 188
           L +       +I DD+ A  +
Sbjct: 197 LGENGASLQSSIDDDVNAATR 217


>gi|240169146|ref|ZP_04747805.1| DSBA oxidoreductase [Mycobacterium kansasii ATCC 12478]
          Length = 260

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 69/176 (39%), Gaps = 2/176 (1%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           A  PS    ++ G   APV + E+    C  C  F   +   L   Y++TGK+R+   + 
Sbjct: 81  AHQPSEGDALARGSVSAPVVVAEWGDFQCPFCRAFDLDSQPVLIGDYVQTGKVRFEWHDL 140

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
                 +V +           G +W F    +  Q    +      +L+ MA+ AG   +
Sbjct: 141 AKLGPESV-LAARGARAAARQGAFWAFHDAFYRDQAPENSGAVTEQSLMAMARNAGLDVD 199

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            F   L D  I D ++  +  A +   I   P F +   L +G  S     ++ID+
Sbjct: 200 RFVADLADPAIADAVERDRSDARQ-LGITHVPSFLVNDELLIGAQSLDTLRRVIDA 254


>gi|295705305|ref|YP_003598380.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium DSM 319]
 gi|294802964|gb|ADF40030.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium DSM 319]
          Length = 235

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 78/181 (43%), Gaps = 16/181 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +G++ APV +VE+    C  C  F    F  ++  Y+ TGK+++    +  +++ S+ A 
Sbjct: 61  LGKESAPVEVVEFGDYKCPACKNFTESFFPLIQKDYVDTGKVKFYFMNYAFINNDSSRAA 120

Query: 119 MLARCAEKRM-DGGYWGFVSLLFNKQD------DWINSKNYRDALLNMAKFAGFSKNDFD 171
             A    K + +  +W F  LL+ KQ+      D +      D L  +++ A   K    
Sbjct: 121 EFAETVYKELGNDTFWKFHELLYKKQNAADEKKDVLTESYLEDTLKEVSRDADAKK--VA 178

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +   D    D      K A+ +  I  TP  ++GG  +     EG      D M++D+ +
Sbjct: 179 SAFKDGKGKDAFDQDMKTAN-NLGITGTPTIYVGGKKF-----EGKTIDDFDQMVKDAAK 232

Query: 232 R 232
            
Sbjct: 233 E 233


>gi|228944297|ref|ZP_04106671.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228815377|gb|EEM61624.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 210

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPQLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 101 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKIDVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|167951035|ref|ZP_02538109.1| DSBA oxidoreductase [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 200

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 62/137 (45%), Gaps = 10/137 (7%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           S  +D   G  +AP+++VEY+   C  C  FH    K +E      GK+ ++ R FPL+ 
Sbjct: 44  SAERDHIYGDPNAPISLVEYSDFECPFCKRFHPTVKKLIEQ---NAGKVNWVYRHFPLEF 100

Query: 113 VSTVAVMLARCAEKRMDGG----YWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSK 167
            +  A   A   E   + G    +W +  L++ +     N + +  D L+ +A+  G   
Sbjct: 101 HNPGAQKEAEATECASELGGNDAFWRYSDLIYQRTTS--NGRGFPIDRLVPLAEEIGLDG 158

Query: 168 NDFDTCLNDQNILDDIK 184
             F  CL+   + D ++
Sbjct: 159 KRFRDCLDSGRMADRVR 175


>gi|257069593|ref|YP_003155848.1| protein-disulfide isomerase [Brachybacterium faecium DSM 4810]
 gi|256560411|gb|ACU86258.1| protein-disulfide isomerase [Brachybacterium faecium DSM 4810]
          Length = 282

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 74/169 (43%), Gaps = 3/169 (1%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPV ++ +    C +CAE+  +T   +  +Y++ G+LR   R+  +    +     
Sbjct: 115 GPVDAPVVLIVFTDYQCPYCAEWSQETLPAVR-EYVERGELRIEWRDVNIYGDDSERAAR 173

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A  A  R D  +  +   LF   +    ++    +L+ +A   G     F   L+ + + 
Sbjct: 174 ASLAAARQDA-HAEYHDRLFEGGEIRTGAELDESSLVALADELGLDTEQFTEDLHSEEVA 232

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           + I A   +   D  I STP F +GG   +G     VF+  ID  + +S
Sbjct: 233 ETISANASQGW-DLGIMSTPAFVVGGTPMVGAQPTDVFTTAIDDALAES 280


>gi|49481661|ref|YP_034804.1| thiol-disulfide oxidoreductase (disulfide bond formation protein D)
           (disulfideoxidoreductase D) [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|49333217|gb|AAT63863.1| probable thiol-disulfide oxidoreductase (disulfide bond formation
           protein D) (disulfideoxidoreductase D) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
          Length = 219

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 50  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 110 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKIDVEQFK 165

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 166 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 201


>gi|49183539|ref|YP_026791.1| hypothetical protein BAS0513 [Bacillus anthracis str. Sterne]
 gi|49177466|gb|AAT52842.1| conserved hypothetical protein [Bacillus anthracis str. Sterne]
          Length = 219

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 50  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 110 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKIDVEQFK 165

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 166 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 201


>gi|196034723|ref|ZP_03102131.1| conserved hypothetical protein [Bacillus cereus W]
 gi|195992766|gb|EDX56726.1| conserved hypothetical protein [Bacillus cereus W]
          Length = 217

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 48  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPQLKEEYIDKGKVQLYFINFPFIGKDSDLG 107

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 108 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKIDVEQFK 163

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 164 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 199


>gi|218901684|ref|YP_002449518.1| hypothetical protein BCAH820_0544 [Bacillus cereus AH820]
 gi|218538254|gb|ACK90652.1| conserved hypothetical protein [Bacillus cereus AH820]
          Length = 217

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 48  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIAKGKVQLYFINFPFIGKDSDLG 107

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 108 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKIDVEQFK 163

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 164 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 199


>gi|85374545|ref|YP_458607.1| protein-disulfide isomerase [Erythrobacter litoralis HTCC2594]
 gi|84787628|gb|ABC63810.1| protein-disulfide isomerase [Erythrobacter litoralis HTCC2594]
          Length = 225

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 67/171 (39%), Gaps = 26/171 (15%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  +A  T+ E+ S TC  C  F  +  + ++  Y+  GK R  +R    + V   A +
Sbjct: 39  VGNPEAEGTLTEFVSYTCPACGNFARQGEEVVKLGYVGPGKARLEIRHVQRNVVDIAATL 98

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWI------------------NSKNYRD-----AL 156
           LA C  K     +    S L  +QD W+                   +  Y+      +L
Sbjct: 99  LAWCGPKEK---FLQNHSALMWQQDKWLTKAQQATQGQQQRWFSGAEAARYKAIANDLSL 155

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
             + +  G+ +   D CL+D  +    +      +E F + +TP F I G 
Sbjct: 156 YELFEGRGYDRPQLDRCLSDTALAAKFRESTVADAETFGVRATPSFAIDGE 206


>gi|299136376|ref|ZP_07029560.1| putative lipoprotein [Acidobacterium sp. MP5ACTX8]
 gi|298602500|gb|EFI58654.1| putative lipoprotein [Acidobacterium sp. MP5ACTX8]
          Length = 337

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 70/183 (38%), Gaps = 22/183 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   APV +V +  + C  CA  H   F  + ++Y    K+R + ++FPLD++   A   
Sbjct: 135 GPVTAPVLIVGFDDLECPFCARLHESIFPAMINRY--GDKVRIVYKDFPLDTIHPWAEHA 192

Query: 121 A---RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA--------------KFA 163
           A    C   +   GYW  V  +     D   S + +D    +A              K  
Sbjct: 193 AVDVNCIGAQSPVGYWNLVDGIHAHASDIGTSDDPKDTQKTLANATVQLDKLTREQGKLQ 252

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-EGVFSKII 222
                  D CL  Q+    + A K        ++  P  FI G+   G +  E +F  I 
Sbjct: 253 KVDAAKLDACLAKQDTA-SVDASKA-VGVSLGLEEAPTLFINGDKVSGALPVEFIFGIID 310

Query: 223 DSM 225
           D++
Sbjct: 311 DAL 313


>gi|308273611|emb|CBX30213.1| hypothetical protein N47_D30220 [uncultured Desulfobacterium sp.]
          Length = 372

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 93/231 (40%), Gaps = 50/231 (21%)

Query: 15  VLLFIASYFFYTRKGSALNELP----IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           ++LF++ Y FY    + L   P    +P+G+ +        P        G ++  + + 
Sbjct: 170 IILFVSVYTFYPVYWN-LTPPPLSANVPNGITE-----DGHPWIG-----GSQNPELVIT 218

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV------------ 118
           EY    CF C + H    + +E       K+R I R +P+D+     V            
Sbjct: 219 EYTDYLCFQCKKMHFFLRQIVEKN---PEKIRLIHRHYPMDNKYNPLVKEPFHIGSGNMA 275

Query: 119 MLARCAEKRMDGGYWGFVSLLFN--KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           +L+  AE +  G +W     LF+  K+D  IN K        +A+  G    +  T   D
Sbjct: 276 ILSIYAESK--GKFWEMNDALFDIDKKDKSINIKK-------LAEKTGLDSKELATARYD 326

Query: 177 QNILD----DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
             I      DIK G K       I  TP + I G LYLG++   +  KII+
Sbjct: 327 NKIRHALWLDIKDGLK-----LGITGTPAYVINGKLYLGEIPADILKKIIE 372


>gi|65317963|ref|ZP_00390922.1| COG1651: Protein-disulfide isomerase [Bacillus anthracis str.
           A2012]
 gi|165871788|ref|ZP_02216432.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|228925732|ref|ZP_04088817.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229089606|ref|ZP_04220869.1| disulfide bond formation protein D [Bacillus cereus Rock3-42]
 gi|229120140|ref|ZP_04249391.1| disulfide bond formation protein D [Bacillus cereus 95/8201]
 gi|164712513|gb|EDR18046.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|228663181|gb|EEL18770.1| disulfide bond formation protein D [Bacillus cereus 95/8201]
 gi|228693724|gb|EEL47424.1| disulfide bond formation protein D [Bacillus cereus Rock3-42]
 gi|228833925|gb|EEM79477.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 210

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 101 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKIDVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|30260702|ref|NP_843079.1| hypothetical protein BA_0544 [Bacillus anthracis str. Ames]
 gi|47525817|ref|YP_017166.1| hypothetical protein GBAA_0544 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|167635698|ref|ZP_02394009.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|167640666|ref|ZP_02398927.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170688485|ref|ZP_02879692.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|170708195|ref|ZP_02898641.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|177653756|ref|ZP_02935857.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190568219|ref|ZP_03021128.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196041354|ref|ZP_03108648.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|227816584|ref|YP_002816593.1| hypothetical protein BAMEG_4042 [Bacillus anthracis str. CDC 684]
 gi|229600248|ref|YP_002865147.1| hypothetical protein BAA_0625 [Bacillus anthracis str. A0248]
 gi|254684378|ref|ZP_05148238.1| hypothetical protein BantC_11017 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254722179|ref|ZP_05183968.1| hypothetical protein BantA1_06902 [Bacillus anthracis str. A1055]
 gi|254738842|ref|ZP_05196545.1| hypothetical protein BantWNA_27074 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254743773|ref|ZP_05201457.1| hypothetical protein BantKB_22659 [Bacillus anthracis str. Kruger
           B]
 gi|254755066|ref|ZP_05207100.1| hypothetical protein BantV_21532 [Bacillus anthracis str. Vollum]
 gi|254762200|ref|ZP_05214044.1| hypothetical protein BantA9_27277 [Bacillus anthracis str.
           Australia 94]
 gi|34921575|sp|Q81YT8|BDBD_BACAN RecName: Full=Probable disulfide bond formation protein D; AltName:
           Full=Disulfide oxidoreductase D; AltName:
           Full=Thiol-disulfide oxidoreductase D; Flags: Precursor
 gi|30254070|gb|AAP24565.1| conserved hypothetical protein [Bacillus anthracis str. Ames]
 gi|47500965|gb|AAT29641.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|167511381|gb|EDR86766.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|167528957|gb|EDR91713.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|170126851|gb|EDS95732.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|170667510|gb|EDT18266.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|172081148|gb|EDT66224.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190560711|gb|EDV14687.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196027839|gb|EDX66452.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|227003673|gb|ACP13416.1| conserved hypothetical protein [Bacillus anthracis str. CDC 684]
 gi|229264656|gb|ACQ46293.1| conserved hypothetical protein [Bacillus anthracis str. A0248]
          Length = 217

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 48  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 107

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 108 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKIDVEQFK 163

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 164 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 199


>gi|289705291|ref|ZP_06501690.1| Na+/H+ antiporter NhaA [Micrococcus luteus SK58]
 gi|289558041|gb|EFD51333.1| Na+/H+ antiporter NhaA [Micrococcus luteus SK58]
          Length = 614

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 78/172 (45%), Gaps = 17/172 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +DA +T+VEY    C +CA     +++ L  ++     LRY++R+ P      +A   
Sbjct: 450 GPEDAQLTLVEYIDFECPYCAH-ATGSWEDLRSRF--GDDLRYVVRQLPHHPHGPIA--- 503

Query: 121 ARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           AR +E   + G +W ++  +F +QD        R+ L+  A+  G     F   L+   +
Sbjct: 504 ARASEAASNQGMFWPWLDFVFTRQD-----ALEREDLIRYAEELGLDVAQFTADLDSAAV 558

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
              ++   + A    A  +TP FF+ G   LG       ++ + S ++ S R
Sbjct: 559 RARVERDLESADASGA-HATPTFFVDGRRLLGSYD----ARTLTSTLEASRR 605


>gi|145220843|ref|YP_001131521.1| Na+/H+ antiporter NhaA [Mycobacterium gilvum PYR-GCK]
 gi|189029133|sp|A4T134|NHAA1_MYCGI RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|145213329|gb|ABP42733.1| sodium/proton antiporter, NhaA family [Mycobacterium gilvum
           PYR-GCK]
          Length = 617

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 82/207 (39%), Gaps = 17/207 (8%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           RIGVL   VL F   +  +      + +   P   V  + L    P   +D   G+ DAP
Sbjct: 410 RIGVLAASVLAFALGWAIFR-----ITDWLSPPEPVGLKLLRPIDPE--RDHVRGRPDAP 462

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAV-MLARCA 124
           +T+VEY    C  C    ++    +++     G  L Y+ R FPL+     A        
Sbjct: 463 LTLVEYGDFECPFC----SRVTGAIDEVRAHFGDDLLYVWRHFPLERAHPRAFDAARASE 518

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
              + G +W     LF  QDD   S  YR A   +A      + D D  ++   +L  + 
Sbjct: 519 AAALQGRFWEMTHELFTHQDDLEWSDMYRYA---VAAGCDIEQFDQDVRVHSSKVLHRVS 575

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLG 211
                 ++   +++TP  F+ G  + G
Sbjct: 576 D-DAEDADAMDLNATPTLFVNGKRHRG 601


>gi|228983744|ref|ZP_04143941.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229154250|ref|ZP_04282370.1| disulfide bond formation protein D [Bacillus cereus ATCC 4342]
 gi|228629074|gb|EEK85781.1| disulfide bond formation protein D [Bacillus cereus ATCC 4342]
 gi|228775939|gb|EEM24308.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 210

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 101 AAAGEAIYKQDQDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVAQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|282891808|ref|ZP_06300289.1| hypothetical protein pah_c197o132 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498392|gb|EFB40730.1| hypothetical protein pah_c197o132 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 173

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 68/169 (40%), Gaps = 22/169 (13%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG---KLRYILREF 108
           P + +D   GQ++A +T+VEY    C  C         YL  K I+     KLR++ R F
Sbjct: 7   PVSNEDHVQGQQNAEITLVEYGDYQCPFCGH------AYLIIKQIQEHFGLKLRFVFRNF 60

Query: 109 PLDSVSTVAVMLARCAE-KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
           PL  +  +A   A   E    +G +W    L++  Q +        + L+ +A     S 
Sbjct: 61  PLTEIHPLAKPAAELTEYAGSEGKFWKMHDLIYENQANL-----SLERLVELADSLDLSS 115

Query: 168 NDFDTCLN--DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
                  N  DQ I  D   G K       ++ TP  FI  + Y G + 
Sbjct: 116 TKLKDGPNTFDQKIQKDFIGGVKS-----GVNGTPTLFINDDRYAGPVE 159


>gi|229159630|ref|ZP_04287642.1| disulfide bond formation protein D [Bacillus cereus R309803]
 gi|228623834|gb|EEK80648.1| disulfide bond formation protein D [Bacillus cereus R309803]
          Length = 210

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 101 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVEKFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKEITEKVRKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|325282737|ref|YP_004255278.1| hypothetical protein Deipr_0493 [Deinococcus proteolyticus MRP]
 gi|324314546|gb|ADY25661.1| hypothetical protein Deipr_0493 [Deinococcus proteolyticus MRP]
          Length = 237

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 73/182 (40%), Gaps = 17/182 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--------D 111
           +G   APV M+      C  C +F    F  +E++Y+ TGK++     +P         +
Sbjct: 60  VGDASAPVEMIVVEDFKCPACKQFEATVFPKVENEYVSTGKVKVYSVAWPFLAEVAKLDE 119

Query: 112 SVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDD----WINSKNYRDALLNMAKFAGFS 166
             S  A     CA E      +  + ++LF  Q+D    W      ++   N+   +G  
Sbjct: 120 DDSKYAAQAGECAYEHGGAEAFSAYKTILFRAQEDESKVWATKARLKELAANV---SGID 176

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +  F +CL++   L  ++A ++       +  TP  FIGG         G     ID+ +
Sbjct: 177 QTAFASCLDNDETLARVEANEEEVEAS-GVTGTPTVFIGGKKVENPGDYGQLKSAIDAAL 235

Query: 227 QD 228
            +
Sbjct: 236 AN 237


>gi|315442203|ref|YP_004075082.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. Spyr1]
 gi|315260506|gb|ADT97247.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. Spyr1]
          Length = 615

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 82/207 (39%), Gaps = 17/207 (8%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           RIGVL   VL F   +  +      + +   P   V  + L    P   +D   G+ DAP
Sbjct: 408 RIGVLAASVLAFALGWAIFR-----ITDWLSPPEPVGLKLLRPIDPE--RDHVRGRPDAP 460

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAV-MLARCA 124
           +T+VEY    C  C    ++    +++     G  L Y+ R FPL+     A        
Sbjct: 461 LTLVEYGDFECPFC----SRVTGAIDEVRAHFGDDLLYVWRHFPLERAHPRAFDAARASE 516

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
              + G +W     LF  QDD   S  YR A   +A      + D D  ++   +L  + 
Sbjct: 517 AAALQGRFWEMTHELFTHQDDLEWSDMYRYA---VAAGCDIEQFDQDVRVHSSKVLHRVS 573

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLG 211
                 ++   +++TP  F+ G  + G
Sbjct: 574 D-DAEDADAMDLNATPTLFVNGKRHRG 599


>gi|118576454|ref|YP_876197.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
 gi|118194975|gb|ABK77893.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
          Length = 177

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV-STVAV 118
           +G   A +T+VE+    C  C  FH  + + L+ +YI TG ++ + R+FPL+   S +A 
Sbjct: 46  LGDPGAGITIVEWGDYQCTFCFRFHGTSLQALKAEYIDTGDVKLVFRDFPLNGPDSVLAA 105

Query: 119 MLARCAEKRMDGGYWGFVSLLFN 141
             + CA+++  G YW +   ++ 
Sbjct: 106 EASYCAKEQ--GRYWEYHDTVYK 126


>gi|229165482|ref|ZP_04293264.1| disulfide bond formation protein D [Bacillus cereus AH621]
 gi|228617987|gb|EEK75030.1| disulfide bond formation protein D [Bacillus cereus AH621]
          Length = 210

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K    +   F 
Sbjct: 101 AAAGEAIYKQDQDSFWIFYDEIYQNQKKDTEEWIT----EELLLNIVKEKLPKINVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + + + ++    RA +   +   P  +I GNL
Sbjct: 157 KDLHSKEMKEKVRKDSDRAQK-LKVQGAPSVYINGNL 192


>gi|163848572|ref|YP_001636616.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222526507|ref|YP_002570978.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
 gi|163669861|gb|ABY36227.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222450386|gb|ACM54652.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
          Length = 232

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 70/180 (38%), Gaps = 22/180 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +A V ++ +    C  CA F       LE  YI TG++++I  E PL ++   AV  
Sbjct: 66  GDPNAAVKVIAFEDYQCPGCAYFSRNLAPILERDYINTGRVQFIYHELPLTNIHPNAVAA 125

Query: 121 ARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           A  A    D G YW     LF  Q  W    +  +     A   G  +  FD C+     
Sbjct: 126 AEAARCAGDQGKYWEMHDQLFANQSLWAQLSSPLNVFSGYAGRIGIDRAAFDACM----- 180

Query: 180 LDDIKAGKKR--------ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
               +AG  R         +    + +TP F + G +    +  G     ID+ ++ + R
Sbjct: 181 ----QAGTHREAILAAAQEAAALGVQATPSFSVNGQI----VDSGRLFTAIDAALRAAGR 232


>gi|228913229|ref|ZP_04076867.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228846412|gb|EEM91426.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 210

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 101 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVAQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|162451230|ref|YP_001613597.1| putative secreted protein [Sorangium cellulosum 'So ce 56']
 gi|161161812|emb|CAN93117.1| putative secreted protein [Sorangium cellulosum 'So ce 56']
          Length = 675

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 77/187 (41%), Gaps = 21/187 (11%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           AA P + KD   G + APVTMV ++   C  C +    T   L+DKY    KLR I +  
Sbjct: 50  AAVPVSSKDPMWGTRAAPVTMVVFSDFECPFCTKVET-TINQLKDKY-GPEKLRIIWKNN 107

Query: 109 PLDSVSTVAVMLARCAEK--RMDG--GYWGFVSLLFNKQDDWINSKNYR----DALLNMA 160
           PL      A   A  AE   R+ G   +W F  L F  Q   +  +N+     DA ++ A
Sbjct: 108 PL-PFHKNARPAALAAETVFRLGGSKAFWKFHELAFQNQKS-LTPENFEKWAGDAGVDRA 165

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
           KF    K  FD       I  D+  GK        +  TP   I G    G      F+ 
Sbjct: 166 KF----KAAFDRQEYMAKIDADMAVGKSS-----GVTGTPASIINGVFLSGAQPIDKFTS 216

Query: 221 IIDSMIQ 227
           +ID  ++
Sbjct: 217 VIDEQLK 223



 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 68/174 (39%), Gaps = 16/174 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPL---DSVSTV 116
           G   A VT+VE++   C  C    +K    +++     G K+R++ +  PL         
Sbjct: 278 GPATALVTIVEWSDFQCPFC----SKVVPTIDEILTTYGDKVRFVWKNNPLPFHQRAEPA 333

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-LLNMAKFAGFSKNDFDTCLN 175
           A +      ++ + G+W    LL      W N +   D  LL  AK  G         + 
Sbjct: 334 AELAMEARAQKGEKGFWDAYYLL------WKNQQKLNDEDLLGYAKELGLDVEKVKAAIA 387

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            +     I A ++ A +D     TP FFI G   +G      F  IID  I+ S
Sbjct: 388 TKKFGASIAADQELA-DDLQASGTPHFFINGRRLVGAQPIDKFKTIIDEEIKKS 440



 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 70/187 (37%), Gaps = 13/187 (6%)

Query: 52  PSTMKDVSIGQKDAP--------VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
           P   K+VS    ++P        V M  ++   C  C    + T   +   Y    K+ +
Sbjct: 466 PPERKEVSAPAPNSPWKGGERAKVVMQVFSDFECPFCKRVED-TVSQISKTYGDKLKIVW 524

Query: 104 ILREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
             R  P+   + +A   A+ A  ++ + G+W +  +LF  Q         R +L   A+ 
Sbjct: 525 RHRPLPMHKNAPLASEAAQEAYTQKGNAGFWAYHEVLFKNQGQ--PDAFSRASLEKYAEE 582

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G     F   L D N        +   ++   I  TP F + G    G      F K+I
Sbjct: 583 QGLDMTKFKKAL-DANTHKAFVDSENSVADKAGISGTPAFVVNGYFISGAQPFSKFKKLI 641

Query: 223 DSMIQDS 229
           D  ++++
Sbjct: 642 DKAMKEA 648


>gi|324324580|gb|ADY19840.1| putative thiol-disulfide oxidoreductase [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 216

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 107 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVAQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 163 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 198


>gi|296491981|ref|YP_003662448.1| hypothetical protein XNC1_p0171 [Xenorhabdus nematophila ATCC
           19061]
 gi|289176868|emb|CBJ93039.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 278

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 79/165 (47%), Gaps = 13/165 (7%)

Query: 46  ALLAASPSTMKDVS--IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
           A    +P  ++D     G   A  T+VE++ + C +C +FH+ T K + D     G + +
Sbjct: 90  AQFEGAPEKVEDGKHIYGDLGARFTLVEFSDLECPYCKQFHD-TPKQIVD--ASKGNVNW 146

Query: 104 ILREFPLDSVSTVA---VMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
             +  PLD  +  A    + A C AE++ + G+W F++ +F +     N +   D L ++
Sbjct: 147 QWKHMPLDFHNPAAHKEALAAECIAEQKGNRGFWVFINDVFQRSQG--NGRGVED-LASV 203

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
               G   + F  CL+     D ++A  ++A + + ++ TP  F+
Sbjct: 204 VTGVGADLDAFRECLSSGKYEDKVQADIQKA-KSYGVNGTPATFV 247


>gi|301052194|ref|YP_003790405.1| putative thiol-disulfide oxidoreductase [Bacillus anthracis CI]
 gi|300374363|gb|ADK03267.1| putative thiol-disulfide oxidoreductase [Bacillus cereus biovar
           anthracis str. CI]
          Length = 216

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 107 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVAQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 163 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 198


>gi|322382283|ref|ZP_08056193.1| thiol-disulfide oxidoreductase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153785|gb|EFX46156.1| thiol-disulfide oxidoreductase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 228

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 67/150 (44%), Gaps = 4/150 (2%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           IG ++APV +VE+    C  C ++       L+  YI++GK    + ++P L   S +A 
Sbjct: 59  IGNREAPVKIVEFTDYKCPSCKKWTETVLPKLDQDYIQSGKAAVYVLDYPFLGPDSNLAA 118

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK--FAGFSKNDFDTCLND 176
           +      ++    +  +  L+  KQ +  ++   +D LLN+ K    G     F+  L+ 
Sbjct: 119 LAGETLYQQNHEFFETYHKLMMEKQKNEKSNWATKDFLLNLVKEGIPGADLQQFEKDLDA 178

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
              L  +K  K+      AI  TP  ++ G
Sbjct: 179 GTYLQQMKKDKEIGKR-LAIPGTPTIYVNG 207


>gi|228899228|ref|ZP_04063493.1| disulfide bond formation protein D [Bacillus thuringiensis IBL
           4222]
 gi|228937780|ref|ZP_04100411.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228963629|ref|ZP_04124778.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228970661|ref|ZP_04131305.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228977239|ref|ZP_04137636.1| disulfide bond formation protein D [Bacillus thuringiensis Bt407]
 gi|228782458|gb|EEM30639.1| disulfide bond formation protein D [Bacillus thuringiensis Bt407]
 gi|228789054|gb|EEM36989.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796060|gb|EEM43519.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228821886|gb|EEM67883.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228860407|gb|EEN04802.1| disulfide bond formation protein D [Bacillus thuringiensis IBL
           4222]
          Length = 210

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 101 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVDVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKEITEKVRKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|228931971|ref|ZP_04094864.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228827689|gb|EEM73430.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 210

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 101 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKIDVAQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|225873724|ref|YP_002755183.1| putative lipoprotein [Acidobacterium capsulatum ATCC 51196]
 gi|225794080|gb|ACO34170.1| putative lipoprotein [Acidobacterium capsulatum ATCC 51196]
          Length = 317

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 77/180 (42%), Gaps = 19/180 (10%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   A VT+V +  + C  CA  H++ F  + D Y   G ++ I  +FPL  +   A+  
Sbjct: 121 GNPKAKVTIVNFDDLECPFCARMHSELFPDIYDHY--KGLIKVIYVDFPLTELHPWAMHA 178

Query: 121 ---ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-----LLNMAKFAGFSKNDFDT 172
              A C        YW FV  +    +D I+  ++  A     L  +A+  G  ++  DT
Sbjct: 179 AVDANCLADESRTAYWNFVDYVHTHGED-ISGPDHDTAKSFSRLDKIAEGEG-QRDHLDT 236

Query: 173 -----CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                C+  Q+  + +   +  A +   I +TP FF+ G  + G +       +ID  ++
Sbjct: 237 AKLNACVAKQD--ESVVKKEMAAGDKLGISATPTFFVNGVRWSGVLDPAELKMMIDRALR 294


>gi|228919406|ref|ZP_04082773.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228951034|ref|ZP_04113154.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229042398|ref|ZP_04190146.1| disulfide bond formation protein D [Bacillus cereus AH676]
 gi|229068229|ref|ZP_04201534.1| disulfide bond formation protein D [Bacillus cereus F65185]
 gi|229077841|ref|ZP_04210463.1| disulfide bond formation protein D [Bacillus cereus Rock4-2]
 gi|229148882|ref|ZP_04277128.1| disulfide bond formation protein D [Bacillus cereus m1550]
 gi|229177071|ref|ZP_04304463.1| disulfide bond formation protein D [Bacillus cereus 172560W]
 gi|229188748|ref|ZP_04315785.1| disulfide bond formation protein D [Bacillus cereus ATCC 10876]
 gi|228594725|gb|EEK52507.1| disulfide bond formation protein D [Bacillus cereus ATCC 10876]
 gi|228606406|gb|EEK63835.1| disulfide bond formation protein D [Bacillus cereus 172560W]
 gi|228634581|gb|EEK91164.1| disulfide bond formation protein D [Bacillus cereus m1550]
 gi|228705471|gb|EEL57835.1| disulfide bond formation protein D [Bacillus cereus Rock4-2]
 gi|228714888|gb|EEL66758.1| disulfide bond formation protein D [Bacillus cereus F65185]
 gi|228726945|gb|EEL78154.1| disulfide bond formation protein D [Bacillus cereus AH676]
 gi|228808641|gb|EEM55140.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228840237|gb|EEM85511.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 210

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 101 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVDVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ ++I + ++    RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKDIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|134099030|ref|YP_001104691.1| DsbA oxidoreductase [Saccharopolyspora erythraea NRRL 2338]
 gi|291006872|ref|ZP_06564845.1| DsbA oxidoreductase [Saccharopolyspora erythraea NRRL 2338]
 gi|133911653|emb|CAM01766.1| DsbA oxidoreductase [Saccharopolyspora erythraea NRRL 2338]
          Length = 236

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 72/182 (39%), Gaps = 22/182 (12%)

Query: 47  LLAASPSTMKDVSIGQK------DAP---VTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           L  A P T    S+ +       +AP   VT+VE+    C  CA +++   K LE  Y  
Sbjct: 34  LHGAGPGTASGASLRKPGSNTLTEAPGEKVTVVEFLDYQCPSCASYYDNVIKQLEQDY-- 91

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI----NSKNYR 153
           TG++ ++ R+FPL   +             M G Y      L++  + W      S   +
Sbjct: 92  TGRIDFVTRDFPLPVHALAVPAAKAAEAAAMQGKYREMYHALYDGYESWAVAADGSSISQ 151

Query: 154 DALLNMAKF------AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           D     A+F       G     F   +    ++  I+  +   ++   ++ TP FFI G 
Sbjct: 152 DVSAARARFDEFAMRIGLDLERFHRDMASPQVMSKIEQDRSDGAK-AGVNGTPTFFINGE 210

Query: 208 LY 209
           L+
Sbjct: 211 LF 212


>gi|242347950|ref|YP_002995511.1| DSBA-like thioredoxin domain protein [Aeromonas hydrophila]
 gi|224831769|gb|ACN66900.1| DSBA-like thioredoxin domain protein [Aeromonas hydrophila]
          Length = 286

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 77/165 (46%), Gaps = 13/165 (7%)

Query: 46  ALLAASPSTMKDVS--IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
           A   A+P  + D     G   A  T+VE++ M C  C +FH+ T K + D     G + +
Sbjct: 90  AKFEAAPEKVDDGKHIYGAPGARFTLVEFSDMECPFCKQFHD-TPKQIVD--ASKGNVNW 146

Query: 104 ILREFPLDSVSTVA---VMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
             +  PLD  +  A    + A C AE++ + G+W FV+ +F+      N     D L ++
Sbjct: 147 QWKHMPLDFHNPTAHREALAAECIAEQKGNRGFWVFVNDIFHHSQG--NGAGVAD-LASV 203

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
               G   ++F  CL      D ++A  ++A + + ++ TP  F+
Sbjct: 204 VTGVGADLDEFRDCLGSGKHEDKVEADIQKA-KSYGVNGTPATFV 247


>gi|75761274|ref|ZP_00741255.1| Thiol:disulfide interchange protein dsbA [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|74491233|gb|EAO54468.1| Thiol:disulfide interchange protein dsbA [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
          Length = 218

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 49  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 108

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 109 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVDVEQFK 164

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 165 KDLHSKEITEKVRKDSDRAQK-LKVQGAPSVYVNGNL 200


>gi|271968711|ref|YP_003342907.1| sodium/proton antiporter [Streptosporangium roseum DSM 43021]
 gi|270511886|gb|ACZ90164.1| putative sodium/proton antiporter [Streptosporangium roseum DSM
           43021]
          Length = 629

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 63/171 (36%), Gaps = 23/171 (13%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           LAA     +D   G + APVT+VEY    C +C +      + L D     G +RY+ R 
Sbjct: 453 LAAPVDPDRDHVRGPQVAPVTVVEYGDFECPYCGQAEAVVRELLAD----LGDVRYVWRH 508

Query: 108 FPLDSVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
            PL  V     +             +W    LL + QD+       RD L+  A   G  
Sbjct: 509 LPLHDVHPYAQLAAEAAEAAAEQEAFWEMHDLLLDHQDE----LRIRD-LIGYAGELGLD 563

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDF------AIDSTPVFFIGGNLYLG 211
              F   L          AG  R +ED        +  TP FFI G  + G
Sbjct: 564 VERFRDSLRGH-------AGAARVAEDIDSADLSGVSGTPTFFINGRRHHG 607


>gi|218895599|ref|YP_002444010.1| hypothetical protein BCG9842_B4758 [Bacillus cereus G9842]
 gi|218543082|gb|ACK95476.1| conserved hypothetical protein [Bacillus cereus G9842]
 gi|326938262|gb|AEA14158.1| Thiol-disulfide oxidoreductase BdbD [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 216

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 107 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVDVEQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 163 KDLHSKEITEKVRKDSDRAQK-LKVQGAPSVYVNGNL 198


>gi|148271787|ref|YP_001221348.1| hypothetical protein CMM_0608 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147829717|emb|CAN00634.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 268

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 90/213 (42%), Gaps = 26/213 (12%)

Query: 10  VLGGIVLLFIA---SYFFYTRKGSALNELPIPDGVVDF----RALLAASPSTMKDVSIGQ 62
           V GG+V++  A     +   +  +A    P+ D         +  +A  P+    VS+G 
Sbjct: 40  VAGGLVIVIAAIAGGVYLLGQSQAASAAGPVQDTTAALSTGDQVRIATEPT---GVSVGA 96

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR------YILREFPLDSVSTV 116
            DAPVTM  Y   +C HCA++  +T   L D+   TG++R       I+ ++ + + S  
Sbjct: 97  ADAPVTMDVYEDYSCPHCAQYEAETGPLL-DRIAATGQVRIVYHPIQIVTKYGVVAGSAA 155

Query: 117 AVMLARCAEKRMDGGYWGFV-SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           A +LA   +K      W  V S LF+      +S  + D  +      G + +   TC+ 
Sbjct: 156 ACVLAEEPDK------WPAVHSALFDNHSTITDSWTHAD-FVTWLTTQGVTADAARTCVA 208

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           +      I +    A+    +  TP   I G++
Sbjct: 209 EGKYSSWITSNTSDATS-AGVTGTPTLRIQGDI 240


>gi|268680062|ref|YP_003304493.1| DsbA oxidoreductase [Sulfurospirillum deleyianum DSM 6946]
 gi|268618093|gb|ACZ12458.1| DsbA oxidoreductase [Sulfurospirillum deleyianum DSM 6946]
          Length = 208

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 92/208 (44%), Gaps = 33/208 (15%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +  L   + L+IA  + YT   SA + +P       +R+             +G++DAP+
Sbjct: 8   LSTLALFIGLYIAGSYLYT---SANHTIPNEQQSSLYRS---------HAFVVGKEDAPI 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T+VE+    C  C  F+    ++L+       +L+ +LR  P    S++ V +   +  R
Sbjct: 56  TIVEFFDPACVTCKNFYPFVKEFLKK---HPKELKLMLRYAPFHQDSSIVVAMIEAS--R 110

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
           +   Y   + +++  QD W++         N+A+   F     +  ++ + + +D+K  +
Sbjct: 111 LQNRYLETLEVIYRYQDQWVSQHT-----PNIARIWSFLP---EAGVDIERLKEDMKKPE 162

Query: 188 KRA--SEDFA------IDSTPVFFIGGN 207
             A  ++D A      I +TP FF+ G 
Sbjct: 163 IEAIIAQDMADVKTLGIKATPEFFVNGK 190


>gi|206968625|ref|ZP_03229581.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|206737545|gb|EDZ54692.1| conserved hypothetical protein [Bacillus cereus AH1134]
          Length = 216

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 107 AAAGEAIYKQDKDSFWIFYDEIYQNQRKDTEEWIT----EDLLLSIVKEKLPKVDVEQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ ++I + ++    RA +   +   P  ++ GNL
Sbjct: 163 KDLHSKDIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 198


>gi|328765882|gb|EGF75980.1| hypothetical protein BATDEDRAFT_28910 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 223

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 75/178 (42%), Gaps = 13/178 (7%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY-ILREFPLDSVSTVAV 118
           IG  DAPVT+VE+    C  C  +    +  L   Y+ TGK+++  +        S +A 
Sbjct: 51  IGDPDAPVTVVEFGDFKCPSCKAWGENIYPQLVSDYVDTGKVKFSFINVLFHGEESELAS 110

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF----AGFSKNDFDTCL 174
           + A    K+    YW F   LF +Q     S+N+  + + + K     +G S  D D   
Sbjct: 111 LAAESVYKQNPDSYWEFHKALFKEQP----SENHDSSWVTIEKILEVASGVSGIDTDKLK 166

Query: 175 ND---QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +D    + +D++    +  +E F +  TP   +   +             ID+ ++++
Sbjct: 167 SDIESNSEIDEVNKDTELVTE-FEVQLTPTIMVNETMIEDPFDYEAIKNAIDNALEEN 223


>gi|47567104|ref|ZP_00237820.1| thiol-disulfide oxidoreductase BdbD [Bacillus cereus G9241]
 gi|47556160|gb|EAL14495.1| thiol-disulfide oxidoreductase BdbD [Bacillus cereus G9241]
          Length = 217

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 68/158 (43%), Gaps = 14/158 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 48  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 107

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMAKFAGFSKND---F 170
                   K+    +W F   ++  Q    ++WI      + LLN+ K     K D   F
Sbjct: 108 AAAGEAIYKQDKDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVK-EKLPKVDIAQF 162

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
              L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 163 KKDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 199


>gi|309796455|ref|ZP_07690863.1| DSBA-like thioredoxin domain protein [Escherichia coli MS 145-7]
 gi|308119960|gb|EFO57222.1| DSBA-like thioredoxin domain protein [Escherichia coli MS 145-7]
          Length = 286

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 78/165 (47%), Gaps = 13/165 (7%)

Query: 46  ALLAASPSTMKDVS--IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
           A   A+P  ++D     G   A  T+VE++ M C  C +FH+ T K + D     G + +
Sbjct: 90  AQFEAAPEKVEDGKHIYGDLGARFTLVEFSDMECPFCKQFHD-TPKQIVD--ASKGNVNW 146

Query: 104 ILREFPLDSVSTVA---VMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
             +  PLD  +  A    + A C AE++ + G+W FV+ +F+      N     D L ++
Sbjct: 147 QWKHMPLDFHNPAAHKEALAAECIAEQKGNRGFWVFVNEIFHHSKG--NGAGVSD-LASV 203

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
               G   + F  CL+     D ++A  ++A + + ++ TP  F+
Sbjct: 204 VTGVGADLDAFRECLSSGKHEDKVQADIQKA-KSYGVNGTPATFV 247


>gi|320533643|ref|ZP_08034273.1| DSBA-like thioredoxin domain protein [Actinomyces sp. oral taxon
           171 str. F0337]
 gi|320134151|gb|EFW26469.1| DSBA-like thioredoxin domain protein [Actinomyces sp. oral taxon
           171 str. F0337]
          Length = 287

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 61/152 (40%), Gaps = 7/152 (4%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G+ DAPV MV Y+   C +C +F  K    L DK +K G LR   R+    S  T  +  
Sbjct: 96  GKVDAPVVMVIYSDFACPYCTQFAQKVEPEL-DKLVKQGTLRVEWRDLAQIS-ETSPLAA 153

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                    G +W F   ++   D   +     D+L+  AK AG    D      D    
Sbjct: 154 QAGRAAAKQGKFWEFHDAVYAAADPQGHPTYTEDSLVAFAKKAGVP--DLKKFRADMTAA 211

Query: 181 DDIKAGKKRAS--EDFAIDSTPVFFIGGNLYL 210
           + +KA  +  +      I  TP F I G  Y+
Sbjct: 212 ETVKAVSESTNHVHSIGIQGTP-FMIVGETYI 242


>gi|229171326|ref|ZP_04298913.1| disulfide bond formation protein D [Bacillus cereus MM3]
 gi|228612145|gb|EEK69380.1| disulfide bond formation protein D [Bacillus cereus MM3]
          Length = 210

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LLN+   K        F 
Sbjct: 101 AAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVKEKLPKVDVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + + + ++    RA +   +   P  +I GNL
Sbjct: 157 KDLHSKEMKEKVRKDSDRAQK-LKVQGAPSVYINGNL 192


>gi|229095194|ref|ZP_04226186.1| disulfide bond formation protein D [Bacillus cereus Rock3-29]
 gi|229101296|ref|ZP_04232044.1| disulfide bond formation protein D [Bacillus cereus Rock3-28]
 gi|229114142|ref|ZP_04243563.1| disulfide bond formation protein D [Bacillus cereus Rock1-3]
 gi|228669162|gb|EEL24583.1| disulfide bond formation protein D [Bacillus cereus Rock1-3]
 gi|228682120|gb|EEL36249.1| disulfide bond formation protein D [Bacillus cereus Rock3-28]
 gi|228688053|gb|EEL41939.1| disulfide bond formation protein D [Bacillus cereus Rock3-29]
          Length = 218

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 49  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 108

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      + LL++   K        F 
Sbjct: 109 AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWIT----EELLLSIVKEKLPKVDVEQFK 164

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  +I GNL
Sbjct: 165 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYINGNL 200


>gi|320105544|ref|YP_004181134.1| putative lipoprotein [Terriglobus saanensis SP1PR4]
 gi|319924065|gb|ADV81140.1| putative lipoprotein [Terriglobus saanensis SP1PR4]
          Length = 309

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 63/159 (39%), Gaps = 20/159 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--STVAV 118
           G  DAPV +V Y  + C +CA  H   F  L D+Y    ++R   R FPL+    +  A 
Sbjct: 123 GPLDAPVVIVSYDDLECPYCARLHAALFPALMDRY--KNQVRIAYRSFPLEGHLWAMHAA 180

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN--------YRDALLNMAKFAGFSKNDF 170
           +   C       GYW  V  +     ++  +++            ++N        ++  
Sbjct: 181 VDVDCLGAENAQGYWAAVDQIHAHAGEYGGAEHLLAKAEEELDTVVINEGHLFHVDESAL 240

Query: 171 DTCLNDQNIL---DDIKAGKKRASEDFAIDSTPVFFIGG 206
             C+  Q+      +I +GKK       +  TP FFI G
Sbjct: 241 RACIKKQDTTLENANIDSGKK-----LGVYRTPTFFING 274


>gi|269926838|ref|YP_003323461.1| DSBA oxidoreductase [Thermobaculum terrenum ATCC BAA-798]
 gi|269790498|gb|ACZ42639.1| DSBA oxidoreductase [Thermobaculum terrenum ATCC BAA-798]
          Length = 231

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 78/170 (45%), Gaps = 10/170 (5%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV-AV 118
           +G  +APVT+  +A   C +C EF       L+   I  GK++ + R F      +V A 
Sbjct: 65  MGDPNAPVTVEVWADYQCPYCREFVMGPEAQLKKTLIPEGKVKLVYRNFAFIGQESVDAA 124

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA---GFSKNDFDTCLN 175
             A CA+ +  G +W +   LF++Q    NS  +  A  N+ +FA   G +   F +CL+
Sbjct: 125 AAAYCAQDQ--GRFWDYNYKLFSEQGAE-NSGTFSKA--NLIRFASDLGLNVAQFRSCLD 179

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
               L  ++A  +       + +TP  F+ G    G  S     ++I+S+
Sbjct: 180 SGKYLSKVQADTQDGRAK-GVRATPTIFVNGEKIEGLPSYEQLVQVINSV 228


>gi|170783127|ref|YP_001711461.1| hypothetical protein CMS_2828 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169157697|emb|CAQ02899.1| putative membrane protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 282

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 92/217 (42%), Gaps = 26/217 (11%)

Query: 6   TRIGVLGGIVLLFIA---SYFFYTRKGSALNELPIPDGVVDF----RALLAASPSTMKDV 58
           T+  V GG+V++  A     +   +  +A    P+ D         +  +A  P+    V
Sbjct: 50  TQFSVAGGLVIVIAAIAGGVYLLGQSQAASAAGPVQDTTAALSTGDQVRIATEPT---GV 106

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR------YILREFPLDS 112
           S+G  DAPVTM  +   +C HCA++  +T   L D+   TG++R       I+ ++ + +
Sbjct: 107 SVGAADAPVTMDVFEDYSCPHCAQYEAETGPLL-DRIAATGQVRIVYHPIQIVTKYGVVA 165

Query: 113 VSTVAVMLARCAEKRMDGGYWGFV-SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            S  A +LA   +K      W  V S LF+      +S  + D  +      G + +   
Sbjct: 166 GSAAACVLAEEPDK------WPAVHSALFDNHSTITDSWTHAD-FVTWLTTQGVTADAAR 218

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           TC+ +      I +    A+    +  TP   I G++
Sbjct: 219 TCVAEGRYSSWITSNTSDATS-AGVTGTPTLRIQGDI 254


>gi|42522366|ref|NP_967746.1| disulfide interchange protein [Bdellovibrio bacteriovorus HD100]
 gi|39574898|emb|CAE78739.1| disulfide interchange protein [Bdellovibrio bacteriovorus HD100]
          Length = 260

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 76/182 (41%), Gaps = 24/182 (13%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD------ 111
           V  G KDA VT++EY+   C +CA+ H  T   +   Y K   +R + +  PLD      
Sbjct: 92  VIFGPKDAKVTIIEYSDFECPYCAKGHA-TVDEVMKAYPKD--VRVVYKHLPLDFHPMAM 148

Query: 112 ----SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
                   +A+  A  AEK        F +L+F  Q D    K    AL   AK AG   
Sbjct: 149 PAAQYFEAIALQDAAKAEK--------FYNLVFENQGDLRTKKE--GALKEAAKKAGADM 198

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              +  LN + +   I+A  + A + F    TP F I G    G      F +IID  + 
Sbjct: 199 KKLEKDLNSEVVKKRIEADMEEARK-FNFSGTPGFLINGVSLRGAYPFADFKEIIDRHLA 257

Query: 228 DS 229
           ++
Sbjct: 258 EA 259


>gi|52144770|ref|YP_082059.1| thiol-disulfide oxidoreductase (disulfide bond formation protein D)
           (disulfideoxidoreductase D) [Bacillus cereus E33L]
 gi|51978239|gb|AAU19789.1| probable thiol-disulfide oxidoreductase (disulfide bond formation
           protein D) (disulfideoxidoreductase D) [Bacillus cereus
           E33L]
          Length = 219

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 68/158 (43%), Gaps = 14/158 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 50  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMAKFAGFSKND---F 170
                   K+    +W F   ++  Q    ++WI      + LLN+ K     K D   F
Sbjct: 110 AAAGEAIYKQDKDSFWIFYDEIYQSQKKDTEEWIT----EELLLNIVK-EKLPKVDIAQF 164

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
              L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 165 KKDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 201


>gi|218233246|ref|YP_002365341.1| hypothetical protein BCB4264_A0580 [Bacillus cereus B4264]
 gi|218161203|gb|ACK61195.1| conserved hypothetical protein [Bacillus cereus B4264]
          Length = 216

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K    +   F 
Sbjct: 107 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVNVEQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ ++I + +     RA +   +   P  ++ GNL
Sbjct: 163 KDLHSKDIKEKVSKDSDRAQK-LKVQGAPSVYVNGNL 198


>gi|229108150|ref|ZP_04237773.1| disulfide bond formation protein D [Bacillus cereus Rock1-15]
 gi|228675280|gb|EEL30501.1| disulfide bond formation protein D [Bacillus cereus Rock1-15]
          Length = 210

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 101 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKIDVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ ++I + +     RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKDIKEKVSKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|15805779|ref|NP_294477.1| hypothetical protein DR_0753 [Deinococcus radiodurans R1]
 gi|6458464|gb|AAF10332.1|AE001931_3 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 262

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 18/172 (10%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR-------YILREFPLDSV 113
           GQ +APV ++      C +C  F       L  KY+ TGK++       ++    P D  
Sbjct: 88  GQANAPVNVLVVEDFKCPNCKSFEETVAPELRTKYVGTGKVKMYSLVYPFLADRLPEDD- 146

Query: 114 STVAVMLARC--AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
           S  A   ARC  A+ + D  +  +  +LF  Q         +  L  +A      +  F 
Sbjct: 147 SKYAAQAARCVYAQGKND-AFNTYKEILFRAQGPETEVWATKSRLKELATSLDIDQAKFA 205

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL------YLGDMSEGV 217
           TCL++      ++  K+ A +   +  TP  F+ G L      Y+ D+S  +
Sbjct: 206 TCLDNDETAAQVETDKQEALK-AGVGGTPTVFVNGKLVNVQSDYVKDISAAI 256


>gi|239932926|ref|ZP_04689879.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
 gi|291441276|ref|ZP_06580666.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
 gi|291344171|gb|EFE71127.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
          Length = 607

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 69/179 (38%), Gaps = 12/179 (6%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-L 110
           P+T  D   G  DAP+T+VEY    C  CA       + L  ++    +LRY+ R  P L
Sbjct: 437 PAT--DHVTGPPDAPLTLVEYGDFECPFCAR-ATGVAQELRQRFGD--RLRYVFRHLPLL 491

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D      +           G +W    LLF  QD       + D +L  A   G     F
Sbjct: 492 DVHPHSELAARAAVAADAQGRFWQMHDLLFAHQDQ----LEFED-ILGYAGQIGLDVERF 546

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
              L+ +     ++A    A E      TP FF+G   + G       ++ +++   DS
Sbjct: 547 LEDLDSERTAARVRADVASA-EASGARGTPTFFLGSRRHTGPYDAQTLARELETSAADS 604


>gi|320333740|ref|YP_004170451.1| DSBA oxidoreductase [Deinococcus maricopensis DSM 21211]
 gi|319755029|gb|ADV66786.1| DSBA oxidoreductase [Deinococcus maricopensis DSM 21211]
          Length = 310

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 63/146 (43%), Gaps = 19/146 (13%)

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA- 121
           K  PV + E++   C +C E H+  F  L+   I  G  R+  R FPL S    A+ LA 
Sbjct: 156 KGGPV-IREFSDFQCPYCRELHDDVFPALQRDLIGKGLARFSYRHFPL-SFHQNAMPLAL 213

Query: 122 --RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
              CA ++  G +W +  + F      + S       +  AK  G +   F TCL D  +
Sbjct: 214 GGECAAQQ--GKFWAYHDVAFT-----VTSP------VTAAKQLGLNLTTFQTCLKDPAV 260

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIG 205
              +KA  K   +   +  TP  ++G
Sbjct: 261 QALVKADMK-VGDAVDVQGTPSLYVG 285


>gi|76801910|ref|YP_326918.1| disulfide bond formation protein [Natronomonas pharaonis DSM 2160]
 gi|76557775|emb|CAI49359.1| probable disulfide bond formation protein [Natronomonas pharaonis
           DSM 2160]
          Length = 209

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G ++APVT+  +    C  CA F  +    L D+YI+TG++RY+  +FP+      + 
Sbjct: 43  ALGAENAPVTVTVFEDYGCPACARFKAQALPALIDQYIETGEVRYLHADFPIPVDEAWSH 102

Query: 119 MLARCAEKRM----DGGYWGFVSLLFNKQ 143
            +A  A +      +  +W F S +++ Q
Sbjct: 103 PVANAAREVFFEAGNDAFWLFSSSIYDHQ 131


>gi|302344415|ref|YP_003808944.1| DSBA oxidoreductase [Desulfarculus baarsii DSM 2075]
 gi|301641028|gb|ADK86350.1| DSBA oxidoreductase [Desulfarculus baarsii DSM 2075]
          Length = 260

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 73/176 (41%), Gaps = 13/176 (7%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G+ DAPVT+ EY   +C  CA         LE    +  ++R  L+  P D  +  A +
Sbjct: 93  LGRADAPVTIFEYTDFSCQACARNAAMVLDLLE---AQPQRVRVFLKHSPSDEYARTAAL 149

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                 ++     W F  L+F +Q      K    AL  +        N     L D ++
Sbjct: 150 HFEAIARQSPVKAWRFQELVFQRQAAL--RKAGPAALQGLLDELAVEPNALAKDLADPDL 207

Query: 180 ---LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
              +DD  A  +R    F I +TP + I G L  G   +    K+++ MI+ + R+
Sbjct: 208 AKRIDDDMAEAER----FHIKNTPSYVINGVLIEGAAPKEAVLKVME-MIEAAERK 258


>gi|326386685|ref|ZP_08208306.1| protein-disulfide isomerase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208738|gb|EGD59534.1| protein-disulfide isomerase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 239

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 70/191 (36%), Gaps = 26/191 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV +V Y S TC HCA F  +    +    I  GK  Y +R F  + +     +
Sbjct: 52  LGNPAAPVNLVAYISYTCPHCAAFEAEAEAPMRIGMIAPGKGSYEIRPFMRNPIDIAVAL 111

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINS-KNYRDA----------------------L 156
           LA C        ++      F  Q +W+    N  DA                      L
Sbjct: 112 LAECGPP---SHFFANNQAFFASQSEWMAPLGNLTDAQKARWSNPDFGARMRAMASDLGL 168

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
             + +  G+ +   D CL ++ + + I    + A E   +  TP F + G    G  +  
Sbjct: 169 YKIMEQRGYDRVTLDRCLANKPLAERIAKHTQDAVEKDFVQGTPAFLLNGVPLAGTYTWE 228

Query: 217 VFSKIIDSMIQ 227
                +D+ ++
Sbjct: 229 ALKPQLDARLR 239


>gi|124515707|gb|EAY57216.1| probable oxidoreductase [Leptospirillum rubarum]
          Length = 254

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/168 (19%), Positives = 71/168 (42%), Gaps = 8/168 (4%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV---ST 115
           S G+      ++E+    C  C +++       E K ++   +R+     PL ++   + 
Sbjct: 87  SSGKPSDTALVIEFGDDQCPVCRKWNQNE----EQKVLQDPSIRFTYIPMPLVTIHQNAL 142

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQD-DWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
            A +   CA +     +W    LL  + +   ++ K+    L  +A          + C+
Sbjct: 143 KAALFEMCAYQIRPSSFWTIHDLLNRRVELGSVDEKDLDGVLNGLASSQALPATKMNQCM 202

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           ++Q+ L DI+      ++   I +TP F +GG +  G ++ G   K++
Sbjct: 203 SEQSPLPDIETADNTLTQKTGIPTTPTFIVGGQVKTGYLTYGEIKKLL 250


>gi|29824950|gb|AAO92065.1| disulfide oxidoreductase [Ehrlichia muris]
          Length = 246

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 70/149 (46%), Gaps = 12/149 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S G KD+ +  VE+   +C +C        + ++D     GK+R I R+FP+   +++  
Sbjct: 87  SAGNKDSKIVFVEFFDYSCGYCKMMSEDMKQIVQD-----GKVRVIFRDFPILGEASLKA 141

Query: 119 MLARCAEKRMD-GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL-ND 176
           + A  A   +D   Y  F     N +  + +     +++LN+ K  G ++ DF   L  +
Sbjct: 142 VQAALAIHLIDPSKYLEFYHAALNHKQQFND-----ESILNIVKSIGITEEDFRISLAKN 196

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            + ++++    ++ +E+  I  TP   IG
Sbjct: 197 SDTIENMIQSTRKLAENINIRGTPAIIIG 225


>gi|228956961|ref|ZP_04118740.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228802716|gb|EEM49554.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 218

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 49  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 108

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 109 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVDVEQFK 164

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ ++I + +     RA +   +   P  ++ GNL
Sbjct: 165 KDLHSKDIKEKVSKDSDRAQK-LKVQGAPSVYVNGNL 200


>gi|229125977|ref|ZP_04255001.1| disulfide bond formation protein D [Bacillus cereus BDRD-Cer4]
 gi|229143268|ref|ZP_04271699.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST24]
 gi|228640075|gb|EEK96474.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST24]
 gi|228657460|gb|EEL13274.1| disulfide bond formation protein D [Bacillus cereus BDRD-Cer4]
          Length = 210

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 41  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 100

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 101 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVDVEQFK 156

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ ++I + +     RA +   +   P  ++ GNL
Sbjct: 157 KDLHSKDIKEKVSKDSDRAQK-LKVQGAPSVYVNGNL 192


>gi|256376890|ref|YP_003100550.1| DSBA oxidoreductase [Actinosynnema mirum DSM 43827]
 gi|255921193|gb|ACU36704.1| DSBA oxidoreductase [Actinosynnema mirum DSM 43827]
          Length = 243

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 69/181 (38%), Gaps = 21/181 (11%)

Query: 40  GVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG 99
           G  D   LL A   T+  V  G +   VT+VE+    C  CA +++   K LE+ Y   G
Sbjct: 49  GSADQSRLLPADAHTLSAVE-GNR---VTLVEFLDYQCPACASYYSGITKQLEEDY--RG 102

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW--------INSKN 151
           ++ +  R FPLD      +           G   G    L+    DW         +   
Sbjct: 103 RITFATRNFPLDVHPLAPLAARAAEAAGEQGQQTGMYHALYGGFQDWAVTGQATATDETA 162

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASED---FAIDSTPVFFIGGNL 208
            R A    A+  G   + F T L+     D +KA   R   D     +  TP FF+GG  
Sbjct: 163 ARTAFERYAQDLGLDVDRFRTDLDS----DAVKAAVDRDVADGKALGVTGTPTFFVGGER 218

Query: 209 Y 209
           +
Sbjct: 219 F 219


>gi|30018731|ref|NP_830362.1| Thiol-disulfide oxidoreductase BdbD [Bacillus cereus ATCC 14579]
 gi|296501303|ref|YP_003663003.1| Thiol-disulfide oxidoreductase BdbD [Bacillus thuringiensis BMB171]
 gi|34921563|sp|Q81I73|BDBD_BACCR RecName: Full=Probable disulfide bond formation protein D; AltName:
           Full=Disulfide oxidoreductase D; AltName:
           Full=Thiol-disulfide oxidoreductase D; Flags: Precursor
 gi|29894272|gb|AAP07563.1| Thiol-disulfide oxidoreductase BdbD [Bacillus cereus ATCC 14579]
 gi|296322355|gb|ADH05283.1| Thiol-disulfide oxidoreductase BdbD [Bacillus thuringiensis BMB171]
          Length = 216

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 47  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 106

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 107 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVDVEQFK 162

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ ++I + +     RA +   +   P  ++ GNL
Sbjct: 163 KDLHSKDIKEKVSKDSDRAQK-LKVQGAPSVYVNGNL 198


>gi|228906288|ref|ZP_04070173.1| disulfide bond formation protein D [Bacillus thuringiensis IBL 200]
 gi|228853311|gb|EEM98083.1| disulfide bond formation protein D [Bacillus thuringiensis IBL 200]
          Length = 218

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 12/157 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP +   S + 
Sbjct: 49  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 108

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMA--KFAGFSKNDFD 171
                   K+    +W F   ++  Q    ++WI      D LL++   K        F 
Sbjct: 109 AAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWIT----EDLLLSIVKEKLPKVDVAQFK 164

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             L+ + I + ++    RA +   +   P  ++ GNL
Sbjct: 165 KDLHSKEIKEKVRKDSDRAQK-LKVQGAPSVYVNGNL 200


>gi|222526130|ref|YP_002570601.1| Protein-disulfide isomerase-like protein [Chloroflexus sp.
           Y-400-fl]
 gi|222450009|gb|ACM54275.1| Protein-disulfide isomerase-like protein [Chloroflexus sp.
           Y-400-fl]
          Length = 253

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 77/172 (44%), Gaps = 14/172 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE-FPLDSVSTVA 117
           ++G   AP+T+ +Y+      C          L ++Y+ TG++ Y+ R      + S + 
Sbjct: 86  TLGDPAAPLTLTDYSDFLUTVCRRHVLTVEPALIEQYVVTGRVLYVFRPVLNHGAASLIT 145

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA---GFSKNDFDTCL 174
              A CA ++    +W    LLF +Q +   +++  D    M  +A   G +   FD C+
Sbjct: 146 TAAAFCAGEQ--DAFWPMHELLFERQGEVAATRD-SDLPALMRSYAADLGLAIEPFDACM 202

Query: 175 ND---QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           ND   Q + + + A +++      I   PVF IG    +G  +   F+ +I+
Sbjct: 203 NDGAAQRLAETLDAEQRQRG----IRVQPVFEIGDIRLVGLQTLERFASLIE 250


>gi|184199898|ref|YP_001854105.1| Na(+)/H(+) antiporter [Kocuria rhizophila DC2201]
 gi|183580128|dbj|BAG28599.1| Na(+)/H(+) antiporter [Kocuria rhizophila DC2201]
          Length = 617

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 74/165 (44%), Gaps = 13/165 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK-LRYILREFPLDSVSTVAVM 119
           G +DA +T+VEY    C +CA   + T  + ED   + G+ LRY++R  P      +A  
Sbjct: 453 GPEDAKLTLVEYVDFECEYCA---HATGSW-EDLSAQFGEDLRYVVRHLPHHPHGPLAAK 508

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                   + G +W ++ L+F  QD        R  L+  A+  G + + F   ++ + +
Sbjct: 509 --ASEAAAIQGEFWRWLDLVFTHQD-----ALERKHLIGYAEELGLNVDHFIHDIDSEAV 561

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            + +      ++E     +TP FF+ G   LGD      +  ++S
Sbjct: 562 AERVNR-DVVSAEASGAHATPTFFVEGRRLLGDYDARTLAAALES 605


>gi|83643873|ref|YP_432308.1| protein-disulfide isomerase [Hahella chejuensis KCTC 2396]
 gi|83631916|gb|ABC27883.1| Protein-disulfide isomerase [Hahella chejuensis KCTC 2396]
          Length = 353

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 75/170 (44%), Gaps = 12/170 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV-M 119
           G   A V++VE+A   C HC    +   K +     ++  +R+ + +FP+   ++V +  
Sbjct: 192 GNAQAAVSIVEFADFRCSHCKHASHTLRKIV---AAQSDNVRWTMVDFPVTGKTSVYLAQ 248

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
            A CA K+    YW F   LF+      + K    ++  +A+  G      + C +    
Sbjct: 249 AAYCAGKQ--NKYWEFHDALFD-----YDGKLSEASIAGVAESLGLDAAKIEECASSPEA 301

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  ++  + +A E   +  TP  FI G  + GD  E V  + +++ +  S
Sbjct: 302 VQFVEKEQSQAIE-LGLRGTPAIFINGLPFHGDNLEAVLEEAVNAAVARS 350


>gi|269956488|ref|YP_003326277.1| Na+/H+ antiporter NhaA [Xylanimonas cellulosilytica DSM 15894]
 gi|269305169|gb|ACZ30719.1| Na+/H+ antiporter NhaA [Xylanimonas cellulosilytica DSM 15894]
          Length = 600

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 67/173 (38%), Gaps = 22/173 (12%)

Query: 49  AASPSTM-------KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           AA P+T+       +D   G  DA VT+VEY    C  CA       +  E       +L
Sbjct: 414 AALPTTLSRPVDPERDHLRGPADAEVTLVEYLDFECPFCARATGAARQVREH---FGDRL 470

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
           RY++R  PLD      +             YW     LF   D+          L ++A 
Sbjct: 471 RYVVRNLPLDVHPHAELAALAAEAAGRQDRYWEMHDTLFAHHDEL--------ELEDLAG 522

Query: 162 FA---GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           +A   G     F   L + ++ D +   K+ A E  A  STP FF+G   + G
Sbjct: 523 YAATLGLDVEQFLRDLQEDDLADHVAQDKESAGESGA-RSTPTFFVGERRHEG 574


>gi|162457325|ref|YP_001619692.1| hypothetical protein sce9040 [Sorangium cellulosum 'So ce 56']
 gi|161167907|emb|CAN99212.1| hypothetical protein sce9040 [Sorangium cellulosum 'So ce 56']
          Length = 665

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 71/176 (40%), Gaps = 13/176 (7%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL- 110
           P T  D + G + APVT+V ++   C  C      T + LE +Y    +LR + + FPL 
Sbjct: 69  PVTRADPARGSRLAPVTIVVFSDFECPFCKHL-GGTLRQLEQRY-GAERLRVVWKNFPLA 126

Query: 111 ---DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
               +  T    +A  A       +W F   +F   D+ ++ +    AL    + AG + 
Sbjct: 127 FHKQARPTAEAAMAVFAHAGPRA-FWAFHDAIFTA-DERLSPEVQATAL----RRAGVTP 180

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
                 +        + A    A     ++ TP  FI G L +G      F++IID
Sbjct: 181 GQIPQLVQQSGAAQKVAADMALAGR-LGVNGTPASFINGVLLVGAQPAERFAEIID 235


>gi|84499303|ref|ZP_00997591.1| dsbA-like thioredoxin domain protein [Oceanicola batsensis
           HTCC2597]
 gi|84392447|gb|EAQ04658.1| dsbA-like thioredoxin domain protein [Oceanicola batsensis
           HTCC2597]
          Length = 217

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 89/200 (44%), Gaps = 19/200 (9%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           + +L   ++LF  + +F +R  +    +P P+  V    +   SP       +G+++APV
Sbjct: 8   LSILALALVLFAGAAWFVSRSDAGAETVP-PE--VAEALVRPWSPV------LGREEAPV 58

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLD-SVSTVAVMLARCAE 125
           T+VE+    C  C  FH      ++D   + G  +R ++R  P    +S VA+ +   A 
Sbjct: 59  TIVEFFDPACEACRAFH----PIVKDIMAEHGDAVRVVVRYTPFHGKISEVAIRVLEAA- 113

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            RM G +   +  L  +Q  W +    R D ++ +A  AG      +T +   +I+  + 
Sbjct: 114 -RMQGVFEPVMDALMREQPRWASHGGMRPDLIMPIAGEAGLDVAAAETQIRAPDIVAVLN 172

Query: 185 AGKKRASEDFAIDSTPVFFI 204
             +    E   +  TP FF+
Sbjct: 173 RDRSDV-EAVGVRQTPTFFV 191


>gi|189218656|ref|YP_001939297.1| protein-disulfide isomerase [Methylacidiphilum infernorum V4]
 gi|189185514|gb|ACD82699.1| Protein-disulfide isomerase [Methylacidiphilum infernorum V4]
          Length = 237

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 71/166 (42%), Gaps = 23/166 (13%)

Query: 55  MKDVSI----GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP- 109
           +K +SI    G+  APV ++EY  + C  CA ++    + L+ KY    K+ +I+R  P 
Sbjct: 51  LKPLSIDWIQGEPSAPVIIIEYLDLECPVCAAYY-PLLQELKKKY--GDKIAWIIRHNPS 107

Query: 110 -LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
                +  A M A  A ++  G +W  V LL   Q +W       +  ++ A+  G ++ 
Sbjct: 108 MTHPEAFPASMAAEAAGRQ--GKFWEMVGLLLTNQKEWSFRPTCSEWFIHYAQKLGLNEE 165

Query: 169 DFDTCLND-------QNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            F   L         + IL D  +  +       +D  P FFI G 
Sbjct: 166 QFKKDLQGVEGIPLRKRILADCLSAIR-----VGVDGNPCFFINGE 206


>gi|116621815|ref|YP_823971.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116224977|gb|ABJ83686.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 296

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 63/148 (42%), Gaps = 4/148 (2%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +AP+T   +    C HCA   ++    L  +Y++TG+++ + R+FPL  +   A + 
Sbjct: 127 GNPNAPITCEIFTDYQCVHCATIFDQVVPGLMAEYVQTGRMKLVHRDFPL-PMHAYAKLA 185

Query: 121 ARCAEKRMD-GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           AR A      G Y   V+ +F  Q  W  + N  DA +             D   ND+  
Sbjct: 186 ARYANAAGQVGQYELVVNQIFRTQAAWAQNGNL-DAEVAQVVSPEVMDKIRDLVKNDER- 243

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           LDD   G    +   ++  TP   +  N
Sbjct: 244 LDDTMMGDMTIARQDSLSMTPSLVVTYN 271


>gi|119716099|ref|YP_923064.1| Na+/H+ antiporter NhaA [Nocardioides sp. JS614]
 gi|189029091|sp|A1SHU2|NHAA2_NOCSJ RecName: Full=Na(+)/H(+) antiporter nhaA 2; AltName:
           Full=Sodium/proton antiporter nhaA 2
 gi|119536760|gb|ABL81377.1| sodium/proton antiporter, NhaA family [Nocardioides sp. JS614]
          Length = 616

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 70/171 (40%), Gaps = 24/171 (14%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAVM 119
           G++DAP+T+VEY    C  CA     T + L +++     LRY+ R  PL D      + 
Sbjct: 458 GREDAPLTLVEYGDFECPFCARATGVTTE-LRERF--GDDLRYVFRHLPLVDVHPHAELA 514

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN---DFDTCLND 176
                     G +W    LLF  Q +           L +   AG++ +   D +  L D
Sbjct: 515 ARAAVAADHQGRFWELHDLLFEHQGE-----------LEVEDLAGYAADLGLDVEAFLRD 563

Query: 177 QNILDDIKAGKKR----ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
               +D  A + R    ++E      TP FF+GG  + G       ++ ++
Sbjct: 564 LE--EDDTADRVRRDVASAEASGARGTPTFFVGGVRHTGPHDAETLARALE 612


>gi|242277879|ref|YP_002990008.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
 gi|242120773|gb|ACS78469.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
          Length = 274

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 79/178 (44%), Gaps = 13/178 (7%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           + +G  DAPVT+VEY+   C +C++  +   K  +D   +  K R I +  P+ + S   
Sbjct: 87  IMLGNADAPVTIVEYSDFLCPYCSKGASVVSKLAQD---QPDKYRVIFKHLPMHAKSREL 143

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-- 175
            +             + F +L+F +Q +  +  N    L N+    G          N  
Sbjct: 144 SLNFEAIALFDKAKAYQFHNLVFERQKELYDD-NSGVVLSNILGEVGVDPEQVRKIANSA 202

Query: 176 --DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
              Q +LDD   GK+    +F I++TP F I G +  G +   +F   ++ +++ ST+
Sbjct: 203 QVQQYLLDD---GKEAG--EFKINATPTFLINGVVVRGYLPVDMFENKVNLILEKSTQ 255


>gi|297624894|ref|YP_003706328.1| carboxypeptidase Taq [Truepera radiovictrix DSM 17093]
 gi|297166074|gb|ADI15785.1| Carboxypeptidase Taq [Truepera radiovictrix DSM 17093]
          Length = 848

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 69/173 (39%), Gaps = 9/173 (5%)

Query: 42  VDFRALLAASPSTMKDV---SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           V F   LAA P         ++G  DA V +  ++ + C  CA +  +    L+   +  
Sbjct: 644 VRFELELAAVPEDRFPAVRHTLGPADAAVVVRAFSDLQCPFCARYGLEVLPELKATLLAR 703

Query: 99  GKLRYILREFPLDSV---STVAVMLARCAEKRMDG---GYWGFVSLLFNKQDDWINSKNY 152
           G +R+     PL S+   +  A   A C      G    +W F   L  +Q  W +  + 
Sbjct: 704 GDVRFEFHHLPLLSIHANAAPAAEAAECVTDANAGDPEAFWTFHDALLERQGAWRDLGDP 763

Query: 153 RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
               + +A+  G S      CL + +  + ++     A++   + +TP  F+G
Sbjct: 764 APYFVRLAREVGLSAEGVAACLTEGHYTETVREAYALATQTLGLSATPTVFVG 816


>gi|116326879|ref|YP_796599.1| protein-disulfide isomerase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116119623|gb|ABJ77666.1| Protein-disulfide isomerase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 406

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 81/190 (42%), Gaps = 23/190 (12%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSI-GQKDAPVTMVEYASMTCFHCAEFHNKT 87
           GSA  E  IP+ + +F          +KDV I G  +AP+T+V+YA   C HC    +K 
Sbjct: 199 GSADGEKSIPEQLKEFETAQTVQID-LKDVPILGDLNAPITIVKYADFNCGHCMH-TSKI 256

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAV-------------MLARCAEKRMDGGYWG 134
            K   ++Y   G ++   + FPLD      V               A CA ++    ++ 
Sbjct: 257 LKSFLNEY--EGIIKVAYKNFPLDGNCNRLVGRKSPEASSCIAASAALCANQQ--NKFYP 312

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
             + L++  D+     +    +  +A+ +G   + F  C++   I D I      A E  
Sbjct: 313 VYTGLYD--DNEAGVMHTAATVTRLAEKSGLKMDQFRACMSSTKIRDHINREVDEA-EKL 369

Query: 195 AIDSTPVFFI 204
            I+STP  FI
Sbjct: 370 KINSTPTLFI 379


>gi|239932915|ref|ZP_04689868.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
          Length = 632

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 63/161 (39%), Gaps = 12/161 (7%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P+T  D   G  DAP+T+VEY    C  CA       + L+ ++    +LRY+ R  PL 
Sbjct: 462 PAT--DHITGPPDAPLTLVEYGDYECPFCAH-ATGVAQELQQRF--GDRLRYVFRHLPLP 516

Query: 112 SVSTVA-VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
            V   + +           G +W    LLF  QD       + D +L  A   G     F
Sbjct: 517 DVHEHSELAARAAVAADAQGRFWQMHDLLFAHQDQ----LEFED-ILGYAGQIGLDVERF 571

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
              L+ +     ++A    A E       P FFIG   + G
Sbjct: 572 LEDLDSERTAARVRADVASA-EASGAQGAPTFFIGNRRHTG 611


>gi|289705219|ref|ZP_06501620.1| DSBA-like thioredoxin domain protein [Micrococcus luteus SK58]
 gi|289558066|gb|EFD51356.1| DSBA-like thioredoxin domain protein [Micrococcus luteus SK58]
          Length = 290

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 77/177 (43%), Gaps = 11/177 (6%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR--YILR 106
           ++ P T+ +        P  +V YA   C HCA+F +   + +E ++++ G++   Y + 
Sbjct: 110 SSQPETLPNTEARGDGEPTRIVLYADFNCVHCADFESSNAEQIE-QWLEQGEVTVDYRMV 168

Query: 107 EF---PLD-SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
           +F   P + + S  A   A C   +    Y GFV+ LF   D+         AL+ +A+ 
Sbjct: 169 DFLSAPNNQNYSARAANAAYCVADQKPEAYNGFVTALFAAYDEHQGKGLDNAALIQLAQE 228

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
            G    D  +C+ D      ++   ++A     +  TP  F+ G  +  D  +  F+
Sbjct: 229 HGV---DISSCVEDGTFRSAVEHTTRQARV-AGVAGTPTVFVDGKNWALDGEDKTFT 281


>gi|110667760|ref|YP_657571.1| protein-disulfide isomerase [Haloquadratum walsbyi DSM 16790]
 gi|109625507|emb|CAJ51934.1| protein-disulfide isomerase [Haloquadratum walsbyi DSM 16790]
          Length = 227

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 72/161 (44%), Gaps = 14/161 (8%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-- 110
           S++   + G  DAPVT+  +    C HC  F  +    +   Y++ G ++Y   +FP+  
Sbjct: 54  SSLPTPTRGSDDAPVTVAVFEDFACPHCQTFSLEVAPKIVSNYVEQGDVQYQYFDFPIPV 113

Query: 111 DSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
              S  A   +R   +K  D  ++ F++ ++ +Q + +N+  Y+  + ++A     S  +
Sbjct: 114 SEWSWRAASASRAVHDKAGDKAFFDFITSVYEQQSE-LNTNGYQ-IVHDIA-----SPTE 166

Query: 170 FDTCL----NDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            D C       Q     +    ++   D  +DSTP  F+ G
Sbjct: 167 VDDCFVAASAKQEPYRPVIEDTRQQGVDRGVDSTPTIFVNG 207


>gi|29824954|gb|AAO92066.1| disulfide oxidoreductase [Ehrlichia sp. Anan]
          Length = 246

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 69/149 (46%), Gaps = 12/149 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S G KD+ V  +E+   +C +C        + ++D     GK+R I R+FP+   +++  
Sbjct: 87  SAGNKDSNVVFIEFFDYSCGYCKMMSEDMKQIVQD-----GKVRVIFRDFPILGEASLKA 141

Query: 119 MLARCAEKRMD-GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL-ND 176
           + A  A   +D   Y  F     + +  + +     +++LN+ K  G ++ DF   L  +
Sbjct: 142 VQAALAIHLIDPSKYLEFYYAALSHKQQFSD-----ESILNIVKSIGIAEEDFKISLAKN 196

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            N ++ +    ++ +E+  I  TP   IG
Sbjct: 197 SNTIEKMIQSTRKLAENMNIRGTPAIIIG 225


>gi|289582068|ref|YP_003480534.1| disulfide bond formation protein [Natrialba magadii ATCC 43099]
 gi|289531621|gb|ADD05972.1| disulfide bond formation protein [Natrialba magadii ATCC 43099]
          Length = 207

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DA VT+  Y   +C  C +F       LE++Y+++G +RY  R+FP+    T +  L
Sbjct: 36  GNPDADVTVAVYEDFSCPFCRDFKLGVLPELEEQYLESGDVRYEHRDFPIPVDDTWSWAL 95

Query: 121 ARCA----EKRMDGGYWGFVSLLFNKQDDWINSKNY 152
              A    E   +  +W F S ++     ++ S NY
Sbjct: 96  PSAAREVFESEGNDAFWEFTSEIYT----YLGSYNY 127


>gi|78355210|ref|YP_386659.1| DSBA-like thioredoxin domain-containing protein [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78217615|gb|ABB36964.1| DSBA-like thioredoxin domain protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 270

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 77/172 (44%), Gaps = 22/172 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTVA 117
           G +DAPVT+V Y+  TC +CA+    T   L + Y   GK+R + + +PL   D+  T +
Sbjct: 103 GPQDAPVTIVAYSDFTCPYCAQAAG-TVAALMEHY--KGKVRLVFKHYPLKSHDNAETAS 159

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWIN------SKNYRDALLNMAKFAGFSKNDFD 171
            M    A  + +   W     +F ++   I       S    +  L+ A+ A  +++D  
Sbjct: 160 RMFV-AAAMQDEAKAWALYDAMFVERARVIKEGSAFISAKAAELGLDAARLARDAQSDAA 218

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           T +  ++         ++ +E+  ++ TP F +   +  G +    F+  +D
Sbjct: 219 TRILRED---------RQEAENLGLEGTPTFLVNDIVVRGSLPLPQFADAVD 261


>gi|291441264|ref|ZP_06580654.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
 gi|291344159|gb|EFE71115.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
          Length = 626

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 63/161 (39%), Gaps = 12/161 (7%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P+T  D   G  DAP+T+VEY    C  CA       + L+ ++    +LRY+ R  PL 
Sbjct: 456 PAT--DHITGPPDAPLTLVEYGDYECPFCAH-ATGVAQELQQRF--GDRLRYVFRHLPLP 510

Query: 112 SVSTVA-VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
            V   + +           G +W    LLF  QD       + D +L  A   G     F
Sbjct: 511 DVHEHSELAARAAVAADAQGRFWQMHDLLFAHQDQ----LEFED-ILGYAGQIGLDVERF 565

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
              L+ +     ++A    A E       P FFIG   + G
Sbjct: 566 LEDLDSERTAARVRADVASA-EASGAQGAPTFFIGNRRHTG 605


>gi|295394315|ref|ZP_06804542.1| possible disulfide bond formation protein [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294972838|gb|EFG48686.1| possible disulfide bond formation protein [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 261

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 69/176 (39%), Gaps = 4/176 (2%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
           T    +IG  +A V + E+    C  CA FHN     L+ KY+ TGK+R+          
Sbjct: 81  TEDSAAIGDVNASVVITEWTDPRCPFCAHFHNDILPELKKKYVDTGKVRFEFITVAFFGE 140

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDT 172
            +     A  A  +  G Y  F   L+    +  +     + L+  AK AG      F  
Sbjct: 141 QSAVAGAAMEAAGKQ-GKYREFSDALYAAAPEKGHPDLPEETLVKFAKTAGVEDIEQFRK 199

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFI--GGNLYLGDMSEGVFSKIIDSMI 226
            +ND  ++D +      A + + I + P F    G +   G      FS+ ID  +
Sbjct: 200 DMNDSELIDAVGEATVTAQQYYGIQAVPFFAASDGESALRGAQPVENFSEFIDEQL 255


>gi|85709146|ref|ZP_01040212.1| protein-disulfide isomerase [Erythrobacter sp. NAP1]
 gi|85690680|gb|EAQ30683.1| protein-disulfide isomerase [Erythrobacter sp. NAP1]
          Length = 245

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 72/178 (40%), Gaps = 27/178 (15%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
           T +   IG  +A  +++E+ S TC HCA F  +    L+   +  G +   +R    +++
Sbjct: 47  TERGFRIGNPNAEASLIEFISYTCGHCATFAKEGEGALDLTVLAPGHMNLEIRPVIRNAI 106

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN-------------SKNYRDALLNMA 160
                +L +C +     G      +   +QD W+              ++  R +  NMA
Sbjct: 107 DLTVSLLVQCGDV---SGMKDRHRMFLTRQDSWMAKAQRAPQSQMQSWARGDRASRANMA 163

Query: 161 KF---------AGFSKNDFDTCL-NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
                       G S+ +   CL +D+  L  I+ G     E+FA+  TP F + G L
Sbjct: 164 AALDFDDMLANTGMSRVEISACLADDEAALALIRNGDAD-REEFAVPGTPSFALDGEL 220


>gi|163735632|ref|ZP_02143063.1| DSBA oxidoreductase [Roseobacter litoralis Och 149]
 gi|161391060|gb|EDQ15398.1| DSBA oxidoreductase [Roseobacter litoralis Och 149]
          Length = 219

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 87/215 (40%), Gaps = 32/215 (14%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS- 59
           +++S   +GV G     F  + +F TR G      P+   + D         + ++  S 
Sbjct: 6   LILSVLALGVAG-----FGGATWFATRPGPVAEAEPVAPELAD---------AMIRPYSP 51

Query: 60  -IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLD-SVSTV 116
            +G  +APVT+VE+    C  C  FH      ++D   + G  +R ++R  P   + S  
Sbjct: 52  ILGPAEAPVTIVEFFDPACEACRAFH----PIVKDIMAEHGDAVRVVIRYTPFHGAASEE 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLN 175
           A+ +   A  RM   Y   +  +  +Q  W +       L L +A  AG       T   
Sbjct: 108 AIRVLEAA--RMQDVYVPVLEAVLREQPRWASHGAPAPGLILQIAATAGLDAEAART--- 162

Query: 176 DQNILDDIKA--GKKRAS-EDFAIDSTPVFFIGGN 207
            Q +  D+ A   + RA  E   I  TP FF+ G 
Sbjct: 163 -QMLAPDVVAILNQDRADVETVGIRQTPTFFVNGK 196


>gi|116329889|ref|YP_799607.1| protein-disulfide isomerase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116123578|gb|ABJ74849.1| Protein-disulfide isomerase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 406

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 81/190 (42%), Gaps = 23/190 (12%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSI-GQKDAPVTMVEYASMTCFHCAEFHNKT 87
           GSA  E  IP+ + +F          +KDV I G  +AP+T+V+YA   C HC    +K 
Sbjct: 199 GSADGEKSIPEQLKEFETAQTVQID-LKDVPILGDLNAPITIVKYADFNCGHCMH-TSKI 256

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAV-------------MLARCAEKRMDGGYWG 134
            K   ++Y   G ++   + FPLD      V               A CA ++    ++ 
Sbjct: 257 LKSFLNEY--EGIIKVAYKNFPLDGNCNRLVGRKSPEASSCIAASAALCANQQ--NKFYP 312

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
             + L++  D+     +    +  +A+ +G   + F  C++   I D I      A E  
Sbjct: 313 VYTGLYD--DNEAGVMHTAATVTRLAEKSGLKMDQFRACMSSTKIRDHINREVDEA-EKL 369

Query: 195 AIDSTPVFFI 204
            I+STP  F+
Sbjct: 370 KINSTPTLFV 379


>gi|262184070|ref|ZP_06043491.1| putative secreted protein [Corynebacterium aurimucosum ATCC 700975]
          Length = 261

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 69/170 (40%), Gaps = 4/170 (2%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DAPV + E++   C  C+   N T   L  KY++ G +R    +FP++  + V  
Sbjct: 88  AVGAVDAPVVISEFSDFECPFCSRHANVTEPDLLKKYVEKGLVRIEWNDFPVNGPAAVEA 147

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKND-FDTCLND 176
             A  A     G +  F   L+    D      +  +  +  A+ AG +  D F     D
Sbjct: 148 AKAGRAAAAQ-GKFQEFKHELYTASKDISGHPEFGIEDFMKFAEKAGVADLDKFRQQATD 206

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
               + I+     AS+   I  TP F +G     G     VF +II   +
Sbjct: 207 DTYTEVIEKATSYASQ-IGITGTPAFVVGDQFVGGAQPPEVFEQIIQEQL 255


>gi|258624167|ref|ZP_05719117.1| Protein-disulfide isomerase [Vibrio mimicus VM603]
 gi|258583598|gb|EEW08397.1| Protein-disulfide isomerase [Vibrio mimicus VM603]
          Length = 286

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (46%), Gaps = 13/165 (7%)

Query: 46  ALLAASPSTMKDVS--IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
           A   A+P  +++     G   A  T+VE++ M C  C +FH+ T K + D     G + +
Sbjct: 90  AQFEAAPEKVEEGKHIYGDLGARFTLVEFSDMECPFCKQFHD-TPKQIVD--ASKGNVNW 146

Query: 104 ILREFPLDSVSTVA---VMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
             +  PLD  +  A    + A C AE++ + G+W FV+ +F+      N     D L ++
Sbjct: 147 QWKHMPLDFHNPAAHKEALAAECIAEQKGNRGFWVFVNDIFHHTQG--NGGGVAD-LASV 203

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
               G   + F  CL      D ++A  ++A + + ++ TP  F+
Sbjct: 204 VTGVGADLDAFRECLGSGKYEDKVEADIQKA-KSYGVNGTPATFV 247


>gi|302535748|ref|ZP_07288090.1| DSBA oxidoreductase [Streptomyces sp. C]
 gi|302444643|gb|EFL16459.1| DSBA oxidoreductase [Streptomyces sp. C]
          Length = 237

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 73/174 (41%), Gaps = 11/174 (6%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
             + +AL    P     +++G+ DAPV ++EY+   C +C +F   T   L  +Y++ G 
Sbjct: 52  AAELKALARREPGDK--LAVGRTDAPVVLIEYSDFKCGYCGKFARDTEPELVKRYVEDGT 109

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNM 159
           LR   R FP+    + +   A  A  + D     F +       +   +K +  D L+ +
Sbjct: 110 LRIEWRNFPIFGAESESAAKAAWAAGQQD----RFTAFHAAAYAEGAKAKGFGEDRLVEL 165

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF--AIDSTPVFFIGGNLYLG 211
           A+ AG    D D    D        A ++   E +   + STP F + G    G
Sbjct: 166 AREAGVP--DLDRFKADLAGEQAAAALRRDQEEGYRIGVQSTPSFLVNGQPIAG 217


>gi|296532649|ref|ZP_06895348.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
 gi|296267020|gb|EFH12946.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
          Length = 214

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 70/176 (39%), Gaps = 14/176 (7%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
           P+P G  D R +   SP       IG+ DA VT+VE+   +C  C  FH    + L    
Sbjct: 33  PVPAGQDD-RFVRPHSPV------IGKPDAAVTLVEFFDPSCEACRAFHPLLNRMLAQ-- 83

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW-INSKNYRD 154
              G+LR +LR  P    S  AV +   A  R+   +   +  LF +Q DW ++     +
Sbjct: 84  -HAGQLRMVLRYAPFHEGSDEAVRILEAA--RLQDRFEPVLDALFARQPDWAMHGAPDLE 140

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           A   +A  AG              I   + A      +   +  TP FF+ G   L
Sbjct: 141 AAWRIAGIAGLDLPRARRDARRPEI-GRVLAIDGEDLQALQVRQTPTFFVNGKPLL 195


>gi|260906414|ref|ZP_05914736.1| DSBA oxidoreductase [Brevibacterium linens BL2]
          Length = 247

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 70/167 (41%), Gaps = 3/167 (1%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPVT+V ++   C +CA +   T   + D Y+ +G LR   RE  +   ++     
Sbjct: 81  GPVDAPVTLVVFSDYQCPYCAAWSQDTLPTMLD-YVDSGDLRIEWREVNVFGSASEQAAE 139

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A  A    D  +W F   LF         +   +AL ++A   G   + F+  +N     
Sbjct: 140 AAYAAALQD-KHWEFHEKLFAGGKPRSPEELSPEALTSVAADIGLDMDQFEEDMNSSETA 198

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           + +       +E  A  STP F +    Y+G     VF   I++ ++
Sbjct: 199 EAVDKNAAMGTELGAF-STPTFILDSQPYVGAQPTSVFVDAIEAKLE 244


>gi|148547207|ref|YP_001267309.1| DSBA oxidoreductase [Pseudomonas putida F1]
 gi|148511265|gb|ABQ78125.1| DSBA oxidoreductase [Pseudomonas putida F1]
          Length = 179

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 70/164 (42%), Gaps = 16/164 (9%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P +  D   G   A VT+VE+    C +C E +    K L+  +     L ++ R FPL 
Sbjct: 7   PVSADDHRQGSAHAKVTLVEFGDYECPYCGEAY-WMVKNLQQHF--RDDLLFVFRNFPLT 63

Query: 112 SVSTVAVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           +    A+  A  AE     G +W     L+  QD  +    YR  +L      G S+ +F
Sbjct: 64  TAHPHALGAAVTAEYAGSRGFFWEAHDGLYENQDR-LGLPLYRAIVLKH----GLSREEF 118

Query: 171 DTCLNDQNILDDIKA---GKKRASEDFAIDSTPVFFIGGNLYLG 211
           D  + +   +  I+A   G  R+     ++ TP F+I G  Y G
Sbjct: 119 DLAMQEDTYIPKIQADFNGGVRS----GVNGTPAFYIDGLRYDG 158


>gi|159035860|ref|YP_001535113.1| DSBA oxidoreductase [Salinispora arenicola CNS-205]
 gi|157914695|gb|ABV96122.1| DSBA oxidoreductase [Salinispora arenicola CNS-205]
          Length = 220

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 69/165 (41%), Gaps = 7/165 (4%)

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           D  VT+VE+    C  CA  +    + L       G++ +++R FP+ S     +     
Sbjct: 59  DGKVTLVEFLDFECEACAAAYPAVKEIL---TAYEGQITFVVRYFPIPSHPNAELAAHTA 115

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G + G   +LF  Q  W + +  + +  L+ A+  G   + F   L+D   +  
Sbjct: 116 QAAANQGHFRGMYQMLFENQSVWGHKEEPQTEVFLDYARALGLDMDRFQRDLDDPATV-- 173

Query: 183 IKAGKKRA-SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            +  + RA  E   +  TP FF+ G+      S+   + +ID+ +
Sbjct: 174 ARVARDRADGEAVGVQGTPTFFLNGSPLTDLRSKDDLTAMIDAAL 218


>gi|296282455|ref|ZP_06860453.1| protein-disulfide isomerase [Citromicrobium bathyomarinum JL354]
          Length = 257

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 69/174 (39%), Gaps = 34/174 (19%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF----PLDSVST 115
           +G  DAP+ +VEY S+TC  CA F  +  + L + Y+ +G++ +  R F    PLD   T
Sbjct: 70  VGNPDAPIKLVEYGSLTCPACAAFSMQASEPLMNDYVDSGRVNFEFRSFVIHGPLDLALT 129

Query: 116 VAVMLARCAEKR----MDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAK------FA- 163
               L  C        +    W  +  +       +  +  + +A LN+ +      FA 
Sbjct: 130 ---RLVDCGTPEQAVPLADQVWANLPTIMQP----LQERGPQLEAALNLPEDQRFVAFAD 182

Query: 164 -----------GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                      G S++   TCL D   L +I    +       I  TP F + G
Sbjct: 183 TAGLLDFFAARGVSRDQARTCLADAGRLSEIADVSETYGTQDDITQTPTFVLNG 236


>gi|284990329|ref|YP_003408883.1| cyclic nucleotide-binding protein [Geodermatophilus obscurus DSM
           43160]
 gi|284063574|gb|ADB74512.1| cyclic nucleotide-binding protein [Geodermatophilus obscurus DSM
           43160]
          Length = 876

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 53/206 (25%), Positives = 78/206 (37%), Gaps = 15/206 (7%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R+GVL   VL  +  +  +      L +   P G      LL       +D   G  DAP
Sbjct: 410 RVGVLVASVLAALLGWALFR-----LADRRRPPGAGARPVLLDPPVDVDRDHVRGPADAP 464

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA-VMLARCAE 125
           +T+VEY    C  C      T + L +++    +LRY+ R  PL  V   A +       
Sbjct: 465 LTLVEYGDFECPFCGR-ATGTVEELRERF--GDRLRYVFRHVPLVGVHPHARLAAEAAEA 521

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
               G +W     LF  QD  + +      LL  A  AG   + F   L        ++ 
Sbjct: 522 ADAQGRFWEMHDRLFAGQDRLMPTD-----LLEHAAAAGLDVSRFARDLGSSRFARRVEE 576

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLG 211
             + A E   +  TP FF+ G  + G
Sbjct: 577 DVESA-EASGVTGTPTFFVNGRRHTG 601


>gi|116623614|ref|YP_825770.1| protein-disulfide isomerase-like protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116226776|gb|ABJ85485.1| Protein-disulfide isomerase-like protein [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 198

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 45/110 (40%), Gaps = 7/110 (6%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           AA P   K  ++G   AP+ M  Y+  TC HC   H +    L   Y+ TGK   +  E+
Sbjct: 16  AAGPEIEKSRTMGNPSAPLRMDLYSDFTCPHCKMLHEQILPKLVADYVSTGKAYLVFHEY 75

Query: 109 ----PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW-INSKNYR 153
               P    S  A + A  A K   G Y      LF  Q  W +N K + 
Sbjct: 76  TLTGPGHEHSKTASLYADAAAK--IGKYQQVSDALFATQSSWALNGKVWE 123


>gi|24212827|ref|NP_710308.1| hypothetical protein LA_0127 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24193480|gb|AAN47326.1| hypothetical protein LA_0127 [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 404

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 82/190 (43%), Gaps = 23/190 (12%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSI-GQKDAPVTMVEYASMTCFHCAEFHNKT 87
           G+A  E  I + + +F  +   S   +KDV + G  +AP+T+V+YA   C HC    +K 
Sbjct: 199 GAANGEKSISEQLKEFGTIPTVSID-LKDVPVVGDPNAPITIVKYADFNCGHCMH-TSKI 256

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAV-------------MLARCAEKRMDGGYWG 134
            K    +Y   G ++   + FPLD      V               A CA ++    ++ 
Sbjct: 257 LKSFLSEY--NGIIKVAYKNFPLDGNCNRLVGRKSPEASSCVAASAALCANEQKK--FYP 312

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
             + L++  D+     +    +  +A+  G + N F +C++   I D I      A E  
Sbjct: 313 IYTGLYD--DNEAGVMHTAVTVTRLAEKNGLNMNQFRSCMSSTKIRDQINREVDEA-EKL 369

Query: 195 AIDSTPVFFI 204
            I+STP  FI
Sbjct: 370 KINSTPTLFI 379


>gi|83952895|ref|ZP_00961624.1| dsbA-like thioredoxin domain protein [Roseovarius nubinhibens ISM]
 gi|83835686|gb|EAP74986.1| dsbA-like thioredoxin domain protein [Roseovarius nubinhibens ISM]
          Length = 219

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 87/215 (40%), Gaps = 32/215 (14%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS- 59
           +++S   +GV G     F  + +F TR G      P+   + D         + ++  S 
Sbjct: 6   LILSVLALGVAG-----FGGATWFATRPGPLAEAEPVAPELAD---------AMIRPYSP 51

Query: 60  -IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLD-SVSTV 116
            +G  +APVT+VE+    C  C  FH      ++D   + G  +R ++R  P   + S  
Sbjct: 52  ILGPAEAPVTIVEFFDPACEACRAFH----PIVKDIMAEHGDAVRVVIRYTPFHGAASEE 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLN 175
           A+ +   A  RM   Y   +  +  +Q  W         L L +A  AG   +   T   
Sbjct: 108 AIRVLETA--RMQDVYVPVLEAVLREQPRWAAHGAPEPGLILQIAATAGLDADAART--- 162

Query: 176 DQNILDDIKA--GKKRAS-EDFAIDSTPVFFIGGN 207
            Q +  D+ A   + RA  E   I  TP FF+ G 
Sbjct: 163 -QMLAPDVVAILNQDRADVETVGIRQTPTFFVNGT 196


>gi|298251327|ref|ZP_06975130.1| DSBA oxidoreductase [Ktedonobacter racemifer DSM 44963]
 gi|297545919|gb|EFH79787.1| DSBA oxidoreductase [Ktedonobacter racemifer DSM 44963]
          Length = 179

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 65/166 (39%), Gaps = 18/166 (10%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P + +D  +G + APVT+VEY    C +C   H    + L+   +   +LR + R FPL
Sbjct: 12  PPVSKQDHVLGPESAPVTLVEYGDYECPYCGMAHLTVKEVLQ---LLGDQLRLVFRHFPL 68

Query: 111 DSVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
             +                 G +W     LF  Q    ++      L+  A      K+ 
Sbjct: 69  IQIHPHAERAAEAAEAAGAQGKFWAMHDTLFEHQRALDDTH-----LVLYATALDLDKDR 123

Query: 170 FDTCLNDQN----ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           F   L +      ++ D+ +G +       ++ TP FFI G  Y G
Sbjct: 124 FVRELAEHKYADRVIKDLLSGARS-----GVNGTPTFFINGLRYEG 164


>gi|227832075|ref|YP_002833782.1| putative secreted protein [Corynebacterium aurimucosum ATCC 700975]
 gi|227453091|gb|ACP31844.1| putative secreted protein [Corynebacterium aurimucosum ATCC 700975]
          Length = 289

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 69/170 (40%), Gaps = 4/170 (2%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DAPV + E++   C  C+   N T   L  KY++ G +R    +FP++  + V  
Sbjct: 116 AVGAVDAPVVISEFSDFECPFCSRHANVTEPDLLKKYVEKGLVRIEWNDFPVNGPAAVEA 175

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKND-FDTCLND 176
             A  A     G +  F   L+    D      +  +  +  A+ AG +  D F     D
Sbjct: 176 AKAGRAAAAQ-GKFQEFKHELYTASKDISGHPEFGIEDFMKFAEKAGVADLDKFRQQATD 234

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
               + I+     AS+   I  TP F +G     G     VF +II   +
Sbjct: 235 DTYTEVIEKATSYASQ-IGITGTPAFVVGDQFVGGAQPPEVFEQIIQEQL 283


>gi|157693761|ref|YP_001488223.1| disulfide dehydrogenase D [Bacillus pumilus SAFR-032]
 gi|157682519|gb|ABV63663.1| disulfide dehydrogenase D [Bacillus pumilus SAFR-032]
          Length = 228

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 59/170 (34%), Gaps = 23/170 (13%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           + PS      IG K+A V +VE+    C  C  F    F  L+  YI  G + +     P
Sbjct: 44  SKPSIQGQPVIGDKNAAVQIVEFGDYKCPSCKSFETDIFPKLKADYIDKGDVSFSFINLP 103

Query: 110 LDSVSTVAVMLARCAE---KRMDGGYWGFVSLLFNKQDD----WINSKNYRDALLNMAKF 162
           L      AV+ A  +E   K     +W F   ++  Q D    W+      +      K 
Sbjct: 104 LPVHGDGAVLAALASEEVWKEDPKNFWAFHEAVYQAQPDSEAEWVTPAKLTELAKKTTKI 163

Query: 163 ------AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                    SK  +   LN  N L             + ++STP  FI  
Sbjct: 164 DTDKLKDHLSKKTYQPQLNTDNQL----------VNKYKVNSTPTIFINN 203


>gi|189219630|ref|YP_001940271.1| protein-disulfide isomerase [Methylacidiphilum infernorum V4]
 gi|189186488|gb|ACD83673.1| Protein-disulfide isomerase [Methylacidiphilum infernorum V4]
          Length = 381

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 66/173 (38%), Gaps = 6/173 (3%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           GQ  APV ++EY    C  C  ++    K L+D     G L  I R  P       A + 
Sbjct: 53  GQVRAPVFLIEYVDFQCPVCKRYNETVNKLLKD---YQGNLSVIYRHKP-SQTHPYAFIA 108

Query: 121 ARCAEKR-MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           A  AE   ++G +W  V LLF  Q+ W    +        A      +  F   L    +
Sbjct: 109 ALSAEAAGLEGRFWPMVDLLFENQERWAGVADPIKLFKEYALALNIPEEKFMQNLRKPEL 168

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
            D I     ++S    +   P F +GG       S   F  ++++ +  S +R
Sbjct: 169 RDKI-FKDLQSSFILGMTRVPSFILGGERIPNPQSYEDFKILVEAALIKSKKR 220


>gi|332528887|ref|ZP_08404857.1| disulfide isomerase-like protein [Hylemonella gracilis ATCC 19624]
 gi|332041644|gb|EGI78000.1| disulfide isomerase-like protein [Hylemonella gracilis ATCC 19624]
          Length = 223

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 79/187 (42%), Gaps = 26/187 (13%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           M     G +DAPVT+VE+    C  C  FH    K L  +Y K  ++R ++R  P    S
Sbjct: 53  MHAAVAGPQDAPVTIVEFFDPACETCRAFH-PIVKDLLRQYPK--EVRLVVRYAPFHPGS 109

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS------KNYRDAL---LNMAK-FAG 164
              V L   A+++  G YW  + ++   Q  W +       K Y  A    LN+ +  A 
Sbjct: 110 DDVVRLLEAAKRQ--GKYWEVLDMVLAAQPLWADHGQPDVGKAYAAAAQTGLNLEQALAD 167

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            +    ++ L  Q+I +D+ A          ++ TP FF+ G   L    E    +++  
Sbjct: 168 AASAGIESVLR-QDI-EDLTA--------LGVNKTPTFFVNGQ-SLPSFGEEPLRRLVAE 216

Query: 225 MIQDSTR 231
            +  + R
Sbjct: 217 EVARAQR 223


>gi|87198980|ref|YP_496237.1| protein-disulfide isomerase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134661|gb|ABD25403.1| protein-disulfide isomerase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 238

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 64/175 (36%), Gaps = 26/175 (14%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   A + +VE+ S TC HC+ F  ++   L+   ++ GK    +R F  D +     +
Sbjct: 51  LGNPAAKLRLVEFVSYTCPHCSHFEIESEGQLKIGMVQPGKGAIEVRNFVRDPIDMTVAL 110

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWI----NSKNYRDALLNMAKFA------------ 163
           +  C        ++   +     Q  WI    NS   +        FA            
Sbjct: 111 ITNCVPPSR---FFTLHTAFMRSQAQWIGPLANSTEAQRQRWFNGTFATRTRAIASDFRF 167

Query: 164 -------GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
                  G  ++  D CL+++ +   + A    A   + +  TP F I G L  G
Sbjct: 168 YDFMAARGMDRSTLDRCLSNEALAKKLAAETDEAINQYNVSGTPSFMIDGILLAG 222


>gi|296272843|ref|YP_003655474.1| DsbA oxidoreductase [Arcobacter nitrofigilis DSM 7299]
 gi|296097017|gb|ADG92967.1| DsbA oxidoreductase [Arcobacter nitrofigilis DSM 7299]
          Length = 213

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 95/234 (40%), Gaps = 36/234 (15%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
            T  I ++  I L F+  YF+   K S   ++      V  R            + IG K
Sbjct: 5   KTVLIVIVALIGLFFVGGYFYKQNKASEFGKVASEKAEVFQRDY---------SLVIGPK 55

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK-TGKLRYILREFPLDSVSTVAVMLAR 122
           DA V +VE+    C  CA +    + +++D   K  G ++ +LR  P  + +  AV +  
Sbjct: 56  DAKVQLVEFFDPACGTCAYY----YPFVKDLIKKHKGDIKLVLRYAPFHANANYAVKMLE 111

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNY----------RDALLNMAKFAGFSKNDFDT 172
            A  R    +   + L+F  Q+ W++              +  +L+M K +       D 
Sbjct: 112 GA--REQNLFKETLELMFATQNQWLDGHGVVPRKLWIVLEKSNILDMKKLS----KSMDN 165

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            + D+ I  D+   +        +  TP FF+ G + L D+S     K+I+S +
Sbjct: 166 LMYDKIIEQDLDDARV-----LNVRGTPSFFVNG-IPLQDLSGENLQKLIESQL 213


>gi|18313962|ref|NP_560629.1| hypothetical protein PAE3285 [Pyrobaculum aerophilum str. IM2]
 gi|18161535|gb|AAL64811.1| hypothetical protein PAE3285 [Pyrobaculum aerophilum str. IM2]
          Length = 211

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 70/163 (42%), Gaps = 12/163 (7%)

Query: 15  VLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYAS 74
           V + IA+   Y+R          P   +D   L    P     +S G+ DAP+T++E   
Sbjct: 13  VFVVIAAITVYSRLAQF-----TPPQQIDVSGL----PLPKWAISFGKTDAPITIIELYD 63

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
           + C  CA  H +    L  + + +GKLR +  +  +   +  A     CA +++    + 
Sbjct: 64  LHCPFCAIAHER-LDPLYRELLNSGKLRLVFLDLIVHPDALQAHQYLHCAYRQLGNKTYD 122

Query: 135 FVSLLFN-KQDDWINSKNYRDALLNMAKFAGF-SKNDFDTCLN 175
            ++ L+    +D +N    +  LL   K     SK+DFD  +N
Sbjct: 123 LITQLYRLLAEDEVNGPGKQLELLQQYKCGDMPSKSDFDNAVN 165


>gi|221215314|ref|ZP_03588279.1| Na+/H+ antiporter NhaA [Burkholderia multivorans CGD1]
 gi|221164746|gb|EED97227.1| Na+/H+ antiporter NhaA [Burkholderia multivorans CGD1]
          Length = 641

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 15/149 (10%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAVM 119
           G +DA +T+VEY    C +CA   + T  + ED     G  LRY++R  P      +A  
Sbjct: 477 GPEDAQLTLVEYVDFECEYCA---HATGSW-EDLRAHFGDDLRYVVRHLPHHPHGPIA-- 530

Query: 120 LARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
            AR +E   + G +W ++  +F +Q         R+ L+  A   G   + F   L+   
Sbjct: 531 -ARASEAASNQGMFWPWLDFVFTRQH-----ALEREDLIGYAAELGLDVDRFIADLDSPA 584

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           +++ ++     A    A  +TP FF+ G 
Sbjct: 585 VIERVERDLASAVASGA-HATPTFFVEGR 612


>gi|326332474|ref|ZP_08198748.1| Na+/H+ antiporter, NhaA family [Nocardioidaceae bacterium Broad-1]
 gi|325949728|gb|EGD41794.1| Na+/H+ antiporter, NhaA family [Nocardioidaceae bacterium Broad-1]
          Length = 204

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 63/165 (38%), Gaps = 9/165 (5%)

Query: 47  LLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR 106
           +LA      +D   G  DA VT++EY    C  CA     T    E +     ++RY++R
Sbjct: 21  VLATPVDPARDHIYGDVDAEVTLLEYLDYECPFCA---RATGTANEVRNYFGSRIRYVVR 77

Query: 107 EFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
             PL       +           G +W     LF+ Q    N   ++D L   A   G  
Sbjct: 78  HLPLPQHPHAELAAVAAEAAARQGRFWEMHKHLFDHQ----NELEHKD-LAGYAGVLGLD 132

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
              F   L D  + + ++     A+ D     TP FF+G + + G
Sbjct: 133 VEQFLRDLEDPALAEHVREDMASAN-DSGARGTPTFFVGSHRHEG 176


>gi|118602040|ref|YP_908740.1| hypothetical protein P91278ORF_142 [Photobacterium damselae subsp.
           piscicida]
 gi|118614780|ref|YP_908563.1| hypothetical protein P99018ORF_152 [Photobacterium damselae subsp.
           piscicida]
 gi|134044624|ref|YP_001101708.1| DSBA-like thioredoxin domain-containing protein [Yersinia ruckeri]
 gi|134044822|ref|YP_001102083.1| DSBA-like thioredoxin domain-containing protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|134047262|ref|YP_001101893.1| DSBA-like thioredoxin domain-containing protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|165937963|ref|ZP_02226523.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|229516097|ref|ZP_04405547.1| protein-disulfide isomerase [Vibrio cholerae RC9]
 gi|237640202|ref|YP_002891057.1| hypothetical protein peH4H_0014 [Escherichia coli]
 gi|237809922|ref|YP_002894361.1| hypothetical protein pAR060302_0015 [Escherichia coli]
 gi|237810111|ref|YP_002894550.1| hypothetical protein pAM04528_0014 [Salmonella enterica]
 gi|300925749|ref|ZP_07141607.1| DSBA-like thioredoxin domain protein [Escherichia coli MS 182-1]
 gi|118596871|dbj|BAF38175.1| hypothetical protein P99018ORF_152 [Photobacterium damselae subsp.
           piscicida]
 gi|118597049|dbj|BAF38352.1| hypothetical protein P91278ORF_142 [Photobacterium damselae subsp.
           piscicida]
 gi|133904987|gb|ABO41004.1| DSBA-like thioredoxin domain protein [Yersinia ruckeri]
 gi|133905181|gb|ABO41196.1| DSBA-like thioredoxin domain protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|133905356|gb|ABO42118.1| DSBA-like thioredoxin domain protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165913986|gb|EDR32603.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|229346877|gb|EEO11845.1| protein-disulfide isomerase [Vibrio cholerae RC9]
 gi|229561421|gb|ACQ77624.1| conserved hypothetical protein [Escherichia coli]
 gi|229561595|gb|ACQ77797.1| conserved hypothetical protein [Salmonella enterica]
 gi|229561777|gb|ACQ77978.1| conserved hypothetical protein [Escherichia coli]
 gi|300418171|gb|EFK01482.1| DSBA-like thioredoxin domain protein [Escherichia coli MS 182-1]
 gi|324007587|gb|EGB76806.1| DSBA-like thioredoxin domain protein [Escherichia coli MS 57-2]
 gi|327536451|gb|AEA95284.1| periplasmic thiol:disulfide interchange protein DsbA [Salmonella
           enterica subsp. enterica serovar Dublin]
 gi|332144542|dbj|BAK19762.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium]
          Length = 286

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 76/165 (46%), Gaps = 13/165 (7%)

Query: 46  ALLAASPSTMKDVS--IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
           A   A+P  +++     G   A  T+VE++ M C  C  FH+ T K + D     G + +
Sbjct: 90  AQFEAAPEKVEEGKHIYGDLGARFTLVEFSDMECPFCKRFHD-TPKQIVD--ASKGNVNW 146

Query: 104 ILREFPLDSVSTVA---VMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
             +  PLD  +  A    + A C AE++ + G+W FV+ +F+      N     D L ++
Sbjct: 147 QWKHMPLDFHNPAAHKEALAAECIAEQKGNRGFWVFVNDIFHHTQG--NGGGVAD-LASV 203

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
               G   + F  CL      D ++A  ++A + + ++ TP  F+
Sbjct: 204 VTGVGADLDAFRECLGSGKYEDKVEADIQKA-KSYGVNGTPATFV 247


>gi|315605960|ref|ZP_07880991.1| conserved hypothetical protein [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315312242|gb|EFU60328.1| conserved hypothetical protein [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 295

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 6/146 (4%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APVT+V ++   C +C +F  +    L D  ++ G LR  +  + L  ++  + + 
Sbjct: 127 GDINAPVTLVIFSDFACPYCTKFAQEIDPALAD-LVEDGTLR--VEWYDLAQITESSPLA 183

Query: 121 ARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQN 178
           A+        G +W F   ++   D   + +  +DAL++ A  AG S    F   + D++
Sbjct: 184 AQAGIAAGEQGKFWEFHDAVYAAADPTGHPQYSQDALVDFAAKAGVSDLEKFRATMLDEH 243

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFI 204
               + A K+RA +   I  TP  FI
Sbjct: 244 TAAKVSAAKERAHQ-AGITGTPTMFI 268


>gi|329944877|ref|ZP_08292904.1| DsbA-like protein [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328529688|gb|EGF56584.1| DsbA-like protein [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 259

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 64/167 (38%), Gaps = 6/167 (3%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G+ DAPV MV Y+   C +C +F  K    L D  +  G LR   R+    S  T  +  
Sbjct: 77  GKVDAPVVMVIYSDFACPYCTQFAQKVEPELAD-LVDQGTLRIEWRDLAQIS-PTSPLAA 134

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                    G +W     ++   D   + +   D+L+  AK AG +  D +   +D N  
Sbjct: 135 QAGRAAAKQGRFWELHDAVYAAADPQGHPEYTEDSLVAFAKRAGVA--DIEKFRSDMNAA 192

Query: 181 DDIKA--GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + + A    K  +    I  TP   +G     G         +I+S 
Sbjct: 193 ETVSAVTEAKNHAHSIGITGTPFMIVGETFISGFQDADYMKAVINSQ 239


>gi|115371834|ref|ZP_01459147.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310824163|ref|YP_003956521.1| DSBA-like thioredoxin domain-containing protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115371069|gb|EAU69991.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309397235|gb|ADO74694.1| DSBA-like thioredoxin domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 667

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 89/210 (42%), Gaps = 30/210 (14%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIG------QKDAPVTMVEYASMTCFHCAE 82
            + L E+P P G+ +   L    P     V IG       KDAP+T+V ++   C +CA 
Sbjct: 459 ANGLEEIPEP-GLAELPPL----PKGTYTVDIGGSPTRGPKDAPITLVTFSDFQCPYCAR 513

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFP-LD--SVSTVAVMLARCAEKRMDGGYWGFVSLL 139
              KT   L ++Y    +LR + ++ P LD    + +A    R A ++  G +W     +
Sbjct: 514 L-EKTLARLGEEY--GDRLRVVWKDAPNLDFHKEAMLAHEAGRAAGEQ--GRFWEMHHQI 568

Query: 140 FNKQ---DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
           F +          K  R+  L+M +F    +   D+  + + I ++   G   A +    
Sbjct: 569 FRRPYLLGRPTLEKYARELGLDMERF----RAALDSGKHQEAIREEFAYGVSLAGQ---- 620

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             TP  F+ G L  G    GV  +II+  +
Sbjct: 621 SGTPTLFLNGRLIPGAYPYGVLRQIIEEEL 650


>gi|296100202|ref|YP_003617119.1| hypothetical protein pDK1_p034 [Pseudomonas putida]
 gi|295443568|dbj|BAJ06447.1| hypothetical protein [Pseudomonas putida]
          Length = 282

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 67/152 (44%), Gaps = 11/152 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTVA 117
           G KDA  T+VE+  + C +C  FH+ T K + DK    G++ +  + +PL   +  + VA
Sbjct: 88  GSKDAQFTLVEFVDLECPYCKRFHD-TPKQMADK--SEGRINWEWQHYPLAFHNPAAEVA 144

Query: 118 VMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
              + C  E   +  +W F    F +    +N +   D +  +A+  G   + +  C+  
Sbjct: 145 AHASECVGEVAGNKAFWAFTGEWFARTQ--LNGQGVED-VERLAQEVGAPLDAYRQCMES 201

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
                 I+ G+ +   +  +  TP   +  NL
Sbjct: 202 GKYRALIE-GQVKKGTNMGVTGTPATVVVDNL 232


>gi|225734328|pdb|3GMF|A Chain A, Crystal Structure Of Protein-Disulfide Isomerase From
           Novosphingobium Aromaticivorans
          Length = 205

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 64/175 (36%), Gaps = 26/175 (14%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   A + +VE+ S TC HC+ F  ++   L+   ++ GK    +R F  D +     +
Sbjct: 10  LGNPAAKLRLVEFVSYTCPHCSHFEIESEGQLKIGMVQPGKGAIEVRNFVRDPIDMTVAL 69

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWI----NSKNYRDALLNMAKFA------------ 163
           +  C        ++   +     Q  WI    NS   +        FA            
Sbjct: 70  ITNCVPPSR---FFTLHTAFMRSQAQWIGPLANSTEAQRQRWFNGTFATRTRAIASDFRF 126

Query: 164 -------GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
                  G  ++  D CL+++ +   + A    A   + +  TP F I G L  G
Sbjct: 127 YDFMAARGMDRSTLDRCLSNEALAKKLAAETDEAINQYNVSGTPSFMIDGILLAG 181


>gi|194015641|ref|ZP_03054257.1| disulfide bond formation protein D (Disulfide oxidoreductaseD)
           (Thiol-disulfide oxidoreductase D) [Bacillus pumilus
           ATCC 7061]
 gi|194013045|gb|EDW22611.1| disulfide bond formation protein D (Disulfide oxidoreductaseD)
           (Thiol-disulfide oxidoreductase D) [Bacillus pumilus
           ATCC 7061]
          Length = 228

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 60/170 (35%), Gaps = 23/170 (13%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           + PS      IG KDA V +VE+    C  C  F    F  L+  YI  G + +     P
Sbjct: 44  SKPSIKGQPVIGDKDAAVQIVEFGDYKCPSCKSFETDIFPKLKADYIDKGDVSFSFINLP 103

Query: 110 LDSVSTVAVMLARCAE---KRMDGGYWGFVSLLFNKQDD----WINSKNYRDALLNMAKF 162
           L      AV+ A  +E   K     +W +   ++  Q D    W+      +      K 
Sbjct: 104 LPVHGDGAVLAALASEEVWKEDPKNFWAYHEAVYQAQPDSEAEWVTPAKLTELAKKTTKI 163

Query: 163 ------AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                    SK  +   LN     DD    K      + ++STP  FI  
Sbjct: 164 DTDKLKDNLSKKTYQPQLN----TDDQLVNK------YKVNSTPTIFINN 203


>gi|45656025|ref|YP_000111.1| hypothetical protein LIC10115 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45599258|gb|AAS68748.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 404

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 68/166 (40%), Gaps = 26/166 (15%)

Query: 55  MKDVSI-GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
           +KDV + G  +AP+T+V+YA   C HC    +K  K    +Y   G ++   + FPLD  
Sbjct: 224 LKDVPVVGDPNAPITIVKYADFNCGHCMH-TSKILKSFLSEY--NGIIKVAYKNFPLDGN 280

Query: 114 STVAV-------------MLARCA--EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
               V               A CA  +K+    Y G         D+     +    +  
Sbjct: 281 CNRLVGRKSPEASSCVAASAALCANEQKKFYPVYTGLY------DDNEAGVMHTAVTVTR 334

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           +A+  G + N F +C++   I D I      A E   I+STP  FI
Sbjct: 335 LAEKNGLNMNQFRSCMSSTKIRDQINREVDEA-EKLKINSTPTLFI 379


>gi|330469503|ref|YP_004407246.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
 gi|328812474|gb|AEB46646.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
          Length = 185

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 71/181 (39%), Gaps = 22/181 (12%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +P T  D   G  DAPVT+VEY    C  C + H    + L +   +   +R + R FP+
Sbjct: 17  TPVTEHDHVRGPTDAPVTIVEYGDYQCPFCGQAHASLQEVLRE---RADTVRLVYRHFPI 73

Query: 111 DSVSTVAVMLARCAEKR-MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
            ++   A M A  AE     G +W     L+  Q+     +  R  L+   +  G   N+
Sbjct: 74  ANLHPYAEMAAEAAEAAGRRGRFWEMHDWLYEHQE-----QLDRVHLMLGVEQLGLPVNE 128

Query: 170 FDTCLNDQNILDDIKAGKKRASEDF------AIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
            D  +          AG  R   DF       +D++P  F+    + GD         +D
Sbjct: 129 VDAEIGRH-------AGGDRIRHDFVSGIRSGVDASPTLFVNDTRHDGDFDLATLLATVD 181

Query: 224 S 224
           +
Sbjct: 182 A 182


>gi|42523577|ref|NP_968957.1| Thiol:disulfide interchange protein dsbA precursor [Bdellovibrio
           bacteriovorus HD100]
 gi|39575782|emb|CAE79949.1| Thiol:disulfide interchange protein dsbA precursor [Bdellovibrio
           bacteriovorus HD100]
          Length = 402

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 65/166 (39%), Gaps = 28/166 (16%)

Query: 64  DAPV-TMVEYASMTCFHC----AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           D PV T+VE+A   C HC    A  H+ T  + +        +R I + FPLD     A+
Sbjct: 231 DEPVMTIVEFADFRCGHCKHAAAPLHSFTKNHPD--------VRLIYKPFPLDGTCNEAM 282

Query: 119 -------------MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
                            C+EK    G W     +F+ Q++     N    L ++AK  G 
Sbjct: 283 KGGGGDGISCGLAFATLCSEKIAQKG-WVAHDYIFDNQEEITRMMNLDKNLESIAKATGI 341

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
              +  TC+    I + ++   K   E   I  TP  F+ G L  G
Sbjct: 342 QLEELKTCVKGTEIPEIVRNTAKEG-EVAQIRGTPAIFVNGKLLDG 386


>gi|88658384|ref|YP_507114.1| disulfide oxidoreductase [Ehrlichia chaffeensis str. Arkansas]
 gi|20502763|gb|AAM22615.1|AF403711_1 disulfide oxidoreductase [Ehrlichia chaffeensis]
 gi|88599841|gb|ABD45310.1| disulfide oxidoreductase [Ehrlichia chaffeensis str. Arkansas]
          Length = 246

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 12/149 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVA 117
           S G KD+ +  VE+   +C +C        + ++D     GK+R I R+FP L   S  A
Sbjct: 87  SAGNKDSKIVFVEFFDYSCGYCKMMSEDMKQIIQD-----GKVRVIFRDFPILGEASLKA 141

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL-ND 176
           V  A          Y  F     N +  + +     +++L++ K  G ++ DF   L  +
Sbjct: 142 VQAALAVHLINPSKYIEFYHAALNHKQQFND-----ESILSLVKSIGIAEEDFKVSLAKN 196

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            + ++ +    K  +++  I  TP   IG
Sbjct: 197 SDTIEKMIQSTKELAQNINIRGTPAIIIG 225


>gi|27228607|ref|NP_758657.1| hypothetical protein pCAR1_p116 [Pseudomonas resinovorans]
 gi|219857029|ref|YP_002474061.1| hypothetical protein pCAR12_p116 [Pseudomonas sp. CA10]
 gi|26106195|dbj|BAC41635.1| hypothetical protein [Pseudomonas resinovorans]
 gi|219688957|dbj|BAH10048.1| hypothetical protein [Pseudomonas putida]
          Length = 282

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 91/219 (41%), Gaps = 33/219 (15%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVD-------------FRALLAASPSTMKDVS 59
           G+ +    SY     K + + +LP   G VD              +A + ++ S   D S
Sbjct: 24  GVSVYMGQSYTEMAVKKALVEQLP---GAVDKTLKDREIEKINAAKAKILSNWSGAADTS 80

Query: 60  I------GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--- 110
           I      G  DA  T+VE++ + C +C  FH+ T K + DK    G++ +  + +PL   
Sbjct: 81  IEGRHIYGSMDAQFTLVEFSDLECPYCKRFHD-TPKQMADK--SEGRINWEWQHYPLAFH 137

Query: 111 DSVSTVAVMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           + V+ VA   + C  E   +  +W F    F +    +N +   D +  +A+  G   + 
Sbjct: 138 NPVAEVAAHASECVGEVAGNKAFWAFTGEWFARTQ--LNGQGVED-VERLAQEVGAPLDA 194

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           +  C+        I+ G+ +   +  +  TP   +  NL
Sbjct: 195 YRQCMESGKYQALIE-GQVKKGTNMGVTGTPATVVVDNL 232


>gi|296162942|ref|ZP_06845720.1| Na+/H+ antiporter NhaA [Burkholderia sp. Ch1-1]
 gi|295886796|gb|EFG66636.1| Na+/H+ antiporter NhaA [Burkholderia sp. Ch1-1]
          Length = 621

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 15/149 (10%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAVM 119
           G +DA +T+VEY    C +CA   + T  + ED     G  LRY++R+ P      +A  
Sbjct: 457 GPEDAQLTLVEYVDFECAYCA---HATGSW-EDLRAHFGDDLRYVVRQLPHHPHGPIA-- 510

Query: 120 LARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
            AR +E   + G +W ++  +F +Q         R+ L+  A   G   + F   L+   
Sbjct: 511 -ARASEAASNQGMFWPWLDFVFTRQH-----ALEREDLIGYAVGLGLDVDRFIADLDSPA 564

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           +++ ++     A    A   TP FF+ G 
Sbjct: 565 VIERVERDLASAVASGA-HVTPTFFVEGR 592


>gi|319950811|ref|ZP_08024697.1| putative disulfide bond formation protein [Dietzia cinnamea P4]
 gi|319435525|gb|EFV90759.1| putative disulfide bond formation protein [Dietzia cinnamea P4]
          Length = 257

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 68/153 (44%), Gaps = 4/153 (2%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           +IG  DAPV + E+  + C  CA F   T   L D+Y+ TG++R    +       +   
Sbjct: 87  AIGAVDAPVLLTEWIDLRCPFCASFSRDTLPTLIDEYVDTGRVRIEFTDVAYFGEQSEDA 146

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND-FDTCLNDQ 177
            +A  A    D  Y  +++ +F+   D  +    RD L++ A+       D F   L+D 
Sbjct: 147 QIAAQAAANQD-KYVDYITAVFDAAPDSGHPDLTRDVLIDFAEQVDMPDMDAFRADLDDP 205

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
            +    +  + R ++   + + P FF+ G + +
Sbjct: 206 GVRAQAE-NETRTAQQLGVTAVP-FFVAGQIAM 236


>gi|251797331|ref|YP_003012062.1| DSBA oxidoreductase [Paenibacillus sp. JDR-2]
 gi|247544957|gb|ACT01976.1| DSBA oxidoreductase [Paenibacillus sp. JDR-2]
          Length = 224

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 65/169 (38%), Gaps = 3/169 (1%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVM 119
           G  +APV +VE+    C  C  F       LE  +I TGK       +  +   ST A +
Sbjct: 53  GNAEAPVKIVEFGDYKCPICQYFAQNVEPQLEKDFIDTGKAALYFANYTFIGPDSTTAAL 112

Query: 120 LARCAEKR-MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
            A   +++  D  +W +   +++ Q D        D L+ +AK A  + +      +  +
Sbjct: 113 AAEAVQQQGGDEAFWTYYKTIYDNQKDEKTKWATSDYLVQLAKDAKLTLDFDKLKKDIDD 172

Query: 179 ILDDIKAGKKRAS-EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
                +  K  A      +  TP  FI G  Y G++        ID  +
Sbjct: 173 KTYQSEVNKDNAKVGPLNVTGTPTLFINGVQYAGNLDYASIKAAIDEAV 221


>gi|256790168|ref|ZP_05528599.1| sodium/proton antiporter [Streptomyces lividans TK24]
          Length = 606

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 87/236 (36%), Gaps = 37/236 (15%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYT--------RKGSALNELPIPDGVVDFRALLAASPST 54
           +   RIG+L  +V  F+ S+            R+  AL       G VD    LA     
Sbjct: 384 LEEARIGILVTLVGAFLTSWAVTAVIGLLPERRRARALL------GDVDPLTDLAVPVDR 437

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             D   G + A VT+VEY    C +C +        + D   +   +RY+ R  PL  V 
Sbjct: 438 RHDRIRGPESAVVTVVEYGDFECPYCGQAE----PVVRDLLGQESDVRYVWRHLPLRDVH 493

Query: 115 TVAVMLARCAEKRM-DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
             A + A  +E     G +W    LL  +Q    N+    D LL  A   G     F   
Sbjct: 494 PRAQLAAEASEAAARQGRFWEMHDLLLERQ----NALAAPD-LLRYAGELGLDVERFRQD 548

Query: 174 LNDQNILDDIKAGKKRASEDF------AIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           L D         G +R +ED        +  TP FFI G  + G       ++ ++
Sbjct: 549 LRDH-------LGARRVAEDVDSADLSRVSGTPTFFINGRRHHGAYDIAALTRAVE 597


>gi|289774045|ref|ZP_06533423.1| sodium/proton antiporter [Streptomyces lividans TK24]
 gi|289704244|gb|EFD71673.1| sodium/proton antiporter [Streptomyces lividans TK24]
          Length = 643

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 87/236 (36%), Gaps = 37/236 (15%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYT--------RKGSALNELPIPDGVVDFRALLAASPST 54
           +   RIG+L  +V  F+ S+            R+  AL       G VD    LA     
Sbjct: 421 LEEARIGILVTLVGAFLTSWAVTAVIGLLPERRRARALL------GDVDPLTDLAVPVDR 474

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             D   G + A VT+VEY    C +C +        + D   +   +RY+ R  PL  V 
Sbjct: 475 RHDRIRGPESAVVTVVEYGDFECPYCGQAE----PVVRDLLGQESDVRYVWRHLPLRDVH 530

Query: 115 TVAVMLARCAEKRM-DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
             A + A  +E     G +W    LL  +Q    N+    D LL  A   G     F   
Sbjct: 531 PRAQLAAEASEAAARQGRFWEMHDLLLERQ----NALAAPD-LLRYAGELGLDVERFRQD 585

Query: 174 LNDQNILDDIKAGKKRASEDF------AIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           L D         G +R +ED        +  TP FFI G  + G       ++ ++
Sbjct: 586 LRDH-------LGARRVAEDVDSADLSRVSGTPTFFINGRRHHGAYDIAALTRAVE 634


>gi|319647757|ref|ZP_08001975.1| BdbD protein [Bacillus sp. BT1B_CT2]
 gi|317390098|gb|EFV70907.1| BdbD protein [Bacillus sp. BT1B_CT2]
          Length = 223

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 67/165 (40%), Gaps = 14/165 (8%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           PST     +G KDA VT+ E+    C  C ++    F  L+  YI   ++ +    F  +
Sbjct: 36  PSTEGQPLLGNKDAAVTITEFGDYKCPSCKQWTETVFPDLKKDYIDKDQVNFSYINFVNE 95

Query: 112 SV---STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS-- 166
                S ++ + +    K     +W F   L+  Q D   +    +     AK A  +  
Sbjct: 96  QHGRGSELSALASEQVWKEDPDSFWKFHEALYKAQPD---NDTMENEWATPAKLADITEA 152

Query: 167 -----KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                ++   + LND+   + +K      ++ + +DSTP  F+ G
Sbjct: 153 NTKIKRDKLVSSLNDKTFAEQLKTDNSLINK-YGVDSTPTIFVNG 196


>gi|299140116|ref|ZP_07033285.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX8]
 gi|298597962|gb|EFI54131.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX8]
          Length = 178

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 66/160 (41%), Gaps = 26/160 (16%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G+ +A  ++VEY    C  C E    T + L+       ++ ++ R FPL  +   A   
Sbjct: 16  GKLNAACSLVEYGDYECPSCGEVQ-PTIRSLQAHL--GNRMSFVFRNFPLREIHPWAEPA 72

Query: 121 ARCAE-KRMDGGYWGFVSLLFNKQDDWINSKNY--------RDALLNMAKFAGFSKNDFD 171
           A  AE     G +W    LLF  Q+    S  +         D+ L +A+ +G +K   D
Sbjct: 73  AEVAEFAGSQGKFWEMHDLLFANQESLDESTFHALLEKLGLTDSGLQLARSSGTAKERID 132

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
                 +    I++G         ++ TP FF+ G+ Y G
Sbjct: 133 A-----DFTGGIRSG---------VNGTPTFFLNGDRYDG 158


>gi|52842068|ref|YP_095867.1| 27 kDa outer membrane protein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54294729|ref|YP_127144.1| hypothetical protein lpl1806 [Legionella pneumophila str. Lens]
 gi|54297754|ref|YP_124123.1| hypothetical protein lpp1805 [Legionella pneumophila str. Paris]
 gi|148359388|ref|YP_001250595.1| 27 kDa outer membrane protein [Legionella pneumophila str. Corby]
 gi|296107434|ref|YP_003619134.1| 27 kDa outer membrane protein [Legionella pneumophila 2300/99
           Alcoy]
 gi|52629179|gb|AAU27920.1| 27 kDa outer membrane protein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53751539|emb|CAH12957.1| hypothetical protein lpp1805 [Legionella pneumophila str. Paris]
 gi|53754561|emb|CAH16045.1| hypothetical protein lpl1806 [Legionella pneumophila str. Lens]
 gi|148281161|gb|ABQ55249.1| 27 kDa outer membrane protein [Legionella pneumophila str. Corby]
 gi|295649335|gb|ADG25182.1| 27 kDa outer membrane protein [Legionella pneumophila 2300/99
           Alcoy]
          Length = 261

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 63/151 (41%), Gaps = 13/151 (8%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVS 114
           K  ++G     VT+VE+    C HC     K    +E+   K   LR I +EFP+    S
Sbjct: 88  KLTTVGNPKGNVTLVEFFDYQCIHC----KKMASTIENLVKKDSGLRVIYKEFPIFGKTS 143

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
            +A  +A  A   M G Y    + L    D  ++ K   DA    AK  G         +
Sbjct: 144 DLASRVALAA--GMQGKYQAMHNALITI-DKRLDEKTVMDA----AKSIGLDMQKLKKDM 196

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
           + Q + D + A ++ A E   +  TP F IG
Sbjct: 197 DSQEVTDILDANRQLA-EKLHLMGTPAFIIG 226


>gi|167933057|ref|ZP_02520144.1| Na+/H+ antiporter, NhaA family protein [candidate division TM7
           single-cell isolate TM7b]
          Length = 229

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 86/218 (39%), Gaps = 33/218 (15%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAAS-----PSTM 55
           ++     I +L G++ L            S  N L + + V  F+ +++        S +
Sbjct: 7   IIFGAASIAILAGLIFL------------SKQNSLDVSN-VDKFKTIISQQDADNVKSGI 53

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS- 114
            D + G KDA + ++EY   +C  C        K L+D Y K  ++  + R FP+ S+  
Sbjct: 54  PDRTNGNKDAKIVLIEYGDYSCPGCTTLEGNIKKVLKD-YGK--EISVVFRHFPITSIHP 110

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN-SKNYRDALLN-MAKFAGFS----KN 168
              +  A      + G +W     LF+ + DW   S + RD + +  AK  G      K 
Sbjct: 111 NSKIAAAYAEAAGLQGKFWEMHDKLFSNRTDWSGVSADKRDKIFDEYAKQLGLDMDKLKK 170

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
           D  +    Q I  D   GK        +  TP  F+ G
Sbjct: 171 DISSNKVAQKIAFDQAIGKAS-----GVSGTPSVFLNG 203


>gi|145595906|ref|YP_001160203.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
 gi|145305243|gb|ABP55825.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
          Length = 182

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 68/167 (40%), Gaps = 20/167 (11%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           SP T  D   G  DAPVT+VEYA   C  C   +    + L     +T  +R + R FP+
Sbjct: 13  SPVTESDHVRGPVDAPVTLVEYADFQCQFCGVAYANLAELLRQ---RTDTVRLVYRHFPI 69

Query: 111 DSVSTVA-VMLARCAEKRMDGGYWGFVSLLFNKQD--DWINSKNYRDALLNMAKFAGFSK 167
            +V   A             G +W     L+  QD  D ++        L + +  G + 
Sbjct: 70  SNVHPYAESAAHATEAAGARGRFWEMHDWLYEHQDQLDPVHLS------LGVGQL-GLAA 122

Query: 168 NDFDTCLNDQNILDDIK---AGKKRASEDFAIDSTPVFFIGGNLYLG 211
           ++ D   + Q   D ++    G  R+     +++TP  F+ G  + G
Sbjct: 123 DEIDAETDQQAHGDRVRRDFVGGIRS----GVEATPTLFVNGARHNG 165


>gi|55377693|ref|YP_135543.1| hypothetical protein rrnAC0856 [Haloarcula marismortui ATCC 43049]
 gi|55230418|gb|AAV45837.1| unknown [Haloarcula marismortui ATCC 43049]
          Length = 222

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 4/88 (4%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTVA 117
           G  +A VT+  Y    C HCA +    +  + + Y+  G +RY   +FP+   +  S  A
Sbjct: 55  GDPEADVTVAVYEDYACPHCATYSESVYPQVREDYLTDGAIRYEFHDFPIPVDEDASWQA 114

Query: 118 VMLARCAEKRM-DGGYWGFVSLLFNKQD 144
              AR  +  + DG ++ +   LF  Q+
Sbjct: 115 ASAARAVQDNVGDGAFFTYSERLFANQN 142


>gi|167461952|ref|ZP_02327041.1| disulfide dehydrogenase D [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322384658|ref|ZP_08058336.1| thiol-disulfide oxidoreductase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321150543|gb|EFX44024.1| thiol-disulfide oxidoreductase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 238

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 85/199 (42%), Gaps = 15/199 (7%)

Query: 41  VVDFRALLAASPSTMKDVS--------IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLE 92
           V+ F A LA  P + K+ S        +G  +APV +VE+    C  C  F+      ++
Sbjct: 41  VIVFIAALAW-PKSTKEASFNYENLPVLGDPNAPVKIVEFGDFKCPACMYFNQDVKPKIQ 99

Query: 93  DKYIKTGKLR-YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
             +I  GK+  Y +    +   S  A + A+    +    YW +   ++  Q D   +  
Sbjct: 100 KDFIDQGKVAFYFINYTIIGPDSETAAIAAQSVFHQNKDEYWKYFESIYKNQQDENKTWA 159

Query: 152 YRDALLNMAKFAGFSKNDFDTCLND---QNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             + L+ +AK  G  + D+D    D   +  ++++K  +   +++  ++STP  FI G  
Sbjct: 160 TPEFLVELAKKEGI-QVDYDKLKQDIENKTYVNEVKE-QYNVAQNNKVNSTPTIFINGKQ 217

Query: 209 YLGDMSEGVFSKIIDSMIQ 227
                   V  K I+  +Q
Sbjct: 218 SKDLFKYEVVKKEIEDALQ 236


>gi|108757090|ref|YP_634464.1| vitamin K epoxide reductase family/thioredoxin domain-containing
           protein [Myxococcus xanthus DK 1622]
 gi|108460970|gb|ABF86155.1| vitamin K epoxide reductase family/thioredoxin domain protein
           [Myxococcus xanthus DK 1622]
          Length = 461

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 69/189 (36%), Gaps = 32/189 (16%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           AASP+  +    G  DAPV +VE+    C HC     +       K +  GK+    R+F
Sbjct: 251 AASPARHR---YGPVDAPVKIVEWTDSKCPHCKMLVEELSAL--KKRVPEGKMSLEARQF 305

Query: 109 PLDSVSTVAVML-------ARCAEKR----MDGG--YWGFVSLLFNKQDDWINSKNYRDA 155
           PLD     A+          RC   R    ++G   YW     +F  Q      +     
Sbjct: 306 PLDGACNPAIPRRGPDAPSVRCVAARAQICLEGAPDYWELREKMFAAQAVLDTERA---- 361

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN-------- 207
            + +A      ++  + C+N       I+   + A     I  TP+  + G         
Sbjct: 362 -VEIASSGSVPRSQLEVCMNSPATAAKIQEDSRYAMRHH-IQGTPLVLVNGRETAPSAPF 419

Query: 208 LYLGDMSEG 216
           LY   M+EG
Sbjct: 420 LYALVMAEG 428


>gi|251772253|gb|EES52823.1| probable oxidoreductase [Leptospirillum ferrodiazotrophum]
          Length = 345

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 86/213 (40%), Gaps = 31/213 (14%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDV----SIGQKDAPVTMVEYASMTCFHCA 81
           TR  S +  +P P      + +  A PST  D+    S G+KDAP  ++ +    C  C 
Sbjct: 139 TRHYSVVPSIPPP------QPIALALPSTDFDIDSFPSTGKKDAPHILIMFGDEQCGACR 192

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSV---STVAVMLARCAEKRMDGGYWGFVSL 138
            ++ +     E+   K   +R++   +P  ++   +  A +   CA +     +W     
Sbjct: 193 RWNRQE----EESVRKDPSIRFVYIPYPQVTIHKNALTAAIFEMCAFQEKPSSFW----T 244

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGF------SKNDFDTCLNDQNILDDIKAGKKRASE 192
           + ++ D  +  KN   A L    F+GF             C+++   L+ I         
Sbjct: 245 IHDQIDRRVEMKNIDKAGLT-PIFSGFMIQAGVPTAKVKKCMDESRPLEAISKAGNELGA 303

Query: 193 DFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
              + S P+F I G +  G M+   +++I  +M
Sbjct: 304 KIGVPSPPIFIIDGQVKEGYMT---YAQIKQTM 333


>gi|52081839|ref|YP_080630.1| thiol-disulfide oxidoreductase [Bacillus licheniformis ATCC 14580]
 gi|52787228|ref|YP_093057.1| BdbD [Bacillus licheniformis ATCC 14580]
 gi|52005050|gb|AAU24992.1| thiol-disulfide oxidoreductase [Bacillus licheniformis ATCC 14580]
 gi|52349730|gb|AAU42364.1| BdbD [Bacillus licheniformis ATCC 14580]
          Length = 231

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 67/165 (40%), Gaps = 14/165 (8%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           PST     +G KDA VT+ E+    C  C ++    F  L+  YI   ++ +    F  +
Sbjct: 44  PSTEGQPLLGNKDAAVTITEFGDYKCPSCKQWTETVFPDLKKDYIDKDQVNFSYINFVNE 103

Query: 112 SV---STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS-- 166
                S ++ + +    K     +W F   L+  Q D   +    +     AK A  +  
Sbjct: 104 QHGRGSELSALASEQVWKEDPDSFWKFHEALYKAQPD---NDTMENEWATPAKLADITEA 160

Query: 167 -----KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                ++   + LND+   + +K      ++ + +DSTP  F+ G
Sbjct: 161 NTKIKRDKLVSSLNDKTFAEQLKTDNSLINK-YGVDSTPTIFVNG 204


>gi|186684771|ref|YP_001867967.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
 gi|186467223|gb|ACC83024.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
          Length = 259

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 70/171 (40%), Gaps = 24/171 (14%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + ++  SP+T      G   +   ++E++   C +CAE H KT K L  KY    K++ +
Sbjct: 94  QTVIGESPTT------GSTQSKTVLIEFSDFQCPYCAEAH-KTLKQLLAKY--PDKVKLV 144

Query: 105 LREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKF 162
            +  PL S+   A+  A  A      G +W +   LF       N K    AL L++AK 
Sbjct: 145 YKNLPLISIHAEALPSATAAWAAYQQGKFWEYHDALFT------NQKQLGQALYLDIAKK 198

Query: 163 AGFSKNDF--DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
                  F  D  L    I  D++  +K       +  TP F I    + G
Sbjct: 199 LNLDLGKFKRDLNLATPAITKDVQLAEK-----LGVSGTPFFIINSPTFSG 244


>gi|227818318|ref|YP_002822289.1| hypothetical protein NGR_b00650 [Sinorhizobium fredii NGR234]
 gi|227337317|gb|ACP21536.1| membrane protein, putative [Sinorhizobium fredii NGR234]
          Length = 180

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 67/166 (40%), Gaps = 20/166 (12%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P   +D   G  +A VT+VEY    C  CA   N   + LE++Y +   L  + R FP+ 
Sbjct: 7   PINPRDHRRGGTNATVTLVEYGDYQCPVCA-IANPVVRSLENRYGQA--LSVVFRHFPMI 63

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKN 168
            V   A   A  AE   D G       LF +  D I S  +R     L  +A     S+ 
Sbjct: 64  EVHPFAGTAAETAEFAGDHG-------LFWEMHDAIFSNQHRLSIQLLFAIASTLQLSQI 116

Query: 169 DFDTCLNDQNILDDIKA---GKKRASEDFAIDSTPVFFIGGNLYLG 211
                +      D I+A   G  R+     ++ TP FF+ G  + G
Sbjct: 117 GLRDSIARSLHADKIQADFIGGVRS----GVNGTPTFFVNGLRHEG 158


>gi|120603965|ref|YP_968365.1| DSBA oxidoreductase [Desulfovibrio vulgaris DP4]
 gi|120564194|gb|ABM29938.1| DSBA oxidoreductase [Desulfovibrio vulgaris DP4]
          Length = 288

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 24/179 (13%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--STVAV 118
           G+ +APVT+V Y+  TC +C +    T + L   Y   GK+RY+ ++ PL++   +  A 
Sbjct: 120 GEANAPVTVVAYSDFTCPYCQQAAG-TVEMLLANY--KGKVRYVFKQMPLETHENARTAS 176

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                A  +     W     +F  +D  +        L  +A+ AG         L+ Q 
Sbjct: 177 NYYVAASLQDPAKAWKLYEAVFADRDRLVTEGE--PFLKKVAQEAG---------LDMQR 225

Query: 179 ILDDIKAGKKRA--SEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  DIK  K +A   ED A      +  TP F +   +  G +   +FS  +D  ++ +
Sbjct: 226 LATDIKGRKVKALIEEDMAEARKLGVQGTPYFLVNDLVVRGALPLDLFSDAVDMALEKA 284


>gi|15811155|gb|AAL08831.1|AF308669_1 hypothetical outer membrane protein [Ehrlichia ruminantium]
          Length = 250

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 84/184 (45%), Gaps = 22/184 (11%)

Query: 53  STMKDV---SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED--KYIKTGKLRYILRE 107
           S ++D+   S G KD+ +  +E+   +C +C           ED  + IK GK+R I R+
Sbjct: 80  SELEDIAYPSAGNKDSKIAFIEFFDYSCGYCKMM-------FEDIKQIIKDGKVRVIFRD 132

Query: 108 FPLDSVSTVAVMLARCAEKRMD-GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
           FP+   S++  + A  A   ++   Y  F     N +  + +     +++LN+ K    S
Sbjct: 133 FPILGESSLKAVKAALAVHLINPSKYLDFYYAALNHKQPFND-----ESILNIVKSLEIS 187

Query: 167 KNDF-DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG--DMSEGVFSKIID 223
           + +F D+   + + +D +    +  +E   I  TP   IG     G  D+S  + SKI++
Sbjct: 188 EEEFKDSLSKNSSTIDKMIESTRNLAEKLNIRGTPALIIGDAFIGGAADLS-TLRSKIVE 246

Query: 224 SMIQ 227
              Q
Sbjct: 247 QQEQ 250


>gi|186683252|ref|YP_001866448.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
 gi|186465704|gb|ACC81505.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
          Length = 180

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 66/159 (41%), Gaps = 16/159 (10%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P + +D   G K+APVT+VEY+   C +C   H   F   E + +    +R++ R FPL 
Sbjct: 12  PVSDRDHIRGPKNAPVTLVEYSDYECPYCGRAH---FIVKELQQLTGDLMRFVYRHFPLT 68

Query: 112 SVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQD--DWINSKNYRDAL-LNMAKFAGFSK 167
           SV                 G +W   + L   Q   D  +   Y   L L++ +F+    
Sbjct: 69  SVHPHAEQAAEAAEAAGAQGKFWEMHNHLLEHQQALDRKHLIEYAANLGLDVPRFSHELA 128

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                    +++L  I++G         ++ TP FFI G
Sbjct: 129 EHAHVARIREDLLSGIQSG---------VNGTPTFFING 158


>gi|42521105|ref|NP_967020.1| DsbA-like disulfide oxidoreductase [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410846|gb|AAS14954.1| DsbA-like disulfide oxidoreductase [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 252

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 76/167 (45%), Gaps = 12/167 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +++ V  V +   +C HC    N   + + D     GK++YI R+ P+   +++    
Sbjct: 91  GNENSSVIAVGFLDYSCGHCKAIKNDIKQLIND-----GKIKYIFRDAPILGNASLKAAK 145

Query: 121 ARCAEKRMDG-GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ-N 178
           +  A   +D   Y+ F     + + ++ +     +++L++ K  G  ++DF+  + D  +
Sbjct: 146 SALAVYFLDKEKYFDFHHAALSHKGEFSD-----ESILDIVKNIGIDEDDFNDSIKDNAD 200

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            ++ +    +    D  +  TP   IG +L++G     V  K +D +
Sbjct: 201 KIEQMINNSRLLVRDLGVGGTPFLIIGDSLFVGATDLNVLRKKVDEL 247


>gi|46578451|ref|YP_009259.1| DSBA-like thioredoxin domain-containing protein [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46447862|gb|AAS94518.1| DSBA-like thioredoxin domain protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311232379|gb|ADP85233.1| DSBA oxidoreductase [Desulfovibrio vulgaris RCH1]
          Length = 261

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 24/179 (13%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--STVAV 118
           G+ +APVT+V Y+  TC +C +    T + L   Y   GK+RY+ ++ PL++   +  A 
Sbjct: 93  GEANAPVTVVAYSDFTCPYCQQAAG-TVEMLLANY--KGKVRYVFKQMPLETHENARTAS 149

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                A  +     W     +F  +D  +        L  +A+ AG         L+ Q 
Sbjct: 150 NYYVAASLQDPAKAWKLYEAVFADRDRLVTEGE--PFLKKVAQEAG---------LDMQR 198

Query: 179 ILDDIKAGKKRA--SEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  DIK  K +A   ED A      +  TP F +   +  G +   +FS  +D  ++ +
Sbjct: 199 LATDIKGRKVKALIEEDMAEARKLGVQGTPYFLVNDLVVRGALPLDLFSDAVDMALEKA 257


>gi|145591913|ref|YP_001153915.1| hypothetical protein Pars_1712 [Pyrobaculum arsenaticum DSM 13514]
 gi|145283681|gb|ABP51263.1| conserved hypothetical protein [Pyrobaculum arsenaticum DSM 13514]
          Length = 208

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 60/149 (40%), Gaps = 24/149 (16%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSA-------LNELPIPDGVVDFRALLAASPSTM 55
           M  T I  +   V + ++    YTR GS        L ELP+P   + F           
Sbjct: 1   MRPTIIFTVAIAVFVLLSIAIVYTRLGSPSVQTPSQLGELPLPPWAMSF----------- 49

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
                G  +APVT++E   + C +CA  H +    L  K +  GKLR I  +  +   + 
Sbjct: 50  -----GNPNAPVTVIELFDLHCPYCAWAHTQ-LDPLYKKLVGEGKLRLIFLDLIVHPDAL 103

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
           +A     CA +++       ++ L+   D
Sbjct: 104 LAHQYLHCAYRQLGNKTLDMITRLYEAYD 132


>gi|149918692|ref|ZP_01907180.1| thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149820533|gb|EDM79947.1| thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 329

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 73/175 (41%), Gaps = 26/175 (14%)

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+V +A   C HC        +    +Y   G+ + + + +PL S     V    C 
Sbjct: 171 APVTVVVFADFQCPHC-RMEAPVLRKAVQQY--RGRAKLVFKHYPLRSHGRAEVAAQACE 227

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL----LNMAKFAGFSKNDFDTCLNDQNIL 180
              + G +W    L+F+ Q    ++   R A     L++AK+    K D  T        
Sbjct: 228 AAHLQGKFWEMHDLVFDHQTQLEDADLERYAKQIDGLDVAKW----KADMAT-------- 275

Query: 181 DDIK---AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           +D+K   A  ++  +   I  TP  +I G      ++  ++   +++ I D+ RR
Sbjct: 276 EDVKLAVAKDRKIGDALGIQGTPAVYINGRT----VTPLLWGGSLEAWIDDALRR 326


>gi|126433087|ref|YP_001068778.1| Na+/H+ antiporter NhaA [Mycobacterium sp. JLS]
 gi|189029134|sp|A3PTR0|NHAA1_MYCSJ RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|126232887|gb|ABN96287.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. JLS]
          Length = 613

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 86/210 (40%), Gaps = 23/210 (10%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R+GVL   VL F  S+  +  + +     P P G+   R +        +D   G  DAP
Sbjct: 407 RVGVLIASVLAFTLSWALF--RITDWISPPEPVGLTLVRPV-----DPERDHIRGDPDAP 459

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAV-MLARCA 124
           + +VEY    C  C     +    +++     G  L Y+ R FPL+     +        
Sbjct: 460 LVLVEYGDYECPFC----GRATGAIDEVRTHFGDDLLYVWRHFPLERAHPRSFDAARASE 515

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL---LNMAKFAGFSKNDFDTCLNDQNILD 181
                G ++     LF  QDD   S  YR A+   L++ +F      D D  ++   +L 
Sbjct: 516 GAAAQGKFFEMGRELFAHQDDLEWSDMYRYAVAIGLDIEQF------DQDVRVHASKVLH 569

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            ++   + A E   ++STP FF+ G  + G
Sbjct: 570 RVRDDAQDA-EVMDLNSTPTFFVNGKRHKG 598


>gi|311069870|ref|YP_003974793.1| thiol-disulfide oxidoreductase [Bacillus atrophaeus 1942]
 gi|310870387|gb|ADP33862.1| thiol-disulfide oxidoreductase [Bacillus atrophaeus 1942]
          Length = 223

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +++ PS      +G+ DAPVT+VE+    C  C  F+N  F  ++  +I  G +++    
Sbjct: 40  VSSQPSIKGQPVLGKNDAPVTVVEFGDYKCPSCKVFNNDIFPKIQKDFIDKGDVKFSFVN 99

Query: 108 FPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLF----NKQDDWI 147
                  S +A + +    K     +W F   LF    N + +W+
Sbjct: 100 VMFHGKGSRLAALASEEVWKEDPDSFWSFHEKLFEEQPNTEQEWV 144


>gi|57239430|ref|YP_180566.1| putative thiol:disulfide interchange protein dsbA [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58579402|ref|YP_197614.1| putative thiol:disulfide interchange protein dsbA [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58617457|ref|YP_196656.1| putative thiol:disulfide interchange protein dsbA [Ehrlichia
           ruminantium str. Gardel]
 gi|57161509|emb|CAH58435.1| putative disulfide oxidoreductase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417069|emb|CAI28182.1| Similar to thiol:disulfide interchange protein dsbA [Ehrlichia
           ruminantium str. Gardel]
 gi|58418028|emb|CAI27232.1| Similar to thiol:disulfide interchange protein dsbA [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 250

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 84/184 (45%), Gaps = 22/184 (11%)

Query: 53  STMKDV---SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED--KYIKTGKLRYILRE 107
           S ++D+   S G KD+ V  +E+   +C +C           ED  + +K GK+R I R+
Sbjct: 80  SELEDIAYPSAGNKDSKVAFIEFFDYSCGYCKMM-------FEDIKQIVKDGKVRVIFRD 132

Query: 108 FPLDSVSTVAVMLARCAEKRMD-GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
           FP+   S++  + A  A   ++   Y  F     N +  + +     +++LN+ K    S
Sbjct: 133 FPILGESSLKAVKAALAIHLINPSKYLDFYYAALNHKQPFND-----ESILNIVKSLEIS 187

Query: 167 KNDF-DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG--DMSEGVFSKIID 223
           + +F D+   + + +D +    +  +E   I  TP   IG     G  D+S  + SKI++
Sbjct: 188 EEEFKDSLSKNSSTIDKMIESTRNLAEKLNIRGTPALIIGDAFIGGAADLS-TLRSKIVE 246

Query: 224 SMIQ 227
              Q
Sbjct: 247 QQEQ 250


>gi|46446969|ref|YP_008334.1| hypothetical protein pc1335 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46400610|emb|CAF24059.1| hypothetical protein pc1335 [Candidatus Protochlamydia amoebophila
           UWE25]
          Length = 175

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 70/166 (42%), Gaps = 10/166 (6%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           ++P + KD  +G  +APV +VEY    C  CA  H    + L++     G+L +  R FP
Sbjct: 6   STPISEKDHILGNLNAPVVLVEYGDYQCKTCALTHPIVKQLLKE---MRGQLCFAFRHFP 62

Query: 110 LDSVSTVA-VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           L +   +A +         +   +W     L++            +A  + A+    +  
Sbjct: 63  LKNSHPLAFIASQAAEAAALQNKFWQMHECLYHHHHAL-----SLEAFPSYAEEIQLNIK 117

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
            F+  L + +++  I+     +  D  ++ TP FFI    Y GD S
Sbjct: 118 LFNENLQNPSLISCIEENFC-SGLDSGVNGTPCFFINKERYDGDRS 162


>gi|323488386|ref|ZP_08093633.1| thiol-disulfide oxidoreductase [Planococcus donghaensis MPA1U2]
 gi|323397893|gb|EGA90692.1| thiol-disulfide oxidoreductase [Planococcus donghaensis MPA1U2]
          Length = 227

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 70/168 (41%), Gaps = 19/168 (11%)

Query: 53  STMKDVS----IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG--KLRYILR 106
           +T  DVS     G+++APVT+VE+    C  C  +    +  L + YI +   K  YI  
Sbjct: 43  TTQVDVSGQPIFGEEEAPVTVVEFGDFKCPSCKAWGEMIYPQLVEDYIDSEDVKFSYINV 102

Query: 107 EFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD------WINSKNYRDALLNMA 160
            F  +  S +A + A    ++    YW F   LF++Q        W+  K     +L +A
Sbjct: 103 LFHGEE-SVLASIAAESVYQQSPDAYWDFHKALFDEQPTQNHDALWVTPKK----ILEVA 157

Query: 161 K-FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
             F    +   +  +  Q  +D ++  +    E+  +  TP   + G 
Sbjct: 158 SVFPSIDQGKLEGDIEQQATMDQVEIDEALV-EEAEVAQTPTIVVNGT 204


>gi|94271342|ref|ZP_01291939.1| DSBA oxidoreductase [delta proteobacterium MLMS-1]
 gi|93450470|gb|EAT01644.1| DSBA oxidoreductase [delta proteobacterium MLMS-1]
          Length = 184

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 69/171 (40%), Gaps = 17/171 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G +DA V +VE++   C HCA     T + L    +    L+ + + FPL S       
Sbjct: 25  LGPEDASVVLVEFSDFQCPHCARVKPLTEQLL----LNNDDLKVVFKHFPLSSHEQAKPA 80

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWIN---SKNYRDALLNMAKFAGFSKNDFDTCLND 176
                  +  G +W     +F  Q D       +  RD  L+M +F    + D ++    
Sbjct: 81  ALAAMAAQQQGKFWEMHDRIFAAQQDLSPRTLQEIARDIGLDMERF----QRDINSRELA 136

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           + +  D+  G++       +  TP  FI G        +G+  ++ID  ++
Sbjct: 137 RRLEQDMADGQQ-----AGVRGTPALFINGIPVTQRNQQGI-QQMIDRALE 181


>gi|108797466|ref|YP_637663.1| Na+/H+ antiporter NhaA [Mycobacterium sp. MCS]
 gi|119866551|ref|YP_936503.1| Na+/H+ antiporter NhaA [Mycobacterium sp. KMS]
 gi|122977483|sp|Q1BES7|NHAA1_MYCSS RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|189029135|sp|A1UA55|NHAA1_MYCSK RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|108767885|gb|ABG06607.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. MCS]
 gi|119692640|gb|ABL89713.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. KMS]
          Length = 613

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 84/209 (40%), Gaps = 21/209 (10%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R+GVL   VL F  S+  +  + +     P P G+   R +        +D   G  DAP
Sbjct: 407 RVGVLIASVLAFTLSWALF--RITDWISPPEPVGLTLVRPV-----DPERDHIRGDPDAP 459

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV-MLARCAE 125
           + +VEY    C  C      T    E +      L Y+ R FPL+     +         
Sbjct: 460 LVLVEYGDYECPFCG---RATGAIDEVRTHFGDDLLYVWRHFPLERAHPRSFDAARASEG 516

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDAL---LNMAKFAGFSKNDFDTCLNDQNILDD 182
               G ++     LF  QDD   S  YR A+   L++ +F      D D  ++   +L  
Sbjct: 517 AAAQGKFFEMGRELFAHQDDLEWSDMYRYAVAIGLDIEQF------DQDVRVHASKVLHR 570

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           ++   + A E   ++STP FF+ G  + G
Sbjct: 571 VRDDAQDA-EVMDLNSTPTFFVNGKRHKG 598


>gi|149922484|ref|ZP_01910916.1| DsbA oxidoreductase [Plesiocystis pacifica SIR-1]
 gi|149816679|gb|EDM76171.1| DsbA oxidoreductase [Plesiocystis pacifica SIR-1]
          Length = 680

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 65/166 (39%), Gaps = 6/166 (3%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G+ DA VT++ +  M C  C +    T   L  +Y K   LR + R  PL   +      
Sbjct: 298 GRADALVTLIAFGDMQCPFCRKA-EATLDALAKRYGKD--LRIVYRHNPLPMHAQAKDAA 354

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                    G ++   + L+   +D   +++       +A+  G     F   + D +  
Sbjct: 355 LALVAADRQGEFFAMRAALYEAAEDGRLAES--GIFSTLARQLGLDIRSFKADMADPDAA 412

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             I A  ++ ++ F    TP FF+ G    G   E  F+ +ID  +
Sbjct: 413 K-IIAEDQKVAQQFGATGTPAFFVNGRFLSGAQPEAAFAALIDEEL 457


>gi|332969282|gb|EGK08309.1| disulfide bond formation protein D [Desmospora sp. 8437]
          Length = 256

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 65/151 (43%), Gaps = 6/151 (3%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK--LRYILREFPLDSVSTVA 117
           +G  DAPV +VE+    C  C  F ++ +  L+  Y+   K    +I  +F L   S  A
Sbjct: 84  LGNGDAPVRIVEFGDYKCPTCKRFADEIYPKLKKDYLDNDKAGFYFINNQF-LGEDSITA 142

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA--GFSKNDFDTCLN 175
            +      ++    +W F   ++  Q +   +   +D L+ +AK A  G   +  +  ++
Sbjct: 143 GIAGEAVHEQDPAAFWKFHEEIYKNQGNERETWATKDFLVKLAKQAAPGIDHDKLEKAID 202

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            ++    ++  K  A +   + S P  FI G
Sbjct: 203 KESFKQQVEQDKAIAIQS-GVSSVPSLFING 232


>gi|296330406|ref|ZP_06872886.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305675953|ref|YP_003867625.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296152409|gb|EFG93278.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305414197|gb|ADM39316.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 222

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 1/99 (1%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G +++    
Sbjct: 40  VSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVN 99

Query: 108 FPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
                  S +A + +    K     +W F   LF KQ D
Sbjct: 100 VMFHGKGSRLAALASEEVWKEDPDSFWAFHEKLFEKQPD 138


>gi|325066381|ref|ZP_08125054.1| DsbA-like thioredoxin domain-containing protein [Actinomyces oris
           K20]
          Length = 265

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 60/152 (39%), Gaps = 7/152 (4%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G+ DAPV MV Y+   C  C +F       L +K +K G LR   R+    S  T  +  
Sbjct: 75  GKVDAPVVMVIYSDFACPFCTQFARNVEPEL-NKLVKEGTLRIEWRDLAQIS-ETSPLAA 132

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                    G +W F   ++   D   +     D+L++ AK AG +  D      D    
Sbjct: 133 QAGRAAAKQGKFWEFHDAVYAAADPKGHPAYTEDSLVDFAKKAGVA--DLSKFRADMTAA 190

Query: 181 DDIKAGKKRAS--EDFAIDSTPVFFIGGNLYL 210
           + +KA  +         I  TP F I G  Y+
Sbjct: 191 ETVKAVSESTDHVHSIGIQGTP-FMIVGETYI 221


>gi|206890896|ref|YP_002249116.1| disulfide bond formation protein D, selenocysteine-containing
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742834|gb|ACI21891.1| disulfide bond formation protein D, selenocysteine-containing
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 200

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 77/181 (42%), Gaps = 25/181 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFH---NKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           IG KDAPVT++E+      HC E     ++  K LE      GK++ +++ FP       
Sbjct: 37  IGNKDAPVTIIEFIDYQUPHCVEVGPTIDRLVKELE------GKVKLVIKFFPYRYRDYS 90

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLN 175
            +      E    G +     LL        NS    R++L+N AK        F   ++
Sbjct: 91  RIAAEAAVEAWKQGKFTEMHDLLIK------NSPRLDRESLINYAKKLNMDVEKFIKAID 144

Query: 176 DQ---NILD-DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +Q   +I+D D+K  K     +  +  TP F+I G   LG      F +II   +++  +
Sbjct: 145 NQEGASIIDKDLKLAK-----ELDLYVTPAFYINGIKVLGVRDSEYFKEIIFRELKNVKK 199

Query: 232 R 232
           +
Sbjct: 200 K 200


>gi|240104401|pdb|3EU3|A Chain A, Crystal Structure Of Bdbd From Bacillus Subtilis (Reduced)
 gi|240104402|pdb|3EU4|A Chain A, Crystal Structure Of Bdbd From Bacillus Subtilis
           (Oxidised)
 gi|240104456|pdb|3GH9|A Chain A, Crystal Structure Of Edta-Treated Bdbd (Oxidised)
 gi|240104457|pdb|3GHA|A Chain A, Crystal Structure Of Etda-Treated Bdbd (Reduced)
          Length = 202

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 1/99 (1%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G +++    
Sbjct: 12  VSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVN 71

Query: 108 FPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
                  S +A + +    K     +W F   LF KQ D
Sbjct: 72  VMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPD 110


>gi|149922962|ref|ZP_01911382.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149816213|gb|EDM75720.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 480

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 70/181 (38%), Gaps = 35/181 (19%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD-----SVST 115
           G  DAPV +VE+    C +C + H +    L ++Y     LR  LR  PL+     + + 
Sbjct: 274 GPADAPVVLVEFIDYQCPYCRKAHEEIVPALIERY--GDDLRVELRHLPLEIHAGAAPAA 331

Query: 116 VAVMLARCAEK---------RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
            AV+ A    K         ++DGG  GF +                   + +A   G  
Sbjct: 332 RAVITASRQGKATEFHEALWKLDGGGLGFST------------------FVRLADELGLD 373

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           K  F+     + + D + A    A     +  TP FF+ G    G  S G F  +ID  +
Sbjct: 374 KEAFERDFQTREVSDALVADLLLARR-LGVRGTPGFFVNGRFVDGARSVGTFEGLIDEEL 432

Query: 227 Q 227
           +
Sbjct: 433 E 433


>gi|296130255|ref|YP_003637505.1| DSBA oxidoreductase [Cellulomonas flavigena DSM 20109]
 gi|296022070|gb|ADG75306.1| DSBA oxidoreductase [Cellulomonas flavigena DSM 20109]
          Length = 172

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 67/170 (39%), Gaps = 17/170 (10%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAV 118
           +G  DAPVT+V+Y  + C +C +      + +E+     G++R + R FPL  +      
Sbjct: 16  LGDPDAPVTVVQYGDLECPYCRDAEPVLRRLVEE---SDGRVRLVWRHFPLFQLHPHALA 72

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWIN---SKNYRDALLNMAKFAGFSKNDFDTCLN 175
                      G +W    LL+  QD   +   ++  R+  L+  +  G   + F   + 
Sbjct: 73  AALAVEAAGAHGRFWEMQRLLYAHQDALTDDDLARYARELGLDPEEVVGEPADRFARAVQ 132

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
                 D + G +       +  TP   + G  Y G +       ++D++
Sbjct: 133 -----ADYEGGIE-----LDVPGTPTLLVDGVPYRGRIELEALRAVVDAV 172


>gi|325277173|ref|ZP_08142817.1| outer membrane protein [Pseudomonas sp. TJI-51]
 gi|324097685|gb|EGB95887.1| outer membrane protein [Pseudomonas sp. TJI-51]
          Length = 214

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 75/199 (37%), Gaps = 21/199 (10%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           L F A+ FFY R   +    P+        A +A+S        IG  +APVT+VE+   
Sbjct: 16  LGFTAAAFFYDRYSVSEETPPV--------APVASSLVRFHSPVIGTANAPVTIVEFFDP 67

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
           +C  C  F     + L D       +R +LR       S  A  +   A K+  G +   
Sbjct: 68  SCEACRAFFPVVKQILAD---NPNDVRLVLRYVLFHEGSETAARILETARKQ--GVFEPV 122

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASED-- 193
           +  L   Q  W     + D L+  A  A  +          + +  DI    KR S+D  
Sbjct: 123 LEALMVAQPQW-----HSDPLVQKAWEAAEAAGLDVEKARAEMMAGDITEALKRDSQDAQ 177

Query: 194 -FAIDSTPVFFIGGNLYLG 211
              +  TP FF+ G   L 
Sbjct: 178 AAGVRQTPTFFVNGKPLLS 196


>gi|223936243|ref|ZP_03628156.1| DSBA oxidoreductase [bacterium Ellin514]
 gi|223895105|gb|EEF61553.1| DSBA oxidoreductase [bacterium Ellin514]
          Length = 186

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 78/187 (41%), Gaps = 29/187 (15%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P + +D   G   AP+ +VEY    C +C   H    K ++ +     +L ++ R FP
Sbjct: 15  AVPISKRDHMQGSIKAPLNLVEYGDYECPYCGLAH-PVVKEVQSEL--GDRLCFVFRNFP 71

Query: 110 L-DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           L D                  G +W    +L+  Q    ++ +  D + + AK       
Sbjct: 72  LVDMHPHAETAAEAAEAAGAQGQFWEMHDILYENQ----HALDDEDLISHAAKL------ 121

Query: 169 DFDTCLNDQNILDDIKAG--KKRASEDF------AIDSTPVFFIGGNLYLGDMSEGVFSK 220
           D D     + ++D++  G  + R  EDF       +  TP FF+ G L+ G+     F  
Sbjct: 122 DLDM----ERLVDELDEGVYRPRVEEDFQSGVRSGVSGTPAFFVNGFLHEGEYD---FDT 174

Query: 221 IIDSMIQ 227
           +++++++
Sbjct: 175 LVNALME 181


>gi|321312898|ref|YP_004205185.1| thiol-disulfide oxidoreductase [Bacillus subtilis BSn5]
 gi|320019172|gb|ADV94158.1| thiol-disulfide oxidoreductase [Bacillus subtilis BSn5]
          Length = 222

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 1/99 (1%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G +++    
Sbjct: 40  VSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVN 99

Query: 108 FPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
                  S +A + +    K     +W F   LF KQ D
Sbjct: 100 VMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPD 138


>gi|86139682|ref|ZP_01058249.1| dsbA-like thioredoxin domain protein [Roseobacter sp. MED193]
 gi|85823573|gb|EAQ43781.1| dsbA-like thioredoxin domain protein [Roseobacter sp. MED193]
          Length = 219

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 85/215 (39%), Gaps = 32/215 (14%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS- 59
           +++S   +GV G     F  + ++ TR G A     +   + D         + ++  S 
Sbjct: 6   LILSVLALGVAG-----FGGATWYATRPGPAAEAKTVAPELAD---------AMIRSYSP 51

Query: 60  -IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLD-SVSTV 116
            +G  DAPVT+VE+    C  C  FH      ++D   + G  +R ++R        S  
Sbjct: 52  ILGPADAPVTIVEFFDPACEACRAFH----PIVKDIMAQHGDAVRVVIRYTAFHGEASEE 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLN 175
           A+ +   A  RM G Y   +  +   Q  W +       L L +A  AG       T   
Sbjct: 108 AIRVLEAA--RMQGVYEPVLEAVLRDQPRWASHGAPEPGLILQIAATAGLDAEAART--- 162

Query: 176 DQNILDDIKA--GKKRAS-EDFAIDSTPVFFIGGN 207
            Q +  D+ A   + RA  E   +  TP FF+ G 
Sbjct: 163 -QMLAPDVVAILNQDRADVETVGVRQTPTFFVNGK 196


>gi|320162490|ref|YP_004175715.1| peptidyl-prolyl cis-trans isomerase B [Anaerolinea thermophila
           UNI-1]
 gi|319996344|dbj|BAJ65115.1| peptidyl-prolyl cis-trans isomerase B [Anaerolinea thermophila
           UNI-1]
          Length = 400

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 76/192 (39%), Gaps = 12/192 (6%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSI-GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           LP P+       L A  P+  KD  I G+  A VT++EY+   C +CA       + L +
Sbjct: 44  LPTPNPT-----LQALIPAPGKDDHILGKDTALVTIIEYSDYQCPYCAMLA-PVLRQLVE 97

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN--SKN 151
           KY     +R + R FPL S     V           G +     L+F +QD   N   +N
Sbjct: 98  KY--PDDVRVVFRYFPLTSHPNSWVAAQAAEAAGKQGKFVEMHELIFAQQDQLANYTPEN 155

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             D  + +A+    + + F      + +   I+     A  +  +  TP  F+ G  Y  
Sbjct: 156 ALDYFVTLAEQLKLNVDQFKQDYASEEVKARIQKNLDEAM-NTGLPGTPFLFLNGLPYQD 214

Query: 212 DMSEGVFSKIID 223
            M     S +++
Sbjct: 215 RMDLETLSSLVE 226


>gi|319408521|emb|CBI82174.1| Outer membrane protein [Bartonella schoenbuchensis R1]
          Length = 285

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 74/172 (43%), Gaps = 15/172 (8%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSV 113
           D   G  +  VT+VE+    C  C  F+      +++       LR I+++ P+   DS+
Sbjct: 125 DAVFGNPNGKVTLVEFFDYNCNFCKRFYPSMVNLIKE----YPDLRIIIKDLPILGPDSI 180

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
              A  +A    ++    Y+ F   L   Q    N  N   A+  +A   G ++ D    
Sbjct: 181 E--AHTIAYAFRQQFPEKYFQFYKELLTSQ----NRANKAKAI-KIAVSLGANEKDLYNA 233

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + + N+    K   + AS    I+ TP   IG  +++G +SE +  + I+S+
Sbjct: 234 IENPNLRKSFKRNIQIAS-TLNINGTPSHIIGDKVFIGAVSEDILKEAIESI 284


>gi|254414867|ref|ZP_05028631.1| DSBA-like thioredoxin domain protein [Microcoleus chthonoplastes
           PCC 7420]
 gi|196178356|gb|EDX73356.1| DSBA-like thioredoxin domain protein [Microcoleus chthonoplastes
           PCC 7420]
          Length = 267

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 85/194 (43%), Gaps = 26/194 (13%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +A++  SP+T      G   + + MVE++   C +C   H KT +    K+     L Y 
Sbjct: 85  QAIIGESPTT------GASQSKIVMVEFSDFQCPYCGRAH-KTVQRFMAKHQDQVTLTY- 136

Query: 105 LREFPLDSVSTVAVMLARCAEKR-MDGGYWGFVSLLFNKQDDWINS---KNYRDALLNMA 160
            + +PL S+   A+  A+ A      G +W +  +LF +Q+    S   +  +   LN+ 
Sbjct: 137 -KHYPLASIHPQAISAAKAAWAAFQQGKFWQYHDVLFTQQEKLGESFYIETAKGLNLNVD 195

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS----EG 216
           +F      D ++   +  I  DI+      +E   I  TP F + G ++ G +     E 
Sbjct: 196 QF----NRDRNSQAAETAISQDIQ-----LAESLGITGTPFFVMNGEVFTGAIELEEMEK 246

Query: 217 VFSKIIDSMIQDST 230
            F+++  S+ +  T
Sbjct: 247 RFTRVKQSLKEQGT 260


>gi|16080401|ref|NP_391228.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221311298|ref|ZP_03593145.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221315625|ref|ZP_03597430.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221320541|ref|ZP_03601835.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221324825|ref|ZP_03606119.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|34921363|sp|O32218|BDBD_BACSU RecName: Full=Disulfide bond formation protein D; AltName:
           Full=Disulfide oxidoreductase D; AltName:
           Full=Thiol-disulfide oxidoreductase D; Flags: Precursor
 gi|2635861|emb|CAB15353.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291485845|dbj|BAI86920.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 222

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 1/99 (1%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G +++    
Sbjct: 40  VSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVN 99

Query: 108 FPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
                  S +A + +    K     +W F   LF KQ D
Sbjct: 100 VMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPD 138


>gi|21218835|ref|NP_624614.1| sodium/proton antiporter [Streptomyces coelicolor A3(2)]
 gi|81552762|sp|Q9S2C8|NHAA2_STRCO RecName: Full=Na(+)/H(+) antiporter nhaA 2; AltName:
           Full=Sodium/proton antiporter nhaA 2
 gi|5824094|emb|CAB54170.1| putative sodium/proton antiporter [Streptomyces coelicolor A3(2)]
          Length = 629

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 87/237 (36%), Gaps = 39/237 (16%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYT--------RKGSALNELPIPDGVVDFRALLAASPST 54
           +   RIG+L  +V  F+ S+            R+  AL       G VD    LA     
Sbjct: 407 LEEARIGILVTLVGAFLTSWAVTAVIGLLPERRRARALL------GDVDPLTDLAVPVDR 460

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             D   G + A VT+VEY    C +C +        + D   +   +RY+ R  PL  V 
Sbjct: 461 RHDRIRGPESAVVTVVEYGDFECPYCGQAE----PVVRDLLGQESDVRYVWRHLPLRDVH 516

Query: 115 TVAVM--LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             A +   A  A  R D  +W    LL  +Q    N+    D LL  A   G     F  
Sbjct: 517 PRAQLAAEASEAAARQD-RFWEMHDLLLERQ----NALAAPD-LLRYAGELGLDVERFRQ 570

Query: 173 CLNDQNILDDIKAGKKRASEDF------AIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
            L D         G +R +ED        +  TP FFI G  + G       ++ ++
Sbjct: 571 DLRDH-------LGARRVAEDVDSADLSRVSGTPTFFINGRRHHGAYDIAALTRAVE 620


>gi|308176335|ref|YP_003915741.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter
           arilaitensis Re117]
 gi|307743798|emb|CBT74770.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter
           arilaitensis Re117]
          Length = 288

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 70/165 (42%), Gaps = 14/165 (8%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR------ 102
           A +P+T +D+++ +K  P+ +  Y  + C HCA+F   T+     +++  GK+       
Sbjct: 109 APAPATPRDLTVAEKGEPINIALYVDVNCVHCADFE-ATYGDQMQQWLADGKVTIEYRNV 167

Query: 103 -YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
            Y+ R    +  S  A  LA C        Y GFV  L+     +   +     L +MA 
Sbjct: 168 GYLDRGSATNFSSRAANALA-CVADESPAAYLGFVKALWGH---YPEGEMKNAELADMAI 223

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
             G +++  D C++D      +K        D  +  TP  F+ G
Sbjct: 224 QNGAAESVAD-CIDDDKFRPFVKYATTAGQYD-GVAGTPSIFVQG 266


>gi|301165890|emb|CBW25463.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 263

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 73/168 (43%), Gaps = 11/168 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G ++AP+T+VEY+   C  C    N T K L  KY   GK+R++ +  PL S    A+  
Sbjct: 96  GAQEAPLTLVEYSDFQCPFCVRGFN-TVKELLKKY--DGKIRFVYKHLPL-SFHKEALPA 151

Query: 121 ARCAEK-RMDGGY--WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
           A   E  R+      + F   +F+ Q      + +   L  MAK  G         +  +
Sbjct: 152 AHYYEAIRLQSAEKAFKFHDEIFDNQRKLSTGEPF---LKKMAKKVGADMKRLAKDVKSK 208

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            +++ +++  K A++ F    TP F + G    G      F KII  +
Sbjct: 209 AVIERVESDIKEAAK-FGFQGTPGFLLNGIPVRGAYPIDHFEKIIAKL 255


>gi|239916941|ref|YP_002956499.1| protein-disulfide isomerase [Micrococcus luteus NCTC 2665]
 gi|281414602|ref|ZP_06246344.1| protein-disulfide isomerase [Micrococcus luteus NCTC 2665]
 gi|239838148|gb|ACS29945.1| protein-disulfide isomerase [Micrococcus luteus NCTC 2665]
          Length = 290

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 70/176 (39%), Gaps = 11/176 (6%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR-- 106
           ++ P T+ +        P  +V Y    C HCA+F +     +E ++++ G++    R  
Sbjct: 110 SSQPETLPNTEARGDGEPTRIVLYEDFNCVHCADFESTNGDQIE-QWLEQGEVTVEYRMV 168

Query: 107 ---EFPLD-SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
                P + + S  A   A C   +    Y GFVS LF   D+         AL  +A+ 
Sbjct: 169 DYLSAPNNQNYSARAANAAYCVADQKPEAYNGFVSALFAAYDEHQGKGLDNAALTQLAQE 228

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
            G    D  +C+ D      ++   ++A     +  TP  F+ G  +  D  +  F
Sbjct: 229 HGA---DIASCVEDGTFRSAVEYTTRQARA-AGVAGTPTVFVDGKNWALDGEDKTF 280


>gi|145592739|ref|YP_001157036.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
 gi|145302076|gb|ABP52658.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
          Length = 219

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 65/164 (39%), Gaps = 6/164 (3%)

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           D  VT+VE+    C  CA  +    + L D     G++ +++R FP+ S     +     
Sbjct: 59  DGRVTLVEFLDFECGPCAAAYPTVKEILAD---YEGQITFVVRYFPISSHPNAELAARAA 115

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                   +     LLF  Q+ W      + +  L  A+  G   + F   L+D      
Sbjct: 116 ESAANQDRFAEMYQLLFENQNAWSRQDEPQTEVFLGYARTLGLDIDRFQRDLDDPATAAR 175

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + A  +   E   +  TP FF+ G   L D+ +   + +ID+ +
Sbjct: 176 V-AKDRTDGEAVGVQGTPTFFLNGE-PLSDLRKDDLTTMIDAAL 217


>gi|324999105|ref|ZP_08120217.1| cyclic nucleotide-binding protein [Pseudonocardia sp. P1]
          Length = 175

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 66/172 (38%), Gaps = 12/172 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVST 115
           D  +G  DA +T+VEY    C +C          +++   + G +LR+  R FPL  V  
Sbjct: 12  DHVLGPPDAELTLVEYGDYECPYC----RDAAPVIDEVRARFGDRLRFAFRHFPLHEVHP 67

Query: 116 -VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                        ++G +W   + LF      +     +D L   A   G          
Sbjct: 68  HALAAAVAAEMAGLEGRFWEMHASLFAPGPPRLR----QDDLREHAAAIGVPPERV-VWP 122

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             Q + D ++AG   A     +  TP  ++ G  Y GD++    +  +D ++
Sbjct: 123 ATQVVEDRVEAGFNAAVRS-GVRGTPTLYVRGERYRGDVTVAALTAALDPVV 173


>gi|297568436|ref|YP_003689780.1| DSBA oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
 gi|296924351|gb|ADH85161.1| DSBA oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
          Length = 286

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 71/157 (45%), Gaps = 25/157 (15%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK-TGKLRYILREFPLD--SVSTV 116
           +G+ DAPV +VE++   C HCA    +    +E   ++   +++ + + FPL     +  
Sbjct: 128 LGRADAPVEIVEFSDFQCPHCA----RVKPLIEQIMLQFPDQVKVVFKHFPLSFHEYAKP 183

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY----RDALLNMAKF-AGFSKNDFD 171
           A +    A+ +  G +W F   LF  Q + I+ +      R+  L+M +F       +  
Sbjct: 184 AALATMAAQNQ--GKFWEFHDKLFAAQSE-ISPQRIRAIARELELDMERFNRDLQSRELH 240

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           + L +Q+I D  +AG         +  TP  F+ G L
Sbjct: 241 SRL-EQDIQDGQQAG---------VRGTPTIFVNGML 267


>gi|322434882|ref|YP_004217094.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
 gi|321162609|gb|ADW68314.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
          Length = 174

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 70/178 (39%), Gaps = 12/178 (6%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P   KD + G  DAP+T+VEY    C  C   +    K L+  + K  +LR++ R FPL 
Sbjct: 6   PVGPKDHTQGPTDAPITLVEYGDFQCPSCGSAYT-VVKKLQRHFGK--RLRFVFRHFPLT 62

Query: 112 SVSTVAVMLARCAEKRMDGG---YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
            +  +A   A  AE         +W    LLF  Q          D   ++A+       
Sbjct: 63  DMHPMAEPAAEAAEYAATESEEKFWAMHDLLFENQQTLST-----DLFADLAEELELDAT 117

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             +  ++       I A    + +   +  TP F+I G+ +         S+ I++ +
Sbjct: 118 KLEKAVHTHKFKSRI-AADLESGDASGLTGTPTFYINGHQHKTAYDYTTLSEAIETAL 174


>gi|288959211|ref|YP_003449552.1| dsbA oxidoreductase [Azospirillum sp. B510]
 gi|288911519|dbj|BAI73008.1| dsbA oxidoreductase [Azospirillum sp. B510]
          Length = 255

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 68/168 (40%), Gaps = 11/168 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           DV  G     VT+VE+    C +C      T   ++       KLR++L+EFP+   ++V
Sbjct: 94  DVVAGNPQGDVTVVEFFDYQCGYCKAVQADTQTLIKG----DPKLRFVLKEFPILGPASV 149

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
               A  A  R  G Y  F + L  ++     +      ++ +AK  G   +     +  
Sbjct: 150 VASKAAIAS-RGQGKYMEFHNALMAQRGQLDEA-----VIMRLAKSVGLDTDRLKKDMEA 203

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            ++L  I A  +  +E   I  TP F  G  L  G +      ++ D+
Sbjct: 204 PDVLKVI-ATNQALAEKLNIRGTPAFIFGDELVPGAIKLDDMKRLTDA 250


>gi|67921403|ref|ZP_00514921.1| DSBA oxidoreductase [Crocosphaera watsonii WH 8501]
 gi|67856515|gb|EAM51756.1| DSBA oxidoreductase [Crocosphaera watsonii WH 8501]
          Length = 245

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 16/168 (9%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           + ++A SPST      G     + ++E++   C +C + + +T K   DK+     L Y 
Sbjct: 82  QTIIADSPST------GSLSEKIILLEFSDFQCPYCEKAY-ETVKEFMDKHGDEVTLVY- 133

Query: 105 LREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
            + FPL ++   A+  A+ +   +  G +W +   LF +QD+        D  + +A+  
Sbjct: 134 -KHFPLFTIHPQALPAAKASWAAQQQGKFWDYYDALFEQQDNL-----GEDFYIELAEDL 187

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
                 F+   N +N    I+   + A E   I  TP+F   G ++ G
Sbjct: 188 DLDMEQFERDRNSRNADLAIEKDMELAQE-IGIQGTPLFIFNGQVFSG 234


>gi|209523914|ref|ZP_03272466.1| DSBA oxidoreductase [Arthrospira maxima CS-328]
 gi|209495586|gb|EDZ95889.1| DSBA oxidoreductase [Arthrospira maxima CS-328]
          Length = 251

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 74/183 (40%), Gaps = 16/183 (8%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           RA++  SP+      +G  DA + +VE++   C  C   H    +++        ++  +
Sbjct: 81  RAIIGDSPT------LGAADAEIVLVEFSDFQCPFCRRAHGTIREFMNRHQ---DQVTLV 131

Query: 105 LREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
            +  PL  + + A+  A+ +   +  G +W + + LF  QDD +    Y    +++    
Sbjct: 132 FKHLPLSQIHSEALPAAKASWAAQQQGKFWEYQNALFEGQDD-LGEALYEAIAISL---- 186

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G     F+   N    +  I+   + AS    I  TP F + G    G +      + + 
Sbjct: 187 GLDLEQFNRDRNSDGAIAAIEQDLQLASV-LGISGTPFFIMNGETLSGAVDLSTLEETLA 245

Query: 224 SMI 226
            +I
Sbjct: 246 EVI 248


>gi|119872007|ref|YP_930014.1| hypothetical protein Pisl_0493 [Pyrobaculum islandicum DSM 4184]
 gi|119673415|gb|ABL87671.1| conserved hypothetical protein [Pyrobaculum islandicum DSM 4184]
          Length = 205

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 56/134 (41%), Gaps = 23/134 (17%)

Query: 14  IVLLFIASYFFY------TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +V L IA+   Y      T + +  + LPIP   + F                G  +AP+
Sbjct: 12  VVFLIIAATIIYKNLSTSTSQTAVSSALPIPSWAISF----------------GNPNAPL 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            +VE   + C +CA  H K    L  + +  GKLR I  +F +   + VA     CA K+
Sbjct: 56  VLVELFDLHCPYCAIAHEK-LDPLYRRLMLEGKLRLIFVDFIVHPDAVVAHRYLHCAYKQ 114

Query: 128 MDGGYWGFVSLLFN 141
           +    +  ++ L+ 
Sbjct: 115 LGNKTYDLLTQLYT 128


>gi|293190198|ref|ZP_06608694.1| DSBA oxidoreductase [Actinomyces odontolyticus F0309]
 gi|292821014|gb|EFF79967.1| DSBA oxidoreductase [Actinomyces odontolyticus F0309]
          Length = 270

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 78/175 (44%), Gaps = 11/175 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APVTMV ++   C +C ++       L D  ++ G LR  +  + L  ++  + + 
Sbjct: 102 GDINAPVTMVLFSDFACPYCTKYAQDIDPALAD-LVEDGTLR--VEWYDLAQITETSPLA 158

Query: 121 ARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND--FDTCLNDQ 177
           A+        G +W F  +++   D   + +    AL++ A  AG    D   +T L+D 
Sbjct: 159 AQAGIAAGEQGKFWEFHDVVYAASDPTGHPQYSEQALVDFAAKAGVPDLDKFRETMLSDH 218

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF--SKIIDSMIQDST 230
                +KA K+RA +   I  TP  FI    Y+    +  +  + I+D   Q ++
Sbjct: 219 TAT-TVKAAKERAHQ-AGITGTPAMFI-NKAYVSGYRDAAYIRNTILDQAAQSAS 270


>gi|239926954|ref|ZP_04683907.1| hypothetical protein SghaA1_01906 [Streptomyces ghanaensis ATCC
           14672]
 gi|291435302|ref|ZP_06574692.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
 gi|291338197|gb|EFE65153.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
          Length = 223

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 63/166 (37%), Gaps = 5/166 (3%)

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           D+ +T+VE+    C  C  +     K L ++Y    ++ ++ R FP+       +     
Sbjct: 62  DSELTLVEFLDFECEACGAYFPVVEK-LREEY--GDRVTFVARYFPMPGHRNGELAARTA 118

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G +    + LF  Q +W  S+ ++ D     A+  G     FD  L D      
Sbjct: 119 EAAARQGKFEEMYTKLFTTQKEWGESQEWKEDVFRGYAEGLGLDMKKFDADLADPETAGR 178

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++   +R      +  TP FF+ G       S   F  +ID  + D
Sbjct: 179 VQE-DQRDGLGLEVQGTPTFFLDGRKIPNPGSYEQFKALIDERLSD 223


>gi|83952915|ref|ZP_00961644.1| 27kDa outer membrane protein [Roseovarius nubinhibens ISM]
 gi|83835706|gb|EAP75006.1| 27kDa outer membrane protein [Roseovarius nubinhibens ISM]
          Length = 220

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 69/163 (42%), Gaps = 13/163 (7%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAE 125
           VT+VE+    C +C     +    LE     +  +R I REFP L   S +A   +  A 
Sbjct: 70  VTLVEFFDYNCGYCRRAAPEVKAVLE----TSKDVRIIYREFPILGPGSEIAARASLAA- 124

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            R  G Y  F   +       +N +    +++ +A   G       T +   ++++D  A
Sbjct: 125 -RNQGKYQQFHEAMM-----ALNGQAVEASVMKVAGDVGLDLEVLKTDMQS-DLVNDHIA 177

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           G  R +E   I  TP F +G  +  G +  G F + I +++ +
Sbjct: 178 GSLRLAEALGITGTPTFVLGDEIIPGVIERGTFLEKIAALVPE 220


>gi|229821995|ref|YP_002883521.1| Na+/H+ antiporter NhaA [Beutenbergia cavernae DSM 12333]
 gi|229567908|gb|ACQ81759.1| Na+/H+ antiporter NhaA [Beutenbergia cavernae DSM 12333]
          Length = 630

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 92/234 (39%), Gaps = 20/234 (8%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           V +  R+GVL G VL F+ +   +      +++   P G    R  LA      +D   G
Sbjct: 411 VQNEARVGVLSGSVLAFVIATVIFR-----VSDRIRPPGESARR--LARPIDPERDHIFG 463

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSV-STVAVM 119
             DAP T+VEY    C  C     K    +++ + + G +LRY+ R  PL          
Sbjct: 464 ALDAPFTIVEYGDFQCGFCL----KASGSIQEVHRELGDRLRYVWRHAPLTRYHPNALAA 519

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                     G ++ F   LF  Q+  +        ++  A+  G     F+  L    +
Sbjct: 520 AEASEAAARQGKFFEFERSLFADQEHQLPVD-----IIRRAEELGLDVEQFEADLTSPEV 574

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM-SEGVFSKIIDSMIQDSTRR 232
              ++     A E   I + P  F+ G L++G   ++ +  +++++      RR
Sbjct: 575 TARVQDDMLDA-EAMDITAVPTLFVNGRLHVGPYDAQSLIRELMETAPSADARR 627


>gi|242279505|ref|YP_002991634.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
 gi|242122399|gb|ACS80095.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
          Length = 274

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 7/173 (4%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS-TVAV 118
           +G  +APVT+VEY    C +C++      K + +   +  K R I +  P+   S  +A+
Sbjct: 89  LGSPEAPVTIVEYTDFLCPYCSKGAKVVSKLVAE---QPEKYRLIFKHLPMHKNSRELAL 145

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           +    A+   +  Y  F  L F +Q D    K     L  + +      +     L    
Sbjct: 146 VFEAIAQFDKERAY-KFHDLAFERQKDLYEDKEG-IVLSKILEEVAVDPDLLQKHLRSPK 203

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +   + A +K A   F ID+TP F + G    G +    F +++D +++ S +
Sbjct: 204 LQAFLLADEKEAGA-FGIDATPTFLVNGVSVRGYLPADRFEQMVDMIMEKSGK 255


>gi|218887262|ref|YP_002436583.1| DSBA oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758216|gb|ACL09115.1| DSBA oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 267

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 75/182 (41%), Gaps = 26/182 (14%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APVT++ Y+  TC +C +    T + L   Y    K+RY+ +  PLDS     +  
Sbjct: 98  GPANAPVTIIAYSDFTCPYCQQAAG-TMELLLANY--KDKVRYVFKHMPLDSHDNARLAS 154

Query: 121 A-RCAEKRMDG-GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF-SKNDFDTCLNDQ 177
               A    DG   W F   +F  ++  +            A+   F  K   D  L+ +
Sbjct: 155 EYHVAAGLQDGKKAWAFYETVFRDREKLV------------AEGEPFLKKAAADAGLDMK 202

Query: 178 NILDDIKAGKKRAS--EDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            +  DIK  K + S  ED A      +  TP F +   +  G +   +FS  +D  ++ +
Sbjct: 203 RLAQDIKGKKVKDSIEEDMAEARALNVQGTPYFLVNDLVIRGSLPLDLFSDAVDMALEAA 262

Query: 230 TR 231
            +
Sbjct: 263 AK 264


>gi|94264471|ref|ZP_01288259.1| DSBA oxidoreductase [delta proteobacterium MLMS-1]
 gi|93455102|gb|EAT05326.1| DSBA oxidoreductase [delta proteobacterium MLMS-1]
          Length = 282

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 69/174 (39%), Gaps = 23/174 (13%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G +DA V +VE++   C HCA     T + L    +    L+ + + FPL S       
Sbjct: 123 LGPEDASVVLVEFSDFQCPHCARVKPLTEQLL----LNNDDLKVVFKHFPLSSHEQAKPA 178

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                  +  G +W     +F  Q D ++ +  ++    +A+  G     F   +N + +
Sbjct: 179 ALAAMAAQQQGKFWEMHDRIFAAQQD-LSPRTLQE----IARDIGLDMELFQRDINSREL 233

Query: 180 LDDIKAGKKRASEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                   +R  +D A      +  TP  FI G        +G+  ++ID  ++
Sbjct: 234 -------ARRLEQDMADGQQAGVRGTPALFINGIPVTQRNQQGI-QQMIDRALE 279


>gi|197123625|ref|YP_002135576.1| Na+/H+ antiporter NhaA [Anaeromyxobacter sp. K]
 gi|196173474|gb|ACG74447.1| Na+/H+ antiporter NhaA [Anaeromyxobacter sp. K]
          Length = 627

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 60/169 (35%), Gaps = 34/169 (20%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D  +G   A +T+VEY S  C HC   H +    L D+     +LRY+ R+ P+ + S 
Sbjct: 19  RDHVLGDAGAELTLVEYGSYACPHCHAAH-EVVAELRDRL--GDRLRYVFRQRPIRAESA 75

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
                   A       +W        K  D           L M +   F+  + D    
Sbjct: 76  RPAAELAEAAGLAADRFW--------KAHD-----------LLMRRGPSFAPGELDAIAR 116

Query: 176 DQNILDDIKAG------KKRASEDF------AIDSTPVFFIGGNLYLGD 212
           +  +    + G        R  ED        +  TP FFIGG  Y G 
Sbjct: 117 ELGLPPREEGGGPWEGAAARVGEDVESARRSGVHLTPTFFIGGRRYEGP 165


>gi|315502259|ref|YP_004081146.1| dsba oxidoreductase [Micromonospora sp. L5]
 gi|315408878|gb|ADU06995.1| DsbA oxidoreductase [Micromonospora sp. L5]
          Length = 238

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 68/163 (41%), Gaps = 10/163 (6%)

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI------LREFPLDSVSTVAV 118
            PVT+  Y    C  C +F   + + L ++ +  GK R +      L  F     ST + 
Sbjct: 75  GPVTIDLYEDYLCPACKQFQQISGETL-NQLVSEGKARLVFHPVAFLNRFSTTEYSTRSS 133

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
             + CA +   G +  F   LF KQ     +    D L+++    G ++++F +C++D  
Sbjct: 134 AASGCAAQ--GGKFREFTDQLFTKQPPEGGAGLSNDELVDIGAGVGLNRDEFASCVSDGT 191

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
                +     AS+   + STP   + G+       EG+ S +
Sbjct: 192 YRPWTEHVTDEASKS-GVTSTPTIKVNGSDLQDRSPEGIKSAV 233


>gi|116622720|ref|YP_824876.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116225882|gb|ABJ84591.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 293

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 72/177 (40%), Gaps = 15/177 (8%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
           T+    IG  +A + +VE++   C +C +   K    L+        +R I ++FPL++ 
Sbjct: 123 TLGSPMIGPANARIVLVEFSDFQCPYCVKAVAKINAILQ---AYPNDVRLIFKQFPLETH 179

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
              ++  A        G +W     LF  +     ++  R  +L  A   G     F   
Sbjct: 180 PQASISAAAALAAHNQGKFWAMHDTLFANR-----TQLSRQNILGWAAKLGLDMKRFTAD 234

Query: 174 LNDQNILDDIKAGKKRASED---FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           L+     D IK    + ++D     ++ TP  FI G  Y G+++      +ID  ++
Sbjct: 235 LDS----DAIKKAVIKDTQDGDKAGVEGTPTVFIDGQRYNGELALDAVKPVIDGELK 287


>gi|225631011|ref|YP_002727802.1| DsbA-like disulfide oxidoreductase [Wolbachia sp. wRi]
 gi|225592992|gb|ACN96011.1| DsbA-like disulfide oxidoreductase [Wolbachia sp. wRi]
          Length = 252

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/167 (19%), Positives = 77/167 (46%), Gaps = 12/167 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +++ V +  +   +C +C    N   + + D     GK++YI R+ P+ S +++    
Sbjct: 91  GNENSSVIVAGFLDYSCGYCKAMKNDIKQLIND-----GKIKYIFRDAPILSNASLKAAK 145

Query: 121 ARCAEKRMDG-GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ-N 178
           +  A   +D   Y+ F     + + ++ +     +++L++ K  G  ++DF+  + D  +
Sbjct: 146 SALAVYFLDKEKYFDFHHAALSHKGEFSD-----ESILDIVKNIGIDEDDFNDSIKDNAD 200

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            ++ +    +    D  +  TP   IG +L++G     V  K +D +
Sbjct: 201 KIEQMINNSRLLVRDLGVGGTPFLIIGDSLFVGATDLNVLRKKVDEL 247


>gi|62388911|ref|YP_224313.1| HCCA isomerase, protein [Corynebacterium glutamicum ATCC 13032]
 gi|41324244|emb|CAF18584.1| HCCA ISOMERASE, secreted protein [Corynebacterium glutamicum ATCC
           13032]
          Length = 248

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 74/184 (40%), Gaps = 5/184 (2%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D  ++ A  PS    V++G  DAPV +V ++   C  CA++ ++T   +  K+++ G LR
Sbjct: 66  DLTSVEARDPS--DPVAVGDVDAPVGLVVFSDYQCPFCAKWSDETLPQMM-KHVEDGNLR 122

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
              RE  +    +     A  A    D  Y  + + LF   +         + L+ +A  
Sbjct: 123 IEWREVNIFGEPSERGARAAYAAGLQD-AYLEYHNALFANGEKPSEDLLSEEGLIKLAGD 181

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G  ++ F            I A  ++   D    STP F +GG   +G     VF    
Sbjct: 182 LGLDESKFTADFQSPETAVAI-AQHQQLGIDLGAYSTPAFLLGGQPIMGAQPASVFEAAF 240

Query: 223 DSMI 226
           +  +
Sbjct: 241 EQAL 244


>gi|134102133|ref|YP_001107794.1| DsbA-like thioredoxin domain-containing protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|291007616|ref|ZP_06565589.1| DsbA-like thioredoxin domain-containing protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|133914756|emb|CAM04869.1| DsbA-like thioredoxin domain protein [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 248

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 66/170 (38%), Gaps = 12/170 (7%)

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           D  VT+ E+    C  C +++    K +E +Y   G++ +++R FPLD         +  
Sbjct: 69  DGKVTVTEFLDYQCPACEQYYRGITKQVEQQY--AGRINFVVRNFPLDMHPLARQAASAA 126

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
               M G +      L++    W  + + ++   +  K A            D N L   
Sbjct: 127 EAAGMQGKFKEMYHALYDNYQAWAIAPDGQNVSSDSQKAAALIDQYAQQIGLDVNRLHQD 186

Query: 184 KAG---KKRASEDFA------IDSTPVFFIGGNLYLGDMSEGV-FSKIID 223
            A    K +   D A      ++STP  FI G  +     +GV + ++ D
Sbjct: 187 MASPQIKAKLDRDLADGEAARVNSTPTLFINGKQFQAPSGDGVTYQQVAD 236


>gi|19551268|ref|NP_599270.1| protein-disulfide isomerase [Corynebacterium glutamicum ATCC 13032]
 gi|21322783|dbj|BAB97412.1| Protein-disulfide isomerase [Corynebacterium glutamicum ATCC 13032]
          Length = 254

 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 74/184 (40%), Gaps = 5/184 (2%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D  ++ A  PS    V++G  DAPV +V ++   C  CA++ ++T   +  K+++ G LR
Sbjct: 72  DLTSVEARDPS--DPVAVGDVDAPVGLVVFSDYQCPFCAKWSDETLPQMM-KHVEDGNLR 128

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
              RE  +    +     A  A    D  Y  + + LF   +         + L+ +A  
Sbjct: 129 IEWREVNIFGEPSERGARAAYAAGLQD-AYLEYHNALFANGEKPSEDLLSEEGLIKLAGD 187

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G  ++ F            I A  ++   D    STP F +GG   +G     VF    
Sbjct: 188 LGLDESKFTADFQSPETAVAI-AQHQQLGIDLGAYSTPAFLLGGQPIMGAQPASVFEAAF 246

Query: 223 DSMI 226
           +  +
Sbjct: 247 EQAL 250


>gi|145294065|ref|YP_001136886.1| hypothetical protein cgR_0023 [Corynebacterium glutamicum R]
 gi|140843985|dbj|BAF52984.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 248

 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 74/184 (40%), Gaps = 5/184 (2%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D  ++ A  PS    V++G  +APV +V ++   C  CA++ ++T   +  K+++ G LR
Sbjct: 66  DLTSVEARDPS--DPVAVGDVNAPVGLVVFSDYQCPFCAKWSDETLPQMM-KHVEDGNLR 122

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
              RE  +    +     A  A    D  Y  + + LF   +        +D L+ +A  
Sbjct: 123 IEWREVNIFGEPSERGARAAYAAGLQD-SYLEYHNALFANGEKPSEELLSKDGLIELAGE 181

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G   + F            I A  ++   D    STP F +GG   +G     VF    
Sbjct: 182 LGLDVSKFTEDFQSPETAAAI-AQHQQLGIDLGAYSTPAFLLGGQPIMGAQPASVFEAAF 240

Query: 223 DSMI 226
           +  +
Sbjct: 241 EQAL 244


>gi|16923692|gb|AAL31540.1|AF435074_5 HCCA isomerase [Corynebacterium glutamicum]
          Length = 254

 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 75/184 (40%), Gaps = 5/184 (2%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D  ++ A  PS    V++G  +APV +V ++   C  CA++ ++T   +  K+++ G LR
Sbjct: 72  DLTSVEARDPS--GPVAVGDVNAPVGLVVFSDYQCPFCAKWSDETLPQMM-KHVEDGNLR 128

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
              RE  +    +     A  A    D  Y  + + LF+  +         + L+ +A  
Sbjct: 129 IEWREVNIFGEPSERGARAAYAAGLQD-AYLEYHNALFDNGEKPSEELLSEEGLIKLAGD 187

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G  ++ F            I A  ++   D    STP F +GG   +G     VF    
Sbjct: 188 LGLDESKFTADFQSPETAAAI-AQHQQLGIDLGAYSTPAFLLGGQPIMGAQPASVFEAAF 246

Query: 223 DSMI 226
           +  +
Sbjct: 247 EQAL 250


>gi|154507803|ref|ZP_02043445.1| hypothetical protein ACTODO_00285 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797437|gb|EDN79857.1| hypothetical protein ACTODO_00285 [Actinomyces odontolyticus ATCC
           17982]
          Length = 270

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 78/175 (44%), Gaps = 11/175 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APVTMV ++   C +C ++       L D  ++ G LR  +  + L  ++  + + 
Sbjct: 102 GDINAPVTMVLFSDFACPYCTKYAQDIDPALAD-LVEDGTLR--VEWYDLAQITETSPLA 158

Query: 121 ARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND--FDTCLNDQ 177
           A+        G +W F  +++   D   + +    AL++ A  AG    D   +T L+D 
Sbjct: 159 AQAGIAAGEQGKFWEFHDVVYAAADATGHPQYSEQALVDFAAKAGVPDLDKFRETMLSDH 218

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF--SKIIDSMIQDST 230
                +KA K+RA +   I  TP  FI    Y+    +  +  + I+D   Q ++
Sbjct: 219 TAT-TVKAAKERAHQ-AGITGTPAMFI-NKAYVSGYRDAAYIRNTILDQAAQSAS 270


>gi|85707009|ref|ZP_01038098.1| 27kDa outer membrane protein [Roseovarius sp. 217]
 gi|85668450|gb|EAQ23322.1| 27kDa outer membrane protein [Roseovarius sp. 217]
          Length = 220

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 67/169 (39%), Gaps = 13/169 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVM 119
           G  D  VT+VE+    C +C     +    LE     +  +R I REFP L   S VA  
Sbjct: 64  GNLDGSVTLVEFFDYNCGYCRRAAPEVKAVLE----ASKDVRIIYREFPILGPGSEVAAR 119

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
            +  A  R  G Y  F   +       +N +    +++ +A   G       T +   ++
Sbjct: 120 ASLAA--RNQGKYQQFHEAMM-----ALNGQAVEASVMKIAGDVGLDLEVLKTDMQSDSV 172

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            D I A   R +E   I  TP F +G  +  G +  G   + I  ++ +
Sbjct: 173 SDHI-AASLRFAEALGITGTPTFVLGDEIIPGVIERGTLLEKIAELVPE 220


>gi|73538274|ref|YP_298641.1| DSBA oxidoreductase [Ralstonia eutropha JMP134]
 gi|72121611|gb|AAZ63797.1| DSBA oxidoreductase [Ralstonia eutropha JMP134]
          Length = 173

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 64/154 (41%), Gaps = 10/154 (6%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
           T  D +IG   A VT+VEY    C +C   +    K L + Y    ++R++ R +P+   
Sbjct: 7   TAADHAIGPDTARVTVVEYGDFECEYCRMAYG-AMKILMEHY--GPQVRFVYRHYPMSHW 63

Query: 114 S-TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             +                +W    LL  K +   +     +AL + A   G   N FD+
Sbjct: 64  HPSAEAAAECAEAAGAQQKFWQMYRLLHEKPNGLKS-----EALRHYAGMLGMDLNRFDS 118

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            +   + L  I+   + A++ + +  TP FF+ G
Sbjct: 119 DMAAHSHLPHIRDDMRGATQ-WQVRGTPSFFVNG 151


>gi|319954455|ref|YP_004165722.1| dsba oxidoreductase [Cellulophaga algicola DSM 14237]
 gi|319423115|gb|ADV50224.1| DSBA oxidoreductase [Cellulophaga algicola DSM 14237]
          Length = 171

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 71/161 (44%), Gaps = 22/161 (13%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVM 119
           G  +A + +VEY    C HC   H+     +++    + +++++ R FPL  + T     
Sbjct: 15  GNLNASLEIVEYGDFECAHCGAAHSIMETIMKE---FSNQIKFVFRNFPLSEMHTNALEA 71

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQD-----DWIN-SKNYRDALLNMAKFAGFSKNDFDTC 173
                   + G YW   + +F  Q+     D++  ++N R   +++ KF    K D    
Sbjct: 72  AKATEAAALQGKYWEMHNSIFENQEYLQPNDFVQRAENLR---MDIQKF----KMDMRQN 124

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
              + I  D ++G +       ++ TP FF+ GN + GD S
Sbjct: 125 NIAEKIDTDFESGIRS-----GVNGTPSFFVNGNKFDGDAS 160


>gi|258651138|ref|YP_003200294.1| DSBA oxidoreductase [Nakamurella multipartita DSM 44233]
 gi|258554363|gb|ACV77305.1| DSBA oxidoreductase [Nakamurella multipartita DSM 44233]
          Length = 188

 Score = 44.3 bits (103), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 61/161 (37%), Gaps = 29/161 (18%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVM 119
           G  DAPVT++EY    C +CA       + L       G++R I R FPL  V       
Sbjct: 31  GALDAPVTVIEYGDFECPYCAAAKPVLEEVLAG---SAGRVRLIFRNFPLYEVHPYALTA 87

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQ---DDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
                     G +W    +LF  Q    DW           ++AK+A  +K   D     
Sbjct: 88  ALAAEAAAAQGAFWPMHDMLFAHQTRLSDW-----------DLAKYA--TKLGLD---GS 131

Query: 177 QNILDDIKAGKKRASEDFA------IDSTPVFFIGGNLYLG 211
           + I D  +    +   DFA      +  TP  FI G LY G
Sbjct: 132 RVIGDPAQPYGDKVEADFALALAAGVQGTPTVFINGVLYEG 172


>gi|90419266|ref|ZP_01227176.1| putative protein disulfide isomerase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336203|gb|EAS49944.1| putative protein disulfide isomerase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 221

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 61/153 (39%), Gaps = 14/153 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV-STVAV 118
           +G + APVT+VE+    C  C  F+    + + +       +R +LR  P     S  A+
Sbjct: 55  LGPEQAPVTIVEFFDPACEACRAFYPTVKQIIAE---HGAAVRVVLRYTPFHGEGSEEAI 111

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQ 177
            +   A  RM G +   +  +  +Q  W +       L L +A  AG   +   T +   
Sbjct: 112 RVLEAA--RMQGVFEPVLQAIMREQPQWASHGAPEPGLVLQIAASAGLDADAARTQMQAP 169

Query: 178 N---ILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
               IL+  +A      E   +  TP FF+ G 
Sbjct: 170 QTTAILNQDRAD----VETMGVSQTPTFFVNGR 198


>gi|327311047|ref|YP_004337944.1| hypothetical protein TUZN_1153 [Thermoproteus uzoniensis 768-20]
 gi|326947526|gb|AEA12632.1| hypothetical protein TUZN_1153 [Thermoproteus uzoniensis 768-20]
          Length = 270

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           T   + +G KDA V ++EY   TC +CA F +  +  L ++YI+ G + Y +R FP
Sbjct: 90  TSTSLLVGSKDAKVVVIEYLDPTCPYCALF-DAQYGALLNQYIQNGTVLYAVRYFP 144


>gi|145589563|ref|YP_001156160.1| DSBA oxidoreductase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047969|gb|ABP34596.1| DSBA oxidoreductase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 276

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 16/135 (11%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEF---HNKTFKYLEDKYIKTGKLRYILREFPL---DSVS 114
           G+ DA ++++EY+   C  C +F    NK    + D+      +  + R FPL   D V+
Sbjct: 98  GKPDAVISIIEYSDFECPFCKQFGDIPNKVVDSMPDQ------VNLVWRNFPLSFHDPVA 151

Query: 115 TVAVMLARCAEKRM-DGGYWGFVSLLFNK---QDDWINSKNYRDALLNMAKFAGFSKNDF 170
           T   + A CA ++  +  +W +   +F         + S N  D LL +AK  G   + F
Sbjct: 152 TKEAIAAACAAQQGGNNAFWKYAQGIFKNTRSNAQGMPSVNGVDPLLALAKEQGLDTDKF 211

Query: 171 DTCLNDQNILDDIKA 185
            TC+  + +   + A
Sbjct: 212 STCMQSEAVAKQVSA 226


>gi|158316713|ref|YP_001509221.1| DSBA oxidoreductase [Frankia sp. EAN1pec]
 gi|158112118|gb|ABW14315.1| DSBA oxidoreductase [Frankia sp. EAN1pec]
          Length = 262

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 68/167 (40%), Gaps = 15/167 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S G+  APV +VEY    C +CA       + ++      G++R + R FP+  +   A+
Sbjct: 83  SRGEPGAPVVIVEYGDFECPYCARAAAILHELVDS---SDGQVRQVFRHFPVFDIHPYAL 139

Query: 119 MLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND- 176
             A  AE     G +W    LLF  QD   +       L+  A+  G    + D  + D 
Sbjct: 140 TAALAAEVAGAHGRFWEMHDLLFANQDKLADKY-----LMAFARSLGI---ETDLVVGDP 191

Query: 177 -QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            Q   D ++A     +E   +  TP  FI G  Y G +  G     +
Sbjct: 192 AQPYGDAVEADYAGGAE-LRVQGTPTIFIDGVRYRGRLELGPLRTAV 237


>gi|227541601|ref|ZP_03971650.1| dsba oxidoreductase [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227182569|gb|EEI63541.1| dsba oxidoreductase [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 264

 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 70/175 (40%), Gaps = 12/175 (6%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           + G+ DAPV + E++   C  CA++ N+T+  +   Y+  G +R    +  ++    V  
Sbjct: 93  ATGKVDAPVVISEFSDFECPFCAKYANETYPQVLKDYVDKGLVRVEWNDMAVNGPDAVKA 152

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDD-WINSKNYRDALLNMAKFAGFS-----KNDFDT 172
             A  A     G +  F + L+    D   + +N  +  +  A  AG       +++ ++
Sbjct: 153 AEAGRA-AAAQGKFHEFHNALYTASKDIQGHPENDIEDFVRFATEAGVPDLDRFRSEVES 211

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
               Q +    K G         I  TP F IG     G     VF K I+  +Q
Sbjct: 212 GTYTQAVTSATKYGAS-----IGISGTPSFIIGDQFVSGAQPYEVFQKAIEEQLQ 261


>gi|149375409|ref|ZP_01893180.1| hypothetical protein MDG893_03025 [Marinobacter algicola DG893]
 gi|149360445|gb|EDM48898.1| hypothetical protein MDG893_03025 [Marinobacter algicola DG893]
          Length = 398

 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 13/71 (18%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           +GV++++ L++ +PS           AP+ ++ Y S+ C HC +F N   +Y  D+  + 
Sbjct: 183 NGVINYQTLVSKNPS-----------APMVVINY-SLACKHCLDFLNDELRYYLDQ-AEQ 229

Query: 99  GKLRYILREFP 109
           G+L  +LRE P
Sbjct: 230 GRLSIVLREVP 240


>gi|145301244|ref|YP_001144084.1| DsbA family oxidoreductase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142856021|gb|ABO92336.1| DsbA family oxidoreductase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 261

 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 70/155 (45%), Gaps = 19/155 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA--- 117
           G  +A  T+VE++ + C +C  FH+ T K L D     G + +  +  PLD  +  A   
Sbjct: 82  GDLNARFTLVEFSDIECPYCKRFHD-TPKQLVD--ASKGNVNWQWKHMPLDFHNPAAFKE 138

Query: 118 VMLARC-AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN- 175
            + A C +E++ + G+W F++ +F       N    +D L  +    G   + F  CL  
Sbjct: 139 AVAAECISEQKGNRGFWVFINDMFEHTQG--NGAGVKD-LPQVVAGVGADLSAFRECLAA 195

Query: 176 ---DQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
              D+ + ++I+  K        ++ TP  F+  N
Sbjct: 196 GKMDEKVQENIQQAK-----SLGVNGTPATFVVDN 225


>gi|227487230|ref|ZP_03917546.1| dsba oxidoreductase [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227092888|gb|EEI28200.1| dsba oxidoreductase [Corynebacterium glucuronolyticum ATCC 51867]
          Length = 264

 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 70/175 (40%), Gaps = 12/175 (6%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           + G+ DAPV + E++   C  CA++ N+T+  +   Y+  G +R    +  ++    V  
Sbjct: 93  ATGKVDAPVVISEFSDFECPFCAKYANETYPQVLKDYVDKGLVRVEWNDMAVNGPDAVKA 152

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDD-WINSKNYRDALLNMAKFAGFS-----KNDFDT 172
             A  A     G +  F + L+    D   + +N  +  +  A  AG       +++ ++
Sbjct: 153 AEAGRA-AAAQGKFHEFHNALYTASKDVQGHPENDIEDFVRFATEAGVPDLDRFRSEVES 211

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
               Q +    K G         I  TP F IG     G     VF K I+  +Q
Sbjct: 212 GTYTQAVTSATKYGAS-----IGISGTPSFIIGDQFVSGAQPYEVFQKAIEEQLQ 261


>gi|149922961|ref|ZP_01911381.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149816212|gb|EDM75719.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 704

 Score = 43.9 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 60/163 (36%), Gaps = 4/163 (2%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G+ +A VT+VEY+   C +C +    T   +E++Y     +R + R+ PL          
Sbjct: 303 GKAEALVTIVEYSDFECPYCRKVL-PTLTQIEEEY--GDDVRVVFRQQPLPMHKNAKPAA 359

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                      +W     LF K      +         +A   G     F+  + D  + 
Sbjct: 360 LAALAAHKQDKFWEMHDALFEKAGSERGALGKEGVYSELATQLGLDVAKFEADMKDPELA 419

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
             I A  ++ ++ F    TP FF+ G    G      F  IID
Sbjct: 420 KMI-AEDQKVAQQFGAGGTPAFFVNGRFVSGAQPFEAFKAIID 461



 Score = 37.0 bits (84), Expect = 2.2,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 74/172 (43%), Gaps = 24/172 (13%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL----DSVSTV 116
            +  A VT+VEY+   C +C+   +   + L +K+ +   +R + + +PL    D+    
Sbjct: 81  AESGALVTIVEYSDFQCPYCSRLTD-ALRELAEKHPE--DVRIVFKHYPLAMHRDARPAS 137

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNK-----QDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             +LA  A+ +  G  W    ++F       +DD I     +  + +M KF    K D +
Sbjct: 138 EAVLAAHAQGKEFG--WAMHDIVFKNARKLSKDDLIAYAE-QAKVPDMDKF----KADLE 190

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
                  +  D+  GK+     F + STP FFI G    G  +     K+++
Sbjct: 191 GKTFGGAVEADMTQGKR-----FGVTSTPSFFINGRPQRGAKNLEALEKLVE 237


>gi|224477392|ref|YP_002634998.1| hypothetical protein Sca_1907 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421999|emb|CAL28813.1| conserved hypothetical protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 199

 Score = 43.9 bits (102), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 64/162 (39%), Gaps = 10/162 (6%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDS 112
           + KD  +  K+  + +VE+A   C +C +  +     LE  YI  GK+ Y +     L  
Sbjct: 21  SQKDPDLNSKNGKIRVVEFADYKCPYCKKVEDNIMPKLEKDYIDKGKVDYQMVNVAFLGK 80

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD-------WINSKNYRDALLNMAKFAGF 165
            S +        +      Y  F   +F  Q D       WIN K   D L++  K +  
Sbjct: 81  DSIIGSRAGHAVKNIAPKQYLDFQKKIFAVQPDTEDHKKPWINEK-LLDKLIDGLKISNK 139

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRA-SEDFAIDSTPVFFIGG 206
            K D       +N      A K +A ++   ID+ PV F+ G
Sbjct: 140 QKADIKKDYKTKNSKSWKDAEKDKAFAKKKNIDTVPVVFVDG 181


>gi|328913412|gb|AEB65008.1| Disulfide bond formation protein D [Bacillus amyloliquefaciens LL3]
          Length = 223

 Score = 43.9 bits (102), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 69/169 (40%), Gaps = 14/169 (8%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +A  PS      +G+  APVT+VE+    C  C  F++  F  ++  +I  G +++    
Sbjct: 39  VAEQPSIKGQPVLGKDSAPVTVVEFGDYKCPSCKVFNSDIFPKIKKDFIDKGDVKFSFVN 98

Query: 108 FPLD-SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMAKF 162
                S S +A + +    K     +W F   LF +Q     +W+       ALL     
Sbjct: 99  VMFHGSGSRLAALASEEVWKEDPASFWAFHEKLFEQQPSSEQEWVTP-----ALLEKTVK 153

Query: 163 AGFSKNDFDTC---LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           +   K D D     L+ +    ++KA     ++   I +TP  ++   L
Sbjct: 154 STAKKVDPDKLKENLDKETFSKELKAD-TDLNDKLNITATPTIYVNDKL 201


>gi|319950808|ref|ZP_08024694.1| hypothetical protein ES5_14423 [Dietzia cinnamea P4]
 gi|319435522|gb|EFV90756.1| hypothetical protein ES5_14423 [Dietzia cinnamea P4]
          Length = 228

 Score = 43.9 bits (102), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 75/176 (42%), Gaps = 13/176 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE---FPLDSVST 115
           ++G  DAPV +V ++   C  CA++   T   + D+  + G LR   R+   +  DS   
Sbjct: 59  ALGPVDAPVGLVVFSDYQCPFCAQWSRDTLPSMVDR-AEIGDLRIEWRDVNVYGPDSRRA 117

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY--RDALLNMAKFAGFSKNDFDTC 173
                A  A+ R    +W +   LF   D  I S +   R+ L+ +A   G   + F   
Sbjct: 118 ALASFAAAAQDR----FWDYHDALFA--DGRIRSGDELSREGLVALAGDLGLDTDRFAAD 171

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +      ++I A  ++   D    +TPVF +GG   +G     VF +   S +  S
Sbjct: 172 MTSPAAEEEI-ARNEQLGIDHGAMATPVFLLGGKPLVGAQPPEVFLEAYQSALDSS 226


>gi|111018707|ref|YP_701679.1| NahA family Na(+)/H(+) antiporter [Rhodococcus jostii RHA1]
 gi|123340817|sp|Q0SG15|NHAA1_RHOSR RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|110818237|gb|ABG93521.1| Na+/H+ antiporter, NhaA family protein [Rhodococcus jostii RHA1]
          Length = 622

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 75/204 (36%), Gaps = 20/204 (9%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R+GVL   V+  +  +  + R    ++    P  VV    L    P   +D   G  DAP
Sbjct: 406 RVGVLTAAVIATVLGWALF-RLSDTVHP---PTEVVGLTLLRPVDPG--RDHLRGPADAP 459

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVA-VMLARCA 124
           +T+VEY    C  C    +K    + D     G +LRY+ R  PLD V   A        
Sbjct: 460 LTLVEYGDFECPFC----SKATGSIRDVRAHFGDELRYVFRHLPLDDVHPHARFAAQASE 515

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                G +W     LF   D         D +   A   G   + F+  +     +  I 
Sbjct: 516 AAAAQGRFWEMHDHLFANSD-----ALAEDEIFGYAAELGLDMDRFEEDIRRGTYVHRID 570

Query: 185 AGKKRA-SEDFAIDSTPVFFIGGN 207
             +  A S DF    TP F++G  
Sbjct: 571 DDELDAESSDF--RGTPTFYLGAT 592


>gi|257454569|ref|ZP_05619826.1| dsba oxidoreductase [Enhydrobacter aerosaccus SK60]
 gi|257448042|gb|EEV23028.1| dsba oxidoreductase [Enhydrobacter aerosaccus SK60]
          Length = 234

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 67/151 (44%), Gaps = 11/151 (7%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--DSVSTVA 117
           IG+ DAPVT+VE+   +C  C    N   K + +++   GK+R +LR + L       VA
Sbjct: 70  IGKVDAPVTIVEFFDPSCEACRAM-NPYVKQIINEH--NGKVRLVLR-YTLFHKGSEQVA 125

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            +L    E+   G Y   ++ +F  Q  W + +  + A    A  AG  +      +N  
Sbjct: 126 RILETAKEQ---GIYEPVLAAVFEAQPQWHDDETVK-AAWQAAIKAGLDEQKARASMNSD 181

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
            I   +K     A +   I  TP +++ G L
Sbjct: 182 KINQVLKQDMDDA-KTIKISGTPTYYVNGKL 211


>gi|268316621|ref|YP_003290340.1| DSBA oxidoreductase [Rhodothermus marinus DSM 4252]
 gi|262334155|gb|ACY47952.1| DSBA oxidoreductase [Rhodothermus marinus DSM 4252]
          Length = 409

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 65/159 (40%), Gaps = 13/159 (8%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--S 112
           M D + G  DA V ++EY    C HC   H    + +E   ++     ++ +  PL   S
Sbjct: 243 MNDPTAGNPDAKVVVIEYLDPNCPHCKHLHPIMKQVVESYGLQA---YFVFKPIPLWQFS 299

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
           +  VA + A   E    G +   +   F +Q    +     + +L++A+  G  +N+   
Sbjct: 300 IPQVAALYAAARE----GKFEAMLEAQFERQR---SGGLTLEEILDIAEAIGMDRNELAR 352

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            +N+  + ++    + R +    +   P   I G+   G
Sbjct: 353 QINE-GVFNEYMQRQSRQASMIGVRGVPTVLINGHFVPG 390


>gi|103487749|ref|YP_617310.1| protein-disulfide isomerase [Sphingopyxis alaskensis RB2256]
 gi|98977826|gb|ABF53977.1| protein-disulfide isomerase [Sphingopyxis alaskensis RB2256]
          Length = 237

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   A + +VEY S TC  CA+F       L  +YI  G +R+  R    D V   A +
Sbjct: 49  VGNPAAKLRLVEYFSYTCHVCADFAKAASLPLRTQYIDPGLVRFEYRNLVRDPVDMTAAL 108

Query: 120 LAR 122
           LAR
Sbjct: 109 LAR 111


>gi|298248027|ref|ZP_06971832.1| DSBA oxidoreductase [Ktedonobacter racemifer DSM 44963]
 gi|297550686|gb|EFH84552.1| DSBA oxidoreductase [Ktedonobacter racemifer DSM 44963]
          Length = 202

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 84/190 (44%), Gaps = 18/190 (9%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           + ++ALL   P + +D   G  DAPV +V+Y    C +     + T      + + T ++
Sbjct: 1   MQYKALLVV-PVSEQDHRQGSADAPVMLVQYGDYECPYTRR--STTVVRALQQQLGT-QM 56

Query: 102 RYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINS--KNYRDAL-L 157
           R++ R FPL  +   A+            G +W     +F+ Q    ++  + + +AL L
Sbjct: 57  RFVFRNFPLTEIHPHALHSAEAAEAAAAQGKFWEMHDYIFHHQHTLEDADLRRFAEALDL 116

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE-G 216
           ++ +F    + D     + + I  D++ G +       +  TP F+I G  + G   +  
Sbjct: 117 DVGQF----EYDMAHHQHLRRIEADVEGGIQS-----GVQGTPTFYINGVRHDGSWEQAA 167

Query: 217 VFSKIIDSMI 226
           +F+ I  +++
Sbjct: 168 LFAAIQQALL 177


>gi|288921277|ref|ZP_06415560.1| DSBA oxidoreductase [Frankia sp. EUN1f]
 gi|288347308|gb|EFC81602.1| DSBA oxidoreductase [Frankia sp. EUN1f]
          Length = 223

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 74/190 (38%), Gaps = 24/190 (12%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           LAA P      S G  DA V +VEY    C +CA       + +       G++R + R 
Sbjct: 18  LAADPFRH---SRGFPDAGVVIVEYGDFECPYCARAAGILRELVN---TSDGQVRQVFRH 71

Query: 108 FPLDSVSTVAVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
           FP+  V   A+  A  AE     G +W    L+F  QD   +       L+  A+  G  
Sbjct: 72  FPVFDVHPYALTAALAAEVAGAHGRFWEMHDLMFANQDKLADKY-----LMGFARAVGL- 125

Query: 167 KNDFDTCLNDQ-----NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
             D D  + D      + ++D  AG    +    ++ TP  FI G  Y G +  G     
Sbjct: 126 --DADLVVGDPAQPYGDAVEDDYAG----AAQLRVEGTPTIFIDGVRYRGRLELGPLRSA 179

Query: 222 IDSMIQDSTR 231
           +      S+R
Sbjct: 180 VARAGSGSSR 189


>gi|253574373|ref|ZP_04851714.1| disulfide dehydrogenase D [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251846078|gb|EES74085.1| disulfide dehydrogenase D [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 282

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 79/203 (38%), Gaps = 8/203 (3%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRA-LLAASPSTMKDVSIGQKDAPVT 68
           +L G++++ +A  F      S L +LP      + +    A      K   +G  +A V 
Sbjct: 63  ILIGVLVITLAVVFLKDSDTSELKDLP---NYTEIKGDYTAEGLKYEKQPHLGDPNAKVK 119

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKR 127
           ++E+A   C  C ++       L+  +I TGK+      +  +D  S +A         +
Sbjct: 120 VIEFADFKCPACKKWEETYMDQLQQDFIDTGKIELFFINYAFIDRDSIMAASAGEAIAAQ 179

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK--FAGFSKNDFDTCLNDQNILDDIKA 185
            +  +W F   L+  Q D        D LL+  K    G   + F   L +   +  +K 
Sbjct: 180 SNEKFWEFKRKLYEHQGDETKIWATPDFLLDFVKKNIEGIDYDRFAKDLKEYTYMLPVKE 239

Query: 186 GKKRASEDFAIDSTPVFFIGGNL 208
             K     + ++ TP F + G L
Sbjct: 240 DFKTGGY-YGVNGTPQFMVNGEL 261


>gi|328555055|gb|AEB25547.1| BdbD [Bacillus amyloliquefaciens TA208]
          Length = 223

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 69/169 (40%), Gaps = 14/169 (8%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +A  PS      +G+  APVT+VE+    C  C  F++  F  ++  +I  G +++    
Sbjct: 39  VAEQPSIKGQPVLGKDSAPVTVVEFGDYKCPSCKVFNSDIFPKIKKDFIDKGDVKFSFVN 98

Query: 108 FPLD-SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMAKF 162
                S S +A + +    K     +W F   LF +Q     +W+       ALL     
Sbjct: 99  VMFHGSGSRLAALASEEVWKEDPASFWAFHEKLFEQQPSSEQEWVTP-----ALLEKTVK 153

Query: 163 AGFSKNDFDTC---LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           +   K D D     L+ +    ++KA     ++   I +TP  ++   L
Sbjct: 154 STAKKVDPDKLKENLDKETFSKELKAD-TDLNDKLNITATPTIYVNDKL 201


>gi|89899228|ref|YP_521699.1| DSBA oxidoreductase [Rhodoferax ferrireducens T118]
 gi|89343965|gb|ABD68168.1| DSBA oxidoreductase [Rhodoferax ferrireducens T118]
          Length = 218

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 79/208 (37%), Gaps = 19/208 (9%)

Query: 3   MSTTRIGVLGGIVLL--FIASYFFY-TRKGSALNELPIPDGVVDFRALLAASPSTMKDVS 59
           M    I  L  ++L+  FI   FFY  +K     +L   +     RA            S
Sbjct: 1   MKQKSIFTLAAVLLIAAFIVGAFFYKNQKTEQAAQLAAKNQTALVRA---------DAPS 51

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
            G  DAPV +VE+    C  C EF+    K L   +   GK+R  +R  P    S   V 
Sbjct: 52  FGNADAPVHIVEFFDPACGTCREFY-PLVKNLMAAH--PGKIRLTMRYAPFHPGSDQVVK 108

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           +   A K+  G +   +  LF  Q  W+ N   + D + +     G       + +N   
Sbjct: 109 VMEAARKQ--GQFQQTLEALFASQTVWVQNHTAHVDLIWSPLGTLGLDMERVKSDMNSPE 166

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGG 206
           I   I A     ++   +  TP +F+ G
Sbjct: 167 IARTI-AQDLADAKTMNVTMTPEYFVNG 193


>gi|73667324|ref|YP_303340.1| DSBA oxidoreductase [Ehrlichia canis str. Jake]
 gi|20502761|gb|AAM22614.1|AF403710_1 disulfide oxidoreductase [Ehrlichia canis]
 gi|72394465|gb|AAZ68742.1| DSBA oxidoreductase [Ehrlichia canis str. Jake]
          Length = 246

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 69/151 (45%), Gaps = 16/151 (10%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S G KD+ +  VE+   +C +C        + ++D     GK+  I R+FP+   S++ V
Sbjct: 87  SAGNKDSKIVFVEFFDYSCGYCKMMSEDMKQIVQD-----GKVHVIFRDFPILGESSLKV 141

Query: 119 MLARCAEKRMDGGYW---GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL- 174
             A  A   ++   +    + +L + +Q +        +++L++ K  G ++ DF   L 
Sbjct: 142 AQAALAVHMINPNKYIDFYYAALHYKQQFN-------DESILSIIKSIGITEEDFKVSLA 194

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            + + +D +    +  +++  I  TP   +G
Sbjct: 195 KNADAIDKMIQSTRELAQNINIRGTPAIIVG 225


>gi|326383328|ref|ZP_08205016.1| hypothetical protein SCNU_10339 [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326198078|gb|EGD55264.1| hypothetical protein SCNU_10339 [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 234

 Score = 43.5 bits (101), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 73/177 (41%), Gaps = 13/177 (7%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE---FPLDSVS 114
           ++ G  DAPV +V +    C +CA++   T   L   +  +GKLR  LR+   F  +S  
Sbjct: 64  MAFGPVDAPVGLVVFTDFQCPYCAKWSYDTLPKLL-PFADSGKLRIELRDMNIFGDESER 122

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                 A   + R+      + + LF        S+   DAL+ +A         F T  
Sbjct: 123 AARAAYAAAGQGRLR----DYHAALFADGRPRPKSELSDDALVTLADRLHLDVPRFRTDY 178

Query: 175 NDQNILDDIKAGKKRASEDFAID--STPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             + +L    A + +AS+ F     STP F +GG   LG     VF   + S +  S
Sbjct: 179 ESRTVL---SAVRNKASDGFTAGTYSTPAFILGGQPILGAQPTRVFLDKLQSALDAS 232


>gi|91788225|ref|YP_549177.1| DSBA oxidoreductase [Polaromonas sp. JS666]
 gi|91697450|gb|ABE44279.1| DSBA oxidoreductase [Polaromonas sp. JS666]
          Length = 179

 Score = 43.5 bits (101), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 58/158 (36%), Gaps = 12/158 (7%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFP 109
           +P    D   GQ  A VT++EY    C  C +     +  L+      G +LR++ R FP
Sbjct: 9   APDGATDHIRGQSFAAVTVIEYGDFECALCLQ----AYAGLKVMLPHFGQQLRFVFRHFP 64

Query: 110 LDSVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           L  +     +           G +W    LLF  Q            LL+ A+  G    
Sbjct: 65  LREMHPHAELAAEAAEAAGAQGKFWPMYELLFTHQQHLTEKH-----LLDYAEQVGLDMP 119

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            +   + D   L  ++      +    I STP F++ G
Sbjct: 120 RYRNEMRDHVYLQRVQE-HILGARHLDIRSTPAFYVNG 156


>gi|222480189|ref|YP_002566426.1| DSBA oxidoreductase [Halorubrum lacusprofundi ATCC 49239]
 gi|222453091|gb|ACM57356.1| DSBA oxidoreductase [Halorubrum lacusprofundi ATCC 49239]
          Length = 235

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           I   +A V +  +   TC HCA +  + F  + ++YI  G++RY   +FP+    T AV 
Sbjct: 72  IVDPEADVVVQAFEDFTCGHCATYKLEHFPTIREEYIDPGEVRYEHWDFPIPVNETWAVP 131

Query: 120 LARCAE----KRMDGGYWGFVSLLFNKQDDW 146
           +A  A     ++    ++ F S  +  Q ++
Sbjct: 132 VASAARGVGARQGAEAFFSFASTAYESQGNY 162


>gi|311692983|gb|ADP95856.1| DSBA oxidoreductase [marine bacterium HP15]
          Length = 212

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 80/203 (39%), Gaps = 37/203 (18%)

Query: 15  VLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS--IGQKDAPVTMVEY 72
           +++F A++ +Y R              +D  A++  +P  ++D S  IG +DAPVT+VE+
Sbjct: 15  LVVFAAAFVYYDRSQG-----------IDEPAVVEKTP-LVRDYSPVIGPEDAPVTIVEF 62

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGY 132
              +C  C   H    K ++  Y     +R +LR       S  AV +   A  R  G Y
Sbjct: 63  FDPSCEGCRAMH-PYVKQIQAAY--PDNVRLVLRYVLFHKGSEEAVRILETA--REQGIY 117

Query: 133 WGFVSLLFNKQDDWINSKNYRDALLNM--------AKFAGFSKNDFDTCLNDQNILDDIK 184
              +  +   Q  W +      A            A  AG +  + D  +  Q    D+K
Sbjct: 118 EPVLDAVMEAQPQWHDDPKVAAAWDAAESAGLDLEAARAGMNSQEIDRII--QQDAADVK 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGN 207
           A          I  TP F++ G+
Sbjct: 176 A--------VGISGTPTFYVNGD 190


>gi|239939989|ref|ZP_04691926.1| hypothetical protein SrosN15_03236 [Streptomyces roseosporus NRRL
           15998]
 gi|239986473|ref|ZP_04707137.1| hypothetical protein SrosN1_04113 [Streptomyces roseosporus NRRL
           11379]
          Length = 172

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 63/162 (38%), Gaps = 6/162 (3%)

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APV +  +  + C  C    +   + L  +Y    ++R  LR FPL+             
Sbjct: 8   APVVLDLWCDLECPDCHRALDD-VRALRARYGDRVEIR--LRHFPLEKHKHAFAAAQAAE 64

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
           E    G  W ++  L ++ DD    +     LL++A+  G    +FDT L D   L  + 
Sbjct: 65  EAVAQGRGWPYIEALLSRTDDL--GRTGEPVLLDVARELGLDTEEFDTALIDGRHLLIVD 122

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A          +  TP + IG     G  S+    + I+ ++
Sbjct: 123 ADHAEGKA-IGVTGTPTYVIGDERLDGGKSQEGLRERIEEIV 163


>gi|171185984|ref|YP_001794903.1| hypothetical protein Tneu_1533 [Thermoproteus neutrophilus V24Sta]
 gi|170935196|gb|ACB40457.1| conserved hypothetical protein [Thermoproteus neutrophilus V24Sta]
          Length = 204

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           A P     +S+G  +APV +VE   + C +CAE H +    L  + +  G+LR +  +F 
Sbjct: 38  AIPIPSWAISVGSPEAPVVLVELFDLHCPYCAEAH-EVLDPLYRRLLAEGRLRIVFVDFI 96

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
           +   + +A     CA +++    +  ++ L+    D
Sbjct: 97  VHPDAVLAHRYLHCAYQQLGNKTYDLITDLYKAYID 132


>gi|291443419|ref|ZP_06582809.1| LOW QUALITY PROTEIN: DSBA oxidoreductase [Streptomyces roseosporus
           NRRL 15998]
 gi|291346366|gb|EFE73270.1| LOW QUALITY PROTEIN: DSBA oxidoreductase [Streptomyces roseosporus
           NRRL 15998]
          Length = 176

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 63/162 (38%), Gaps = 6/162 (3%)

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APV +  +  + C  C    +   + L  +Y    ++R  LR FPL+             
Sbjct: 12  APVVLDLWCDLECPDCHRALDD-VRALRARYGDRVEIR--LRHFPLEKHKHAFAAAQAAE 68

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
           E    G  W ++  L ++ DD    +     LL++A+  G    +FDT L D   L  + 
Sbjct: 69  EAVAQGRGWPYIEALLSRTDDL--GRTGEPVLLDVARELGLDTEEFDTALIDGRHLLIVD 126

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A          +  TP + IG     G  S+    + I+ ++
Sbjct: 127 ADHAEGKA-IGVTGTPTYVIGDERLDGGKSQEGLRERIEEIV 167


>gi|315641114|ref|ZP_07896193.1| thioredoxin superfamily protein [Enterococcus italicus DSM 15952]
 gi|315483122|gb|EFU73639.1| thioredoxin superfamily protein [Enterococcus italicus DSM 15952]
          Length = 175

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 76/171 (44%), Gaps = 25/171 (14%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI--LREFPLDSVSTVAV 118
           GQK+APV + E+ ++ C +C ++ N + + L DK +  GK+  +  L + P +S+    V
Sbjct: 20  GQKEAPVVLKEFINLRCPYCRQWFNHSKEVL-DKAVAEGKVVRLFKLTDRPKESLQRGNV 78

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND-- 176
           M         +  Y   +  +F  QD W +        L++ + A +++N      ++  
Sbjct: 79  MHRYVTTDDSEQAY-ADIQAIFESQDQWGD--------LSLEEVAQYAENTLGLTEHNHL 129

Query: 177 ---QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
              Q I+D+ +A          I   P   +  +++   +S    +K+I+ 
Sbjct: 130 DYAQEIVDETQAA--------VIKFVPTVILNEHIFDETISTEELTKLIEE 172


>gi|17228397|ref|NP_484945.1| hypothetical protein all0902 [Nostoc sp. PCC 7120]
 gi|17130248|dbj|BAB72859.1| all0902 [Nostoc sp. PCC 7120]
          Length = 248

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 76/177 (42%), Gaps = 26/177 (14%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +A++  SP+T    S  Q  A V  VE++   C +CA+ H+ T K L  K+   G++  +
Sbjct: 83  QAVIGDSPTT----SATQSKAVV--VEFSDFQCPYCAKAHD-TLKQLLAKH--PGEITLV 133

Query: 105 LREFPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKF 162
            +  PL  + +               G +W +   LF+      N K   +AL L++AK 
Sbjct: 134 YKHLPLIPIHNEAMPAAKAAWAATQQGKFWEYHDALFS------NQKQLGEALYLDIAKK 187

Query: 163 AGFSKNDF--DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG--DMSE 215
                  F  D  L D  I  DI+  +K      AI  TP F +    + G  D+SE
Sbjct: 188 LNLDLEKFNSDRLLADAAISKDIQIAQK-----LAIAGTPFFIMNSKTFSGGIDLSE 239


>gi|94984854|ref|YP_604218.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
 gi|94555135|gb|ABF45049.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
          Length = 335

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 58/149 (38%), Gaps = 10/149 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTF-KYLEDKYIKTGKLRYILREFPLD--SVSTVA 117
           G   AP  +  ++   C +C E  +    K+     +     R +   FPL     +  A
Sbjct: 158 GSAQAPNVLRIFSDFQCPYCKELWDTAHPKWAAQPNV----YRVMHYHFPLSFHKNAEPA 213

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            + + CA ++  G +W +  LLF    +W    +        A+ AG +   F TCL   
Sbjct: 214 AIASECAAEQ--GKFWPYADLLFRHTAEWTGLPSASAKFSEYAQAAGLNVAAFQTCLTSA 271

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                ++A ++ A     +  TP  ++ G
Sbjct: 272 APKAVVRA-QQAAGLKLGVQGTPTVYLNG 299


>gi|86156933|ref|YP_463718.1| vitamin K epoxide reductase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773444|gb|ABC80281.1| Vitamin K epoxide reductase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 411

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 67/165 (40%), Gaps = 36/165 (21%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV---------A 117
           + + EY+   C  CA+ H      L  +      ++ + R FPLD              A
Sbjct: 253 IVLYEYSDYECPFCAKSHEANKPILASRP----DVKVVRRHFPLDDTCNPKLTRPFHVGA 308

Query: 118 VMLAR---CAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKNDFDTC 173
             LAR   CAE +            F + DD +  ++  +  +  +A+  G     FD C
Sbjct: 309 CDLARAAICAEAQGR----------FEQMDDALFRNQAEKAPVRELARRVGLDLPRFDAC 358

Query: 174 LN----DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           L+    ++ + DDI++  +       +  TP +  GG +Y GD++
Sbjct: 359 LSSPDTERRLADDIESAIQ-----AGVRGTPSYVYGGKVYPGDLA 398


>gi|226360820|ref|YP_002778598.1| Na(+)/H(+) antiporter [Rhodococcus opacus B4]
 gi|226239305|dbj|BAH49653.1| putative Na(+)/H(+) antiporter [Rhodococcus opacus B4]
          Length = 622

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 57/155 (36%), Gaps = 14/155 (9%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVS 114
           +D   G  DAP+T+VEY    C  C    +K    + D     G +LRY+ R  PLD V 
Sbjct: 449 RDHVRGPADAPLTLVEYGDFECPFC----SKATGSIRDVRAHFGDELRYVFRHLPLDEVH 504

Query: 115 TVA-VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
             A             G +W     LF   D         D +   A   G   + F+  
Sbjct: 505 PHARFAAQASEAAAAQGRFWEMHDHLFANSD-----ALAEDEIFGYAAELGLDTDRFEED 559

Query: 174 LNDQNILDDIKAGKKRA-SEDFAIDSTPVFFIGGN 207
           +     L  +   +  A S DF    TP F++G  
Sbjct: 560 IRKGEYLHRVDDDELDAESSDF--HGTPTFYLGAT 592


>gi|238063155|ref|ZP_04607864.1| DSBA oxidoreductase [Micromonospora sp. ATCC 39149]
 gi|237884966|gb|EEP73794.1| DSBA oxidoreductase [Micromonospora sp. ATCC 39149]
          Length = 238

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 69/168 (41%), Gaps = 26/168 (15%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI------LR 106
           +T     I     PVT+  Y    C  C +F   +   + D+ +  GK R +      L 
Sbjct: 63  ATEAGTGIAYGTGPVTIDLYEDFLCPVCKQFQQTSGTTI-DQLVSEGKARVVFHPVAYLN 121

Query: 107 EFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
            +     ST A   + CA K   G +  F   LF++Q    ++    D L+++    G +
Sbjct: 122 RYSTTEYSTRASAASGCAAK--GGKFQEFAKALFDRQPPEGSAGLSDDELVDIGAGVGLN 179

Query: 167 KNDFDTCLND-------QNILDDI-KAGKKRASEDFAIDSTPVFFIGG 206
           ++DF +C+++       +++ DD  +AG         +  TP   I G
Sbjct: 180 RDDFASCVSNGTYTSWTEHVTDDASRAG---------VTGTPTVKING 218


>gi|170076808|ref|YP_001733446.1| DSBA-like thioredoxin domain-containing protein [Synechococcus sp.
           PCC 7002]
 gi|169884477|gb|ACA98190.1| DsbA-like thioredoxin domain protein [Synechococcus sp. PCC 7002]
          Length = 265

 Score = 43.1 bits (100), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 11/133 (8%)

Query: 43  DFRALLAASPSTM--KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
           DF+  +   P T+     ++G +D  V ++E++   C  CA  H+    ++      +  
Sbjct: 82  DFQQQVLTEPQTVIGDSPTLGAEDLNVVLIEFSDFECPFCARAHSTLQTFMAQ---NSDT 138

Query: 101 LRYILREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +  + + FPL  +   A+  A  +   +  G +W +   LF  QD  +  + Y++   N+
Sbjct: 139 VTLVYKHFPLAQIHPQAIPAAEASWAAQQQGKFWEYHDQLFENQDR-LGEELYQEIATNL 197

Query: 160 A----KFAGFSKN 168
                KF G  +N
Sbjct: 198 GLDLEKFEGDRQN 210


>gi|134095225|ref|YP_001100300.1| putative sodium/proton antiporter [Herminiimonas arsenicoxydans]
 gi|189029165|sp|A4G6P0|NHAA_HERAR RecName: Full=Na(+)/H(+) antiporter nhaA; AltName:
           Full=Sodium/proton antiporter nhaA
 gi|133739128|emb|CAL62177.1| putative Na+/H+ antiporter fused with thioredoxin domain
           [Herminiimonas arsenicoxydans]
          Length = 621

 Score = 43.1 bits (100), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 69/164 (42%), Gaps = 11/164 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +DA +T+VEY    C +CA   + T  + + +      LRY++R  P      +A   
Sbjct: 457 GPEDAQLTLVEYVDFECAYCA---HATGSWDDLRAHFGDDLRYVVRHLPHHPHGPIAARA 513

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           +  A  +  G +W ++  +F +Q         R+ L+  A   G     F   L+   ++
Sbjct: 514 SEAAANQ--GMFWPWLDFVFTRQH-----ALEREHLIGYAAELGLDVERFIADLDSPAVI 566

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           + ++     A    A  +TP FF+ G    G       + ++++
Sbjct: 567 ERVERDLASAVASGA-HATPTFFVEGRRLRGSYDARTVTAVLEA 609


>gi|284043941|ref|YP_003394281.1| DSBA oxidoreductase [Conexibacter woesei DSM 14684]
 gi|283948162|gb|ADB50906.1| DSBA oxidoreductase [Conexibacter woesei DSM 14684]
          Length = 235

 Score = 43.1 bits (100), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 58/154 (37%), Gaps = 21/154 (13%)

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK-TGKLRYILREFPLDSVSTVAVMLA 121
           +D  VT+VE+    C  C       + YLE    +  G++ + +R FP+ S +   +   
Sbjct: 73  RDGRVTLVEFLDFECESC----RALYPYLEQLRAEYDGRVTFAIRYFPIASHTNAQLAAQ 128

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN---DFDTCLNDQN 178
                 + G        +F  Q +W  S+  R      A F GF+     D D    D  
Sbjct: 129 AVEAASLQGRLEPMYRTMFETQAEWGESQESR-----RATFLGFASRLGLDMDRFRRD-- 181

Query: 179 ILDDIKAGKKRASED-----FAIDSTPVFFIGGN 207
            LDD +   + A +        +  TP  F+ G 
Sbjct: 182 -LDDPRTAARIARDQEEGLALGVQGTPTLFLNGE 214


>gi|107102093|ref|ZP_01366011.1| hypothetical protein PaerPA_01003142 [Pseudomonas aeruginosa PACS2]
          Length = 592

 Score = 43.1 bits (100), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 69/164 (42%), Gaps = 11/164 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +DA +T+VEY    C +CA   + T  + + +      LRY++R  P      +A   
Sbjct: 428 GPEDAQLTLVEYVDFECAYCA---HATGSWDDLRAHFGDDLRYVVRHLPHHPHGPIAARA 484

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           +  A  +  G +W ++  +F +Q         R+ L+  A   G     F   L+   ++
Sbjct: 485 SEAAANQ--GMFWPWLDFVFTRQH-----ALEREHLIGYAAELGLDVERFIADLDSPAVI 537

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           + ++     A    A  +TP FF+ G    G       + ++++
Sbjct: 538 ERVERDLASAVASGA-HATPTFFVEGRRLRGSYDARTVTAVLEA 580


>gi|109820104|gb|ABG46425.1| DSBA-like thioreodoxin [Synechococcus sp. PCC 7002]
          Length = 271

 Score = 43.1 bits (100), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 11/133 (8%)

Query: 43  DFRALLAASPSTM--KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
           DF+  +   P T+     ++G +D  V ++E++   C  CA  H+    ++      +  
Sbjct: 88  DFQQQVLTEPQTVIGDSPTLGAEDLNVVLIEFSDFECPFCARAHSTLQTFMAQ---NSDT 144

Query: 101 LRYILREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +  + + FPL  +   A+  A  +   +  G +W +   LF  QD  +  + Y++   N+
Sbjct: 145 VTLVYKHFPLAQIHPQAIPAAEASWAAQQQGKFWEYHDQLFENQDR-LGEELYQEIATNL 203

Query: 160 A----KFAGFSKN 168
                KF G  +N
Sbjct: 204 GLDLEKFEGDRQN 216


>gi|302560025|ref|ZP_07312367.1| Na+/H+ antiporter NhaA [Streptomyces griseoflavus Tu4000]
 gi|302477643|gb|EFL40736.1| Na+/H+ antiporter NhaA [Streptomyces griseoflavus Tu4000]
          Length = 550

 Score = 43.1 bits (100), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 37/90 (41%), Gaps = 4/90 (4%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
            D  +G  DAP+T+VEY    C  CA     T K L  ++    + RY+ R  PL  V  
Sbjct: 463 HDHILGPVDAPLTLVEYGDFECHFCARATGVT-KELRQRF--GDRFRYVFRHLPLPDVHP 519

Query: 116 -VAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
              +           G +W    LL+  QD
Sbjct: 520 HAELAARAAVAAAAQGRFWEMHDLLYEHQD 549


>gi|154253719|ref|YP_001414543.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
 gi|154157669|gb|ABS64886.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
          Length = 263

 Score = 43.1 bits (100), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 11/168 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D   G     VT+VE+    C +C     ++FK L D     G +R IL+EFP+   +++
Sbjct: 103 DFVAGNPKGDVTIVEFFDYRCGYC----KQSFKPLMDFVKADGNIRLILKEFPILGPASL 158

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
               A  A K+ +  Y      L+  +    +     +A+  +A   G         + D
Sbjct: 159 EASKAAIAAKKQNR-YLEMHRALYEHKGQLDS-----EAIFGIATSLGLDTAKLRKDMED 212

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             I   +      A E   +D TP F +GG LY G   +   ++I+ +
Sbjct: 213 PEIAKMVSRHYDLA-EALGVDGTPAFIVGGELYPGAADKERLTEIVKT 259


>gi|118590070|ref|ZP_01547474.1| outer membrane protein [Stappia aggregata IAM 12614]
 gi|118437567|gb|EAV44204.1| outer membrane protein [Stappia aggregata IAM 12614]
          Length = 267

 Score = 43.1 bits (100), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 9/173 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ++ + V +G  +  VT+VE+    C +C   H    K +E+       L+ +L+EFP+  
Sbjct: 96  NSSRQVVLGNPEGSVTLVEFFDYNCGYCKRAHGDMVKLIEE----NPDLKVVLKEFPVLG 151

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             +V       A   +    +G     F+++      +  R + L  AK  G S++D   
Sbjct: 152 QGSVEAAQVAVAVNSIAPEKYGE----FHEKLLLSRGQANRASALEAAKSVGISEDDLQE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            +        I+     A+    +  TP + IG ++ +G +     S+ +D++
Sbjct: 208 AMKTDEAGQTIEEVYSLANR-LGLTGTPSYVIGNDVVMGAVGYQELSQKLDAL 259


>gi|197120955|ref|YP_002132906.1| Vitamin K epoxide reductase [Anaeromyxobacter sp. K]
 gi|196170804|gb|ACG71777.1| Vitamin K epoxide reductase [Anaeromyxobacter sp. K]
          Length = 390

 Score = 43.1 bits (100), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 66/165 (40%), Gaps = 36/165 (21%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV---------A 117
           + + EY+   C  CA  H      L  +      ++ + R FPLD              A
Sbjct: 232 IVLYEYSDYECPFCARSHEANKPILASRP----DVKVVRRHFPLDDTCNPKLTRPFHVGA 287

Query: 118 VMLAR---CAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKNDFDTC 173
             LAR   CAE +            F + DD +  ++  +  +  +A+  G     FD C
Sbjct: 288 CDLARAAICAEAQGR----------FEQMDDALFRNQAEKAPVRELARRIGLDLPRFDAC 337

Query: 174 LN----DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           L+    ++ + DDI++  +       +  TP +  GG +Y GD++
Sbjct: 338 LSSPGTEKRLADDIESAIQ-----AGVRGTPSYVYGGKVYPGDLA 377


>gi|154687467|ref|YP_001422628.1| BdbD [Bacillus amyloliquefaciens FZB42]
 gi|154353318|gb|ABS75397.1| BdbD [Bacillus amyloliquefaciens FZB42]
          Length = 223

 Score = 43.1 bits (100), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY-ILR 106
           +A  PS      +G+  APVT+VE+    C  C  F++  F  ++  +I  G +++  + 
Sbjct: 39  VAEQPSIKGQPVLGKDSAPVTVVEFGDYKCPSCKVFNSDIFPKIKKDFIDKGDVKFSFVN 98

Query: 107 EFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ----DDWI 147
                S S +A + +    K     +W F   LF +Q     +W+
Sbjct: 99  VMYHGSGSRLAALASEEVWKEDPASFWAFHEKLFEQQPSSEQEWV 143


>gi|213966037|ref|ZP_03394226.1| dsba oxidoreductase [Corynebacterium amycolatum SK46]
 gi|213951332|gb|EEB62725.1| dsba oxidoreductase [Corynebacterium amycolatum SK46]
          Length = 331

 Score = 43.1 bits (100), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 80/208 (38%), Gaps = 22/208 (10%)

Query: 36  PIPDGVVDFRALLAA--------SPSTMKDV---------SIGQKDAPVTMVEYASMTCF 78
           P+P    DF A +          SP  M +V         ++G  DAPV +  Y+   C 
Sbjct: 112 PVPGPNGDFDASIYGPKAGAQLKSPEDMDNVHRRNENDPFALGAVDAPVVISIYSDFECP 171

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
            CA+F N+T   L +KY+  G +R    +  ++         A  A     G +W F   
Sbjct: 172 FCAKFANETEPDLVEKYVNEGLVRLEWNDMAINGEKATKDAEAGRAAAAQ-GKFWEFSRA 230

Query: 139 LFNK--QDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQNILDDIKAGKKRASEDFA 195
           LF K  +    + +     L+ +A+ AG      F+  L D    + ++   +  S    
Sbjct: 231 LFKKAGEKGQGHPEFTEKELIAVAREAGVPDMKRFEKELKDGKWTEAVENATQFGSM-LG 289

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           I  TP F +G     G     VF   I+
Sbjct: 290 ISGTPGFLVGTQFVSGAQPLDVFEDNIE 317


>gi|54027197|ref|YP_121439.1| hypothetical protein nfa52230 [Nocardia farcinica IFM 10152]
 gi|54018705|dbj|BAD60075.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 248

 Score = 43.1 bits (100), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 83/212 (39%), Gaps = 14/212 (6%)

Query: 7   RIGVLGGIVLLFIA-----SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +I +  G+  + I            +K    +  P P       A +  S +    V IG
Sbjct: 22  KIAIQAGVAAVLIGLVAAIGIGIAVKKAERDDPGPTPAIAAQNGAAVTGSITDSGAVRIG 81

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK-TGKLRYILREFPLDSVST----- 115
           + DA VT+   A + C  C  F     + LED     T  + Y +  F LD  ST     
Sbjct: 82  KPDATVTVRVVADLQCPACKNFEATYGQLLEDAVNNGTAAVEYNVISF-LDRASTNEYSS 140

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
            A   A C  ++    +  ++  +F +Q     + +  D L+ +A+  G++ +    C+ 
Sbjct: 141 RAANAAYCVAEQDPAKFQTWLKTMFAQQPAEGGAGHTDDQLIEIAREVGYT-DAVAGCIQ 199

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           D+     + + K +A     + STP  F+ G 
Sbjct: 200 DRTYAKYVTS-KTQAVFGEGVQSTPTVFVDGQ 230


>gi|163842653|ref|YP_001627057.1| DSBA oxidoreductase [Brucella suis ATCC 23445]
 gi|163673376|gb|ABY37487.1| DSBA oxidoreductase [Brucella suis ATCC 23445]
          Length = 204

 Score = 42.7 bits (99), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 60/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADP 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +D I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIDGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 191


>gi|212703777|ref|ZP_03311905.1| hypothetical protein DESPIG_01825 [Desulfovibrio piger ATCC 29098]
 gi|212672745|gb|EEB33228.1| hypothetical protein DESPIG_01825 [Desulfovibrio piger ATCC 29098]
          Length = 271

 Score = 42.7 bits (99), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 75/176 (42%), Gaps = 22/176 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   APV +V ++  TC +C +  +     +  KY K   L Y  +  PLD      ++ 
Sbjct: 106 GNAAAPVRIVAFSDFTCHYCQQATH-VLDEIMKKYGKNVSLVY--KHMPLDEQGP-GMLA 161

Query: 121 AR---CAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDAL-----LNMAKFAGFSKNDFD 171
           AR       + +   W F   ++  +D  +   + + D +     L+ A+    + +D  
Sbjct: 162 ARYFVAVAAQSESKAWKFYDAMYADRDRLLLEGQKFVDEVCDKLGLDKARLQKDASSDKT 221

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             +  Q+ LDD K  K        ID TP F + G +  G +SE +F   +D+ ++
Sbjct: 222 ARIIAQD-LDDAKKLK--------IDGTPCFLVNGLMVRGALSEPLFEAAVDTALE 268


>gi|23501271|ref|NP_697398.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella suis 1330]
 gi|62289358|ref|YP_221151.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699283|ref|YP_413857.1| DSBA oxidoreductase [Brucella melitensis biovar Abortus 2308]
 gi|148560038|ref|YP_001258399.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ovis ATCC 25840]
 gi|161618346|ref|YP_001592233.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
 gi|189023611|ref|YP_001934379.1| DSBA oxidoreductase [Brucella abortus S19]
 gi|225626884|ref|ZP_03784923.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ceti str. Cudo]
 gi|237814845|ref|ZP_04593843.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus str. 2308 A]
 gi|254688673|ref|ZP_05151927.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|254696800|ref|ZP_05158628.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701181|ref|ZP_05163009.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|254703727|ref|ZP_05165555.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|254707894|ref|ZP_05169722.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|254709522|ref|ZP_05171333.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|254713061|ref|ZP_05174872.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|254716586|ref|ZP_05178397.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|254729707|ref|ZP_05188285.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|256031016|ref|ZP_05444630.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|256060508|ref|ZP_05450677.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|256256920|ref|ZP_05462456.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|256368823|ref|YP_003106329.1| twin-arginine translocation signal domain protein [Brucella microti
           CCM 4915]
 gi|260168148|ref|ZP_05754959.1| DSBA oxidoreductase [Brucella sp. F5/99]
 gi|260545889|ref|ZP_05821630.1| DSBA oxidoreductase [Brucella abortus NCTC 8038]
 gi|260567021|ref|ZP_05837491.1| DSBA oxidoreductase [Brucella suis bv. 4 str. 40]
 gi|260754150|ref|ZP_05866498.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260757370|ref|ZP_05869718.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260761194|ref|ZP_05873537.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883175|ref|ZP_05894789.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|261218385|ref|ZP_05932666.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261315385|ref|ZP_05954582.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|261317048|ref|ZP_05956245.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261320766|ref|ZP_05959963.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|261324502|ref|ZP_05963699.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|261751718|ref|ZP_05995427.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|261754371|ref|ZP_05998080.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|261757606|ref|ZP_06001315.1| DSBA oxidoreductase [Brucella sp. F5/99]
 gi|265988086|ref|ZP_06100643.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|294851751|ref|ZP_06792424.1| DSBA oxidoreductase [Brucella sp. NVSL 07-0026]
 gi|297247772|ref|ZP_06931490.1| DSBA oxidoreductase [Brucella abortus bv. 5 str. B3196]
 gi|23347157|gb|AAN29313.1| twin-arginine translocation signal domain protein [Brucella suis
           1330]
 gi|62195490|gb|AAX73790.1| twin-arginine translocation signal domain protein [Brucella abortus
           bv. 1 str. 9-941]
 gi|82615384|emb|CAJ10351.1| DSBA oxidoreductase:Twin-arginine translocation pathway signal
           [Brucella melitensis biovar Abortus 2308]
 gi|148371295|gb|ABQ61274.1| twin-arginine translocation signal domain protein [Brucella ovis
           ATCC 25840]
 gi|161335157|gb|ABX61462.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
 gi|189019183|gb|ACD71905.1| DSBA oxidoreductase [Brucella abortus S19]
 gi|225618541|gb|EEH15584.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ceti str. Cudo]
 gi|237789682|gb|EEP63892.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus str. 2308 A]
 gi|255998981|gb|ACU47380.1| twin-arginine translocation signal domain protein [Brucella microti
           CCM 4915]
 gi|260097296|gb|EEW81171.1| DSBA oxidoreductase [Brucella abortus NCTC 8038]
 gi|260156539|gb|EEW91619.1| DSBA oxidoreductase [Brucella suis bv. 4 str. 40]
 gi|260667688|gb|EEX54628.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260671626|gb|EEX58447.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674258|gb|EEX61079.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260872703|gb|EEX79772.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|260923474|gb|EEX90042.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261293456|gb|EEX96952.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|261296271|gb|EEX99767.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261300482|gb|EEY03979.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|261304411|gb|EEY07908.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|261737590|gb|EEY25586.1| DSBA oxidoreductase [Brucella sp. F5/99]
 gi|261741471|gb|EEY29397.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|261744124|gb|EEY32050.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|264660283|gb|EEZ30544.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|294820340|gb|EFG37339.1| DSBA oxidoreductase [Brucella sp. NVSL 07-0026]
 gi|297174941|gb|EFH34288.1| DSBA oxidoreductase [Brucella abortus bv. 5 str. B3196]
          Length = 204

 Score = 42.7 bits (99), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 60/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +D I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIDGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 191


>gi|308175087|ref|YP_003921792.1| thiol-disulfide oxidoreductase [Bacillus amyloliquefaciens DSM 7]
 gi|307607951|emb|CBI44322.1| thiol-disulfide oxidoreductase [Bacillus amyloliquefaciens DSM 7]
          Length = 223

 Score = 42.7 bits (99), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 49/119 (41%), Gaps = 5/119 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           +A  PS      +G+  APVT+VE+    C  C  F++  F  ++  +I  G +++    
Sbjct: 39  VAEQPSIKGQPVLGKDSAPVTVVEFGDYKCPSCKVFNSDIFPKIKKDFIDKGDVKFSFVN 98

Query: 108 FPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQ----DDWINSKNYRDALLNMAK 161
                  S +A + +    K     +W F   LF +Q     +W+        + + AK
Sbjct: 99  VMFHGTGSRLAALASEEVWKEDPASFWAFHEKLFEEQPSSEQEWVTPALLEKTVKSTAK 157


>gi|220918868|ref|YP_002494172.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956722|gb|ACL67106.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 311

 Score = 42.7 bits (99), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 72/167 (43%), Gaps = 12/167 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
            +G   APVT++E++  TC  C        +++E+     G+++ + + FP+++    A+
Sbjct: 141 PLGDPAAPVTLLEFSDFTCPFCRGLRPALERFVEE---HPGRVKLVFKPFPIEA-HPGAL 196

Query: 119 MLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             A+  E   D G +W     LF        +    DA+   A+ AG    D    L  +
Sbjct: 197 EAAQAGEWARDQGIFWPLHDALFE-----AAAPLDVDAIAAAAREAGGDAGDLRDALASR 251

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGN-LYLGDMSEGVFSKIID 223
             LD I+A +  A     +  TP  F+ G  L L D S  +    ++
Sbjct: 252 KYLDKIRASQAEARA-AGLRGTPTLFLNGRYLALPDFSPAMLLHALE 297


>gi|197124089|ref|YP_002136040.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
 gi|196173938|gb|ACG74911.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
          Length = 311

 Score = 42.7 bits (99), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 72/167 (43%), Gaps = 12/167 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
            +G   APVT++E++  TC  C        +++E+     G+++ + + FP+++    A+
Sbjct: 141 PLGDPAAPVTLLEFSDFTCPFCRGLRPALERFVEE---HPGRVKLVFKPFPIEA-HPGAL 196

Query: 119 MLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             A+  E   D G +W     LF        +    DA+   A+ AG    D    L  +
Sbjct: 197 EAAQAGEWARDQGIFWPLHDALFE-----AAAPLDVDAIAAAAREAGGDAGDLRDALASR 251

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGN-LYLGDMSEGVFSKIID 223
             LD I+A +  A     +  TP  F+ G  L L D S  +    ++
Sbjct: 252 KYLDKIRASQAEARA-AGLRGTPTLFLNGRYLALPDFSPAMLLHALE 297


>gi|254693156|ref|ZP_05154984.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|261213396|ref|ZP_05927677.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|260915003|gb|EEX81864.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
          Length = 204

 Score = 42.7 bits (99), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 60/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +D I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIDGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 191


>gi|311743346|ref|ZP_07717153.1| NhaA family sodium:proton (Na+:H+) antiporter [Aeromicrobium
           marinum DSM 15272]
 gi|311313414|gb|EFQ83324.1| NhaA family sodium:proton (Na+:H+) antiporter [Aeromicrobium
           marinum DSM 15272]
          Length = 610

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 68/159 (42%), Gaps = 10/159 (6%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D   G+ DAP+ MVEY    C  C+     +   + D +     L ++ R  PL  V  
Sbjct: 443 RDHHRGRPDAPLVMVEYLDFECPFCSRM-TGSVDQVSDHF--GDDLVWVWRHLPLHRVHP 499

Query: 116 VAVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
            + + A+ AE     G +  +  LLF +QDD       R  LL  A   G   + F+  L
Sbjct: 500 HSQLAAQAAEAAALQGRHLEYGPLLFARQDDLT-----RTDLLAYAAELGLDLDRFEADL 554

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
           +   ++  ++      ++   +  TP FFIG   + G +
Sbjct: 555 DSAAVVRRVQD-DVDDADLMDLAGTPTFFIGTERHSGPI 592


>gi|308176268|ref|YP_003915674.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter
           arilaitensis Re117]
 gi|307743731|emb|CBT74703.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter
           arilaitensis Re117]
          Length = 249

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 9/172 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE---FPLDSVS 114
           ++ G  DAPV +V ++   C  CA++ ++T   + D Y K GK+R   R+   F  DS  
Sbjct: 78  LAAGPVDAPVGVVVFSDYQCKFCAKWSSETLPLILD-YAKEGKVRVEWRDVNIFGDDSER 136

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                 A   +    G +W +   LF        S     +L  +A   G     F T +
Sbjct: 137 AALASYAAAKQ----GKFWEYHDELFADGKSRKGSGLSEKSLAKLAADLGLDTKQFTTDV 192

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             +     I +  +   +   + STP F + G   +G   + VF   I++ +
Sbjct: 193 KSEEAAKMIDSNAQLGLQ-LGVYSTPAFLVDGEPVMGAQPKSVFIDKIEAAL 243


>gi|149374352|ref|ZP_01892126.1| DSBA oxidoreductase [Marinobacter algicola DG893]
 gi|149361055|gb|EDM49505.1| DSBA oxidoreductase [Marinobacter algicola DG893]
          Length = 212

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 79/197 (40%), Gaps = 26/197 (13%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS--IGQKDAPVTMVEYA 73
           L+  A+ F Y  +    NE           A++  +P  ++D S  IG +DAPVT+VE+ 
Sbjct: 15  LVIFAAAFIYYDRSQGTNE----------PAVVEKTP-LVRDYSPVIGPEDAPVTIVEFF 63

Query: 74  SMTCFHCAEFHNKTFKYLEDKYIKTG---KLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
             +C  C       + Y+  K I+     ++R +LR       S  AV +   A ++  G
Sbjct: 64  DPSCEGC----RAMYPYV--KQIRAAYPDRVRLVLRYVLFHKGSEEAVRMVETAGEQ--G 115

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
            Y   +  +   Q  W +  +   A  + A+ AG         +N   I D I       
Sbjct: 116 IYEPVLDAVMEAQPQWHDDPDVT-AAWDAAESAGLDVEAARASMNSPEI-DGIVQQDAAD 173

Query: 191 SEDFAIDSTPVFFIGGN 207
            +   I  TP F++ G 
Sbjct: 174 VKAVGISGTPTFYVNGE 190


>gi|256159070|ref|ZP_05456899.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|256254419|ref|ZP_05459955.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|261221586|ref|ZP_05935867.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|265997550|ref|ZP_06110107.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|260920170|gb|EEX86823.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|262552018|gb|EEZ08008.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
          Length = 204

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 60/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +D I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIDGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 191


>gi|158422975|ref|YP_001524267.1| hypothetical protein AZC_1351 [Azorhizobium caulinodans ORS 571]
 gi|158329864|dbj|BAF87349.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 176

 Score = 42.7 bits (99), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 71/166 (42%), Gaps = 20/166 (12%)

Query: 52  PSTMKDVSI-GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK-LRYILREFP 109
           PS   D  I G     VT+VEY    C +C E     +  L+      G  LR++ R FP
Sbjct: 6   PSLAADDHILGTPSFSVTLVEYGDYQCPYCGE----AYPVLKAVQRAMGADLRFVFRNFP 61

Query: 110 LDSVSTVAVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINS--KNYRDAL-LNMAKFAGF 165
           L  V   A+  A+ AE   + G +W    +L+  QD   +   + Y D L ++ A  A  
Sbjct: 62  LVEVHAHALRAAQFAEAAAEAGLFWEAHDMLYENQDALGDRHLEAYADQLGIDRAILAAA 121

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            +   D  +  ++ L  ++ G         ++ TP  FI G LY G
Sbjct: 122 FEGRHDEKIQ-RDFLGGVRGG---------VNGTPSLFINGQLYEG 157


>gi|301058679|ref|ZP_07199680.1| DsbA-like protein [delta proteobacterium NaphS2]
 gi|300447243|gb|EFK11007.1| DsbA-like protein [delta proteobacterium NaphS2]
          Length = 282

 Score = 42.7 bits (99), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 73/181 (40%), Gaps = 18/181 (9%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           +T    S+G ++APV +  ++   C +CA    +  + L+ +Y K+  +R + + FPL S
Sbjct: 115 NTADTPSMGPQNAPVVLAVFSDFQCPYCARLAPRLEQVLK-QYPKS--VRVVYKNFPLSS 171

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD----ALLNMAKFAGFSKN 168
                   A        G +W +   L          K YR+      + +A+  G  + 
Sbjct: 172 HKFAKQAAAAALAAERQGKFWEYHDEL---------HKYYRNLSDKKFIEIAQQLGLDEA 222

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            F+   +D  IL+ I    +   E   I   P  F+ G   + +   G    IID  ++ 
Sbjct: 223 KFNKDRHDPAILEKINLDHEEG-EALEIRGIPALFMNGR-RIQNRDLGNLQDIIDKQLKK 280

Query: 229 S 229
           +
Sbjct: 281 A 281


>gi|83814846|ref|YP_445780.1| vitamin K epoxide reductase family protein [Salinibacter ruber DSM
           13855]
 gi|83756240|gb|ABC44353.1| Vitamin K epoxide reductase family [Salinibacter ruber DSM 13855]
          Length = 412

 Score = 42.7 bits (99), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 68/160 (42%), Gaps = 25/160 (15%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D++ G  +A VT++EY    C HC +FH    + +E       ++R++ + FPL   S 
Sbjct: 242 QDITAGSNEAGVTVIEYFDPNCPHCKDFHQVMKQVVE---AHRDEVRFVYKPFPLRRSSL 298

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL--LNMAKFAGFSKN-DFDT 172
             +                +V+   +K ++ + ++  R     + M      ++  D D 
Sbjct: 299 PEIQAL-------------YVAAQSDKFNEMLEAQYARQGPGGIGMQDLRAIAEEIDLDP 345

Query: 173 CLNDQNI-----LDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            +  + +      D +   +KRA +   +DSTP   I G+
Sbjct: 346 SVLSERVEQNEYRDQVLQQRKRAVK-VGVDSTPTVLINGH 384


>gi|292491831|ref|YP_003527270.1| Na+/H+ antiporter NhaA [Nitrosococcus halophilus Nc4]
 gi|291580426|gb|ADE14883.1| Na+/H+ antiporter NhaA [Nitrosococcus halophilus Nc4]
          Length = 611

 Score = 42.7 bits (99), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +D  +G  DAP+T+VEY S  C  C    N+    + D++    +LRY+ R  PL
Sbjct: 17  RDHVLGPSDAPITLVEYGSYACPRCRAV-NEQIAKIRDQF--GDRLRYVFRHKPL 68


>gi|313848099|emb|CBY17098.1| putative exported protein [Chlamydophila psittaci RD1]
 gi|328914771|gb|AEB55604.1| Disulfide Bond Chaperone [Chlamydophila psittaci 6BC]
          Length = 232

 Score = 42.7 bits (99), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 66/162 (40%), Gaps = 12/162 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE--FPLDSVSTV 116
           ++G + AP+ +  +   +C  CAEF  + F  L+ KYI TG++ + L    F   S+   
Sbjct: 44  TLGNRYAPINITVFEEPSCLACAEFSTEVFPLLKKKYIDTGEVSFTLIPVCFIRGSMPAA 103

Query: 117 AVMLARCAEKRMDGGYWGFVS-----LLFNKQD--DWINSKNYRDALLNMAKFAGFSKND 169
             +L        +     +V      L++ K++  +W   +       N+   +G S N 
Sbjct: 104 QALLCVYHHDPREPDIEAYVEYFHRLLVYPKEEGKNWATPQVLTKLTENLKTHSGRSINP 163

Query: 170 --FDTCLNDQNILDDIKAGKKRASEDFAID-STPVFFIGGNL 208
                C++ Q   + IK      S+      +TP   +G  L
Sbjct: 164 KGLMQCIDSQRYEEQIKKNNIYGSQVLGGQLATPTAVVGDYL 205


>gi|294507681|ref|YP_003571739.1| Conserved hypothetical protein containing vitamin K epoxide
           reductase domain [Salinibacter ruber M8]
 gi|294344009|emb|CBH24787.1| Conserved hypothetical protein containing vitamin K epoxide
           reductase domain [Salinibacter ruber M8]
          Length = 455

 Score = 42.7 bits (99), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 68/160 (42%), Gaps = 25/160 (15%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D++ G  +A VT++EY    C HC +FH    + +E       ++R++ + FPL   S 
Sbjct: 285 QDITAGSNEAGVTVIEYFDPNCPHCKDFHQVMKQVVE---AHRDEVRFVYKPFPLRRSSL 341

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL--LNMAKFAGFSKN-DFDT 172
             +                +V+   +K ++ + ++  R     + M      ++  D D 
Sbjct: 342 PEIQAL-------------YVAAQSDKFNEMLEAQYARQGPGGIGMQDLRAIAEEIDLDP 388

Query: 173 CLNDQNI-----LDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            +  + +      D +   +KRA +   +DSTP   I G+
Sbjct: 389 SVLSERVEQNEYRDQVLQQRKRAVK-VGVDSTPTVLINGH 427


>gi|38233011|ref|NP_938778.1| hypothetical protein DIP0397 [Corynebacterium diphtheriae NCTC
           13129]
 gi|38199270|emb|CAE48901.1| Putative secreted protein [Corynebacterium diphtheriae]
          Length = 289

 Score = 42.4 bits (98), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 67/174 (38%), Gaps = 6/174 (3%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DAP+ + E++   C  CA + N+T   L ++Y+  G +R    + P++       
Sbjct: 108 AVGAVDAPLVITEFSDFECPFCARWSNQTEPTLMEEYVSKGLVRIEWNDLPVNG-EHALA 166

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF---AGFSKNDFDTCLN 175
                      G +  F   LF    +     N  + L +  +F   AG    +  +   
Sbjct: 167 AAKAGRAAAAQGKFDEFRKALFEASRNVSGHPN--NTLKDFERFARNAGVKDMERFSREA 224

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             +  D++       +    +  TP F +G     G      F K+I+S ++ S
Sbjct: 225 QDSTYDEVLTKAADYAHGLGVSGTPAFVVGTQYISGAQPTEEFIKVIESELKKS 278


>gi|218672311|ref|ZP_03521980.1| hypothetical protein RetlG_12067 [Rhizobium etli GR56]
          Length = 70

 Score = 42.4 bits (98), Expect = 0.052,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           ++A   G  +  FD  ++D++ILD +     +A EDF ++ TP FF+ G  + G  S
Sbjct: 11  DIAASTGIDRPAFDWLVSDRSILDGLNKLTSQAREDFNVEGTPTFFVNGEKFTGAQS 67


>gi|220911391|ref|YP_002486700.1| DSBA oxidoreductase [Arthrobacter chlorophenolicus A6]
 gi|219858269|gb|ACL38611.1| DSBA oxidoreductase [Arthrobacter chlorophenolicus A6]
          Length = 227

 Score = 42.4 bits (98), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 71/206 (34%), Gaps = 27/206 (13%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIP--DGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           VL   V+  +A Y   T         P P  + +V   +    +PS  K           
Sbjct: 22  VLAAAVIGGVAWYALLTANNEQKAAPPAPGSEQLVRENSYRLTAPSVEK----------A 71

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAVMLARCAEK 126
            +VE+    C  C   H      +E+   + G ++ ++ R FPL + +            
Sbjct: 72  QLVEFLDFECPSCGSIH----PVVEELKAEFGDRITFVNRHFPLAAHANSGQAALAAEAA 127

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM-AKFAGFSKNDFDTCLND----QNILD 181
              G Y    + LF  Q  W   +  +  L    A+  G     FD  + D    + +L 
Sbjct: 128 NQQGKYQEMANRLFETQSQWAGQQTSQAPLFRTYAEDLGLDLALFDAAVADHQTEERVLA 187

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN 207
           DI  G     E   +  TP FF+ G 
Sbjct: 188 DIADG-----EALGVHGTPTFFLNGE 208


>gi|159900279|ref|YP_001546526.1| hypothetical protein Haur_3762 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159893318|gb|ABX06398.1| hypothetical protein Haur_3762 [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 258

 Score = 42.4 bits (98), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 91/223 (40%), Gaps = 25/223 (11%)

Query: 1   MVMSTTRIGVLGG-----IVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP--- 52
           +++ + R  ++GG     I LL +    +   + +A   LP           +AA+P   
Sbjct: 6   VIVPSQRRFLVGGLASIAISLLVLGLSVWQMPEQTAPTTLPTSQPTA-----VAAAPIPQ 60

Query: 53  ---STMKDVSIGQKDAPVTMVEYASMTCFHCAEFH-NKTFKYLEDKYIKTGKLRYILREF 108
               +  D S+G+  AP+ +  Y  +TC HC + H     K    ++I +G +   +   
Sbjct: 61  FTRESTTDWSLGKPTAPIVLDLYTDLTCSHCRDLHLAMESKGFLSQFIDSGDVYLRIHMM 120

Query: 109 PLDSVSTVAV---MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAG 164
            +  VS  +V   +++ CA  +  G +W     L  +   W+ + N R  A + + +   
Sbjct: 121 AMPEVSPWSVDVTVMSVCAGSQ--GQFWPAYDALM-RDATWLTAPNPRQQAQIQVLQATT 177

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
             +  F+ C    +   +I A  +    +  +   P  ++ G+
Sbjct: 178 LDRQAFEACFQRPDFGREIVAFSRWQVAN-GLAGAPTAYVNGH 219


>gi|332287522|ref|YP_004422423.1| thioredoxin family protein [Chlamydophila psittaci 6BC]
 gi|325507361|gb|ADZ18999.1| thioredoxin family protein [Chlamydophila psittaci 6BC]
          Length = 212

 Score = 42.4 bits (98), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 66/162 (40%), Gaps = 12/162 (7%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE--FPLDSVSTV 116
           ++G + AP+ +  +   +C  CAEF  + F  L+ KYI TG++ + L    F   S+   
Sbjct: 24  TLGNRYAPINITVFEEPSCLACAEFSTEVFPLLKKKYIDTGEVSFTLIPVCFIRGSMPAA 83

Query: 117 AVMLARCAEKRMDGGYWGFVS-----LLFNKQD--DWINSKNYRDALLNMAKFAGFSKND 169
             +L        +     +V      L++ K++  +W   +       N+   +G S N 
Sbjct: 84  QALLCVYHHDPREPDIEAYVEYFHRLLVYPKEEGKNWATPQVLTKLTENLKTHSGRSINP 143

Query: 170 --FDTCLNDQNILDDIKAGKKRASEDFAID-STPVFFIGGNL 208
                C++ Q   + IK      S+      +TP   +G  L
Sbjct: 144 KGLMQCIDSQRYEEQIKKNNIYGSQVLGGQLATPTAVVGDYL 185


>gi|227876800|ref|ZP_03994909.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35243]
 gi|269976327|ref|ZP_06183323.1| dsba thioredoxin domain-containing protein [Mobiluncus mulieris
           28-1]
 gi|306817747|ref|ZP_07451489.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239]
 gi|227842697|gb|EEJ52897.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35243]
 gi|269935656|gb|EEZ92194.1| dsba thioredoxin domain-containing protein [Mobiluncus mulieris
           28-1]
 gi|304649561|gb|EFM46844.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239]
          Length = 308

 Score = 42.4 bits (98), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 80/182 (43%), Gaps = 21/182 (11%)

Query: 54  TMKDV-----SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG--KLRYI-L 105
           T KD+     ++G+  APVT+   +  +C  C  +  +T   LE+     G  KL+++ L
Sbjct: 126 TQKDLDAPTRTLGKDSAPVTLTVMSDFSCPMCTRWEQQTLPALEE-LAAAGDVKLQWVNL 184

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
             F     S +A   A  A K+  G  W FV   +    +  +++  ++++  MAK AG 
Sbjct: 185 VIFAEQYRSDIAAHGAIAAGKQ--GKLWEFVHAAYGAAGEGNHAEYTKESVTEMAKAAGV 242

Query: 166 S-----KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
                 K D  +   ++ + D+      R++    I+ TP F +G ++  G      F+ 
Sbjct: 243 PDIEKFKTDLTSDETEKQMQDE-----SRSARRLGINGTPFFIVGDSVISGAYPTEYFAN 297

Query: 221 II 222
            I
Sbjct: 298 TI 299


>gi|84503206|ref|ZP_01001291.1| dsbA-like thioredoxin domain protein [Oceanicola batsensis
           HTCC2597]
 gi|84686772|ref|ZP_01014659.1| dsbA-like thioredoxin domain protein [Maritimibacter alkaliphilus
           HTCC2654]
 gi|114762621|ref|ZP_01442065.1| dsbA-like thioredoxin domain protein [Pelagibaca bermudensis
           HTCC2601]
 gi|159046162|ref|YP_001541834.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|159046497|ref|YP_001542167.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|84388447|gb|EAQ01396.1| dsbA-like thioredoxin domain protein [Oceanicola batsensis
           HTCC2597]
 gi|84665203|gb|EAQ11682.1| dsbA-like thioredoxin domain protein [Rhodobacterales bacterium
           HTCC2654]
 gi|114544876|gb|EAU47881.1| dsbA-like thioredoxin domain protein [Roseovarius sp. HTCC2601]
 gi|157913921|gb|ABV95353.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|157914256|gb|ABV95686.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
          Length = 219

 Score = 42.4 bits (98), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 63/152 (41%), Gaps = 12/152 (7%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAV 118
           +G +DAPVT+VE+    C  C  F    +  +ED   + G  +R ++R  P    ++V  
Sbjct: 53  LGPEDAPVTIVEFFDPACEACRAF----YPVVEDIMAEHGDAVRVVIRYTPFHGEASVEA 108

Query: 119 MLARCAE-KRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLND 176
           +  R  E  RM   +   +  +  +Q  W +       L L +A   G       T +  
Sbjct: 109 I--RVLEAARMQDVFEPVLEAVLREQPRWASHGTPAPGLILEIAASGGLDVEAARTQMLA 166

Query: 177 QNILDDIKAGKKRAS-EDFAIDSTPVFFIGGN 207
             ++  +   + RA  E   +  TP FF+ G 
Sbjct: 167 PGVVAVLN--QDRADVETVGVRQTPTFFVNGK 196


>gi|322436094|ref|YP_004218306.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
 gi|321163821|gb|ADW69526.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
          Length = 614

 Score = 42.4 bits (98), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 84/207 (40%), Gaps = 31/207 (14%)

Query: 39  DGVVDFRALLAA--SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
           DG +    LLA   +P++    + G   AP+T+VE+    C  C          +E    
Sbjct: 227 DGTITDPTLLAQILAPTS---PTQGPATAPLTIVEFTDFQCPFC----RAAVAPMEQLMA 279

Query: 97  KTGK-LRYILREFPLD--SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
             G+ +R+I R FPLD    +  +   A  A ++  G +W    LLF  Q     +    
Sbjct: 280 ARGQEVRWIFRAFPLDFHQFAEQSAEAALAAGEQ--GKFWPMHDLLFAHQSALTLAD--- 334

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK---RASEDFAIDSTPVFFIGGNLYL 210
             L   A+    +   FD  ++   +   + A +    RA     +  TP F + G+L +
Sbjct: 335 --LHTYAQQLNLNLPAFDEAMSTHRLAGQVAADRALGLRA----GVSGTPTFMVDGHLMV 388

Query: 211 GDMSEGVFSKIIDSM-----IQDSTRR 232
           G  S    + + D+      IQ+++ R
Sbjct: 389 GARSLTELAALADAHRNFAGIQNASAR 415



 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 80/203 (39%), Gaps = 25/203 (12%)

Query: 40  GVVDFRALLAASPSTMKDV-----SIGQKDAPVTMVEYA---SMTCFHCAEFHNKTFKYL 91
           G+ +  A +  +P+    V     S GQ D P+T+  +    S    H AE      + L
Sbjct: 408 GIQNASARVPTAPAATHQVLGPEPSSGQPDTPITLTWFTDVRSPLAAHQAEL----LRTL 463

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG---YWGFVSLLFNKQDDWIN 148
              Y   G++R + +  PL +     +  A        GG   +W     L +++D    
Sbjct: 464 TAHY--EGRIRVLFKADPLVTHPDSRLASAALFAALALGGSDKFWPMFDALADRRDLLDR 521

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
            K     LL +A     + + F+  L+     +D+ A ++ A+    I   PV F+    
Sbjct: 522 PK-----LLTIAAAMHLNASAFEKSLDQSE--NDVTADQQEATRR-GISGAPVLFLNTER 573

Query: 209 YLGDMSEGVFSKIIDSMIQDSTR 231
             G   E  ++ I+D  ++D  +
Sbjct: 574 VDGLQREAFYTAILDRQLKDQLK 596


>gi|312887092|ref|ZP_07746696.1| DSBA oxidoreductase [Mucilaginibacter paludis DSM 18603]
 gi|311300404|gb|EFQ77469.1| DSBA oxidoreductase [Mucilaginibacter paludis DSM 18603]
          Length = 174

 Score = 42.0 bits (97), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 65/168 (38%), Gaps = 16/168 (9%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH---NKTFKYLEDKYIKTGKLRYILRE 107
           +P T +D  +G + AP+ ++EY    C  C + +   N   + + +  +      ++ R 
Sbjct: 7   NPITKRDHMLGIQAAPLVLLEYGDYQCSSCGDSYMAVNNVIQAMGEDIV------FVFRN 60

Query: 108 FPLDSVS-TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
           FPL  +               +   +W    LLF  Q     +    + L + A+  G  
Sbjct: 61  FPLTDIHPDAFDAALAAEAAALQNKFWEMYDLLFQNQ-----AYLSENELFSYARRIGLD 115

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
            + F   +  Q ++  I A  +       +  TP F+I G  + GD +
Sbjct: 116 MDRFGQDIQSQALISKIDADIESGLRS-GVSGTPTFYINGEKFDGDWT 162


>gi|94496265|ref|ZP_01302843.1| dsbA-like thioredoxin domain protein [Sphingomonas sp. SKA58]
 gi|94424444|gb|EAT09467.1| dsbA-like thioredoxin domain protein [Sphingomonas sp. SKA58]
          Length = 234

 Score = 42.0 bits (97), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 65/151 (43%), Gaps = 16/151 (10%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           IG ++APVT+VE+   +C  C  F+ +  K +  +Y +  ++R ++R  P    S  AV 
Sbjct: 72  IGPRNAPVTIVEFFDPSCEACRAFYPEV-KQIMARYPR--EVRLVVRYAPNHPGSEEAVR 128

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN---- 175
           +   A  R    Y   +  +  +Q  W +     ++  + A  AG +       LN    
Sbjct: 129 ILEAA--RAQNVYVPVLEAVLAQQPQWHDGN--MESAWSAAAAAGLNVERARAALNAPAV 184

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
             N+  DI  G+        +  TP +F+ G
Sbjct: 185 TANMQQDIADGQA-----LGVKGTPTYFVNG 210


>gi|257898279|ref|ZP_05677932.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|257836191|gb|EEV61265.1| conserved hypothetical protein [Enterococcus faecium Com15]
          Length = 173

 Score = 42.0 bits (97), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T K ++ G  DAP  M+E+ ++ C +C ++  ++ + LE+  +++G+L
Sbjct: 1   MDISVIDATKTTTEKGITYGSSDAPKKMIEFINLACPYCRQWFEESHELLEE-AVQSGQL 59

Query: 102 RYILREF 108
           + +++ F
Sbjct: 60  QRVIKLF 66


>gi|307701545|ref|ZP_07638562.1| DsbA-like protein [Mobiluncus mulieris FB024-16]
 gi|307613224|gb|EFN92476.1| DsbA-like protein [Mobiluncus mulieris FB024-16]
          Length = 308

 Score = 42.0 bits (97), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 80/182 (43%), Gaps = 21/182 (11%)

Query: 54  TMKDV-----SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG--KLRYI-L 105
           T KD+     ++G+  APVT+   +  +C  C  +  +T   LE+     G  KL+++ L
Sbjct: 126 TQKDLDAPTRTLGKDSAPVTLTVMSDFSCPMCTRWEQQTLPALEE-LAAAGDVKLQWVNL 184

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
             F     S +A   A  A K+  G  W FV   +    +  +++  ++++  MAK AG 
Sbjct: 185 VIFAEQYRSDIAAHGAIAAGKQ--GKLWEFVHAAYGAAGEGNHAEYTKESVTEMAKAAGV 242

Query: 166 S-----KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
                 K D  +   ++ + D+      R++    I+ TP F +G ++  G      F+ 
Sbjct: 243 PDIEKFKTDLTSDETEKQMQDE-----SRSARRLGINGTPFFIVGDSVISGAYPTEYFAN 297

Query: 221 II 222
            I
Sbjct: 298 TI 299


>gi|302205424|gb|ADL09766.1| Putative secreted protein with DSBA-like thioredoxin domain
           [Corynebacterium pseudotuberculosis C231]
          Length = 309

 Score = 42.0 bits (97), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 74/183 (40%), Gaps = 18/183 (9%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           +T    ++G  DAPV + E++   C  CA++ N+T   +  +Y++ G +R    + P++ 
Sbjct: 123 NTKDPFALGALDAPVVISEFSDFECPFCAKWSNETEPTIIKEYVEKGFVRIEWNDLPING 182

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF---------A 163
              V+   A  A     G +  F S LF  Q       +  + L N  +F         A
Sbjct: 183 PDAVSAAKAGRA-AAAQGKFNEFRSALF--QASKTIKGHPENKLTNFEEFAREAGVKDMA 239

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
            FS+   D         D +    +  +    I+ TP F +G     G     VF + I+
Sbjct: 240 RFSREASDAT------YDSVVDKAREYAGSLGINGTPGFVVGTQYVSGAQPTEVFIRAIE 293

Query: 224 SMI 226
           + +
Sbjct: 294 AEL 296


>gi|227551693|ref|ZP_03981742.1| thioredoxin superfamily protein [Enterococcus faecium TX1330]
 gi|257887171|ref|ZP_05666824.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257895708|ref|ZP_05675361.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|293377682|ref|ZP_06623871.1| conserved hypothetical protein [Enterococcus faecium PC4.1]
 gi|293571876|ref|ZP_06682892.1| thioredoxin family protein [Enterococcus faecium E980]
 gi|227179134|gb|EEI60106.1| thioredoxin superfamily protein [Enterococcus faecium TX1330]
 gi|257823225|gb|EEV50157.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257832273|gb|EEV58694.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|291608130|gb|EFF37436.1| thioredoxin family protein [Enterococcus faecium E980]
 gi|292643682|gb|EFF61803.1| conserved hypothetical protein [Enterococcus faecium PC4.1]
          Length = 173

 Score = 42.0 bits (97), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T K ++ G  DAP  M+E+ ++ C +C ++  ++ + LE+  +++G+L
Sbjct: 1   MDISVIDATKTTTEKGITYGSSDAPKKMIEFINLACPYCRQWFEESHELLEE-AVQSGQL 59

Query: 102 RYILREF 108
           + +++ F
Sbjct: 60  QRVIKLF 66


>gi|300857683|ref|YP_003782666.1| hypothetical protein cpfrc_00266 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685137|gb|ADK28059.1| putative secreted protein [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302329978|gb|ADL20172.1| Putative secreted protein with DSBA-like thioredoxin domain
           [Corynebacterium pseudotuberculosis 1002]
 gi|308275662|gb|ADO25561.1| Putative secreted protein with DSBA-like thioredoxin domain
           [Corynebacterium pseudotuberculosis I19]
          Length = 293

 Score = 42.0 bits (97), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 75/177 (42%), Gaps = 18/177 (10%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DAPV + E++   C  CA++ N+T   +  +Y++ G +R    + P++    V+ 
Sbjct: 113 ALGALDAPVVISEFSDFECPFCAKWSNETEPTIIKEYVEKGFVRIEWNDLPINGPDAVSA 172

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF---------AGFSKND 169
             A  A     G +  F S LF  Q       +  + L N  +F         A FS+  
Sbjct: 173 AKAGRA-AAAQGKFNEFRSALF--QASKTIKGHPENKLTNFEEFAREAGVKDMARFSREA 229

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            D   +  +++D      +  +    I+ TP F +G     G     VF + I++ +
Sbjct: 230 SDATYD--SVVDKA----REYAGSLGINGTPGFVVGTQYVSGAQPTEVFIRAIEAEL 280


>gi|260221388|emb|CBA29900.1| hypothetical protein Csp_A14470 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 218

 Score = 42.0 bits (97), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 63/155 (40%), Gaps = 11/155 (7%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           M    +G  +APVT+VE+    C  C EF+    K L  KY     +R ++R  P    S
Sbjct: 48  MHSPVLGPVNAPVTIVEFFDPACETCREFY-PIVKELLKKY--PNDVRLVVRYAPFHRNS 104

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
            + V +   +  ++ G YW  +  +   Q  W  + +    L    + A     D +  L
Sbjct: 105 DLVVKMLEAS--KVQGKYWEVLDAVLADQPLW--ASHGEPNLYVAYQSAVRVGVDLNKAL 160

Query: 175 NDQNILDDIKAGKKRASEDFA---IDSTPVFFIGG 206
            D      + A  K+  ED     +  TP FF+ G
Sbjct: 161 FDAQS-PAVTAALKQDVEDLTALEVTKTPTFFVNG 194


>gi|325271665|ref|ZP_08138163.1| putative sodium/proton antiporter [Pseudomonas sp. TJI-51]
 gi|324103200|gb|EGC00549.1| putative sodium/proton antiporter [Pseudomonas sp. TJI-51]
          Length = 378

 Score = 42.0 bits (97), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 11/147 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +DA +T+VEY    C +CA   + T  + + +      LRY++R  P      +A   
Sbjct: 214 GPEDAQLTLVEYVDFECAYCA---HATGSWDDLRAHFGDDLRYVVRHLPHHPHGPIAARA 270

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           +  A  +  G +W ++  +F +Q         R+ L+  A   G     F   L+   ++
Sbjct: 271 SEAAANQ--GMFWPWLDFVFTRQH-----ALEREHLIGYAVELGLDVERFIADLDSTAVI 323

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGN 207
           + ++     A    A  +TP FF+ G 
Sbjct: 324 ERVERDLASAVASGA-HATPTFFVEGR 349


>gi|305679792|ref|ZP_07402602.1| DsbA-like protein [Corynebacterium matruchotii ATCC 14266]
 gi|305660412|gb|EFM49909.1| DsbA-like protein [Corynebacterium matruchotii ATCC 14266]
          Length = 287

 Score = 42.0 bits (97), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 63/170 (37%), Gaps = 4/170 (2%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DAPV + E++   C  CA + N   K +  +Y+  G +R    +FP++       
Sbjct: 110 AVGAVDAPVVISEFSDFECPFCALYVNGARKQILSEYVDQGLVRLEWNDFPING-PNAVA 168

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-LLNMAKFAGFSK-NDFDTCLND 176
                      G +  F   L+            + A  +  AK AG      F+    D
Sbjct: 169 AAKAGRAAAAQGKFHEFHDALYQASAGVKGHPENKTADFVRFAKEAGVPDLAKFEEQATD 228

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
               + IK  +   S    ID  P   +G     G     VF ++I++ +
Sbjct: 229 STYDEVIKKAQGYGS-SLGIDGVPAALVGTQFVSGAQPIEVFRQVIETEL 277


>gi|190570933|ref|YP_001975291.1| DsbA-like disulfide oxidoreductase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019449|ref|ZP_03335255.1| DsbA-like disulfide oxidoreductase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357205|emb|CAQ54621.1| DsbA-like disulfide oxidoreductase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994871|gb|EEB55513.1| DsbA-like disulfide oxidoreductase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 32/167 (19%), Positives = 73/167 (43%), Gaps = 12/167 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +++ +  V +   +C +C    N   + + D     GK++YI R+ P+   +++    
Sbjct: 88  GNENSNIIAVGFFDYSCGYCKAIKNDVKQLIND-----GKVKYIFRDAPILGNNSLKAAK 142

Query: 121 ARCAEKRMDG-GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL-NDQN 178
              A   +D   Y  F     + + ++ +       +L + K  G ++NDF+  + N+ +
Sbjct: 143 GALATYFIDKEKYLDFHYAALDHRGEFSDK-----TILGIVKNIGINENDFNNSMKNNAD 197

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            ++ +    K    D  +  TP   IG +L++G     +  K ++ +
Sbjct: 198 KIEQMINNSKLLVRDLGVGGTPFLIIGDSLFVGKTDLNILRKKVNEL 244


>gi|153005981|ref|YP_001380306.1| vitamin K epoxide reductase [Anaeromyxobacter sp. Fw109-5]
 gi|152029554|gb|ABS27322.1| Vitamin K epoxide reductase [Anaeromyxobacter sp. Fw109-5]
          Length = 398

 Score = 42.0 bits (97), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 66/169 (39%), Gaps = 40/169 (23%)

Query: 65  APVT----MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD--------- 111
           APV     +VE++   C  CA  H +    L         L  + R FPLD         
Sbjct: 228 APVAAGGVVVEFSDYECPFCARAHEQ----LATLRAARPDLEIVRRHFPLDAACNPALAR 283

Query: 112 SVSTVAVMLAR---CAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSK 167
           S+   A  LAR   CAE +            F + DD +  ++  R+    +A   G   
Sbjct: 284 SIHPSACALARAAICAEAQGR----------FAEMDDALFRNQQAREPASRLAARLGLDV 333

Query: 168 NDFDTCL----NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
             F+ CL     +  +  D++ G +       + +TP + +GG +Y G+
Sbjct: 334 AAFEACLASPATEARLARDVEDGMR-----AGVRATPSYVVGGKVYAGE 377


>gi|115372120|ref|ZP_01459431.1| vitamin K epoxide reductase family [Stigmatella aurantiaca DW4/3-1]
 gi|310818802|ref|YP_003951160.1| vitamin k epoxide reductase family/thioredoxin domain-containing
           protein [Stigmatella aurantiaca DW4/3-1]
 gi|115370822|gb|EAU69746.1| vitamin K epoxide reductase family [Stigmatella aurantiaca DW4/3-1]
 gi|309391874|gb|ADO69333.1| Vitamin K epoxide reductase family/thioredoxin domain protein
           [Stigmatella aurantiaca DW4/3-1]
          Length = 551

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 57/162 (35%), Gaps = 25/162 (15%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV-- 118
           G  DAPV +VE+    C HC             + +  GK+    R++PLD     A+  
Sbjct: 362 GPVDAPVKVVEWTDSKCPHCKILVESVADL--KRRVPEGKMSLEARQYPLDGACNPAIPP 419

Query: 119 ----------MLAR---CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
                     + A+   C E   D  YW     LF  Q      K     ++ +A     
Sbjct: 420 QYSDGSGTRCLAAKAQICLESASD--YWSLREKLFANQAALTGPK-----VMEIASSGTM 472

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            ++  + C+N       ++     A +   I  TP+  + G 
Sbjct: 473 PRSQLEACVNSPETAARLREDVSYAKQ-HDIHGTPLMVVNGR 513


>gi|329942931|ref|ZP_08291710.1| disulfide bond chaperone [Chlamydophila psittaci Cal10]
 gi|328815191|gb|EGF85180.1| disulfide bond chaperone [Chlamydophila psittaci Cal10]
          Length = 173

 Score = 41.6 bits (96), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 58/137 (42%), Gaps = 11/137 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE--FPLDSVSTV 116
           ++G + AP+ +  +   +C  CAEF  + F  L+ KYI TG++ + L    F   S+   
Sbjct: 24  TLGNRYAPINITVFEEPSCLACAEFSTEVFPLLKKKYIDTGEVSFTLIPVCFIRGSMPAA 83

Query: 117 AVMLARCAEKRMDGGYWGFVS-----LLFNKQD--DWINSKNYRDALLNMAKFAGFSKND 169
             +L        +     +V      L++ K++  +W   +       N+   +G S N 
Sbjct: 84  QALLCVYHHDPREPDIEAYVEYFHRLLVYPKEEGKNWATPQVLTKLTENLKTHSGRSINP 143

Query: 170 --FDTCLNDQNILDDIK 184
                C++ Q   + IK
Sbjct: 144 KGLMQCIDSQRYEEQIK 160


>gi|320159569|ref|YP_004172793.1| putative peptidyl-prolyl cis-trans isomerase B [Anaerolinea
           thermophila UNI-1]
 gi|319993422|dbj|BAJ62193.1| putative peptidyl-prolyl cis-trans isomerase B [Anaerolinea
           thermophila UNI-1]
          Length = 422

 Score = 41.6 bits (96), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 65/163 (39%), Gaps = 6/163 (3%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P + +D + G ++A +T +EY  +         + +   L ++Y +  K+R + R FPL
Sbjct: 76  PPPSAQDWTQGPENAVLTFIEYTDLQAPASLAL-DWSLTRLRERYPE--KVRRVFRHFPL 132

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW--INSKNYRDALLNMAKFAGFSKN 168
            +     +  A        G +W    LL  +Q++W  +    +R  L   A        
Sbjct: 133 PANDKSLLAGAAAEAAGAQGKFWEMTHLLLERQEEWTPLPEAEFRAWLEARAADLALDVP 192

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            F + L+D  I   ++  ++       I + P   +   +Y G
Sbjct: 193 TFLSALDDPAIRLSLQQAQEEGFR-LGIPTMPFVLVNQRMYQG 234


>gi|62185180|ref|YP_219965.1| hypothetical protein CAB563 [Chlamydophila abortus S26/3]
 gi|62148247|emb|CAH64011.1| putative exported protein [Chlamydophila abortus S26/3]
          Length = 232

 Score = 41.6 bits (96), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 67/173 (38%), Gaps = 13/173 (7%)

Query: 49  AASPSTMKDV-SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           A  P+  K   ++G + AP+ +  +   +C  CAEF  + F  L+  YI TG++ + L  
Sbjct: 33  AHIPTNAKHFPTLGNRYAPINITVFEEPSCLACAEFSTEVFPLLKKNYIDTGEVSFTLIP 92

Query: 108 FPLDSVSTVAVMLARCA------EKRMDGGYWGFVSLLFNKQDD---WINSKNYRDALLN 158
                 S  A     C       E  ++     F  LL + +++   W   +       N
Sbjct: 93  VCFIRGSMPAAQALLCVYHHDPREPDIEAYTEYFHRLLIHPKEEGKHWATPQVLTKLTEN 152

Query: 159 MAKFAGFSKND--FDTCLNDQNILDDIKAGKKRASEDFAID-STPVFFIGGNL 208
           +   +G S N      C++ Q   + IK      S+      +TP   +G  L
Sbjct: 153 LKTHSGRSINPKGLMQCIDSQRYEEQIKKNNIYGSQVLGGQLATPTAVVGDYL 205


>gi|86159539|ref|YP_466324.1| Na+/H+ antiporter NhaA [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123763870|sp|Q2IE76|NHAA_ANADE RecName: Full=Na(+)/H(+) antiporter nhaA; AltName:
           Full=Sodium/proton antiporter nhaA
 gi|85776050|gb|ABC82887.1| sodium/proton antiporter, NhaA family [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 644

 Score = 41.6 bits (96), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 67/168 (39%), Gaps = 12/168 (7%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D  +G+  A +T+VEY S  C HC   H +    L D+     +LRY+ R+ P+ + + 
Sbjct: 36  RDHVLGEPGADLTLVEYGSYACPHCHVAH-EVVAELRDRL--GDRLRYVFRQRPIRAEAA 92

Query: 116 VAVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                   A   +DG  +W    LL  +   +  +    DA+          +       
Sbjct: 93  RPAAELAEAAG-LDGERFWHAHDLLMRRGPSF--AAGELDAIARELGLPPRERGAGPWEG 149

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
               + +D+++ ++       +  TP FFI G  Y G       S+ +
Sbjct: 150 AAARVREDVESARRS-----GVHLTPTFFINGRRYEGPWDAAALSEAL 192


>gi|299137865|ref|ZP_07031046.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX8]
 gi|298600506|gb|EFI56663.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX8]
          Length = 343

 Score = 41.6 bits (96), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 75/197 (38%), Gaps = 19/197 (9%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRAL-LAASPSTMKD----VSIGQKDAPVTMVEYASM 75
           + FF T  G       I D V+DF A   AA+   ++D     + G     + +VE+A +
Sbjct: 121 TVFFTTPDGKHA----IADNVIDFGATPFAATRKILQDRVDGPARGAAGKELLLVEFADL 176

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA---RCAEK-RMDGG 131
            C HC E         +D      + R +   +P+  +   A   A    C  K + D  
Sbjct: 177 QCPHCKEVQATMDNIAQD----FPQARIVFENYPISELHPYAFRAAAEGECVRKAKGDSA 232

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           ++ +   +F+ QD     +   DA L+ A               +   + D     ++  
Sbjct: 233 FFTYAQTVFDMQDGLTPER--ADATLSAAVTKAGGDPAAAAACAETPAIKDAVKASQKLG 290

Query: 192 EDFAIDSTPVFFIGGNL 208
            D  +D TP+  + G+L
Sbjct: 291 TDVGVDQTPILAVNGHL 307


>gi|84500859|ref|ZP_00999094.1| 27 kDa outer membrane protein, putative [Oceanicola batsensis
           HTCC2597]
 gi|84390926|gb|EAQ03344.1| 27 kDa outer membrane protein, putative [Oceanicola batsensis
           HTCC2597]
          Length = 263

 Score = 41.6 bits (96), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 66/153 (43%), Gaps = 12/153 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +  VT+VE+    C +C     K F+ ++    + G +R+I++EFP+   +++A   
Sbjct: 104 GNPEGDVTVVEFLDYRCGYC----RKAFEEVQQLIERDGNIRFIVKEFPILGEASLASSR 159

Query: 121 ARCAEKRMDG--GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
              A +++ G   Y      L   +           AL  +A+  G +       L+D  
Sbjct: 160 FAIATRQVAGDDAYAAMHDALMAYK-----GSTEPAALSRLARTLGIAPEPIVAHLDDPA 214

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           +  +I+  ++ A +   I  TP F +G  +  G
Sbjct: 215 VDAEIRKTRELA-QRLQISGTPTFVMGDQMIRG 246


>gi|220915653|ref|YP_002490957.1| Vitamin K epoxide reductase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219953507|gb|ACL63891.1| Vitamin K epoxide reductase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 390

 Score = 41.6 bits (96), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 67/165 (40%), Gaps = 36/165 (21%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM------- 119
           + + EY+   C  CA  H      L  +      ++ + R FPLD      ++       
Sbjct: 232 IVLYEYSDYECPFCARSHEANKPILASRP----DVKVVRRHFPLDDTCNPKLIRPFHVGA 287

Query: 120 --LAR---CAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKNDFDTC 173
             LAR   CAE +            F + DD +  ++  +  +  +A+  G     F+ C
Sbjct: 288 CDLARAAICAEAQGR----------FEQMDDALFRNQAEKAPVRELARRIGLDLPRFEAC 337

Query: 174 LN----DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           L+    ++ + DDI++  +       +  TP +  GG +Y GD++
Sbjct: 338 LSSPETEKRLADDIESAIQ-----AGVRGTPSYVYGGKVYPGDLA 377


>gi|82702666|ref|YP_412232.1| Na+/H+ antiporter NhaA [Nitrosospira multiformis ATCC 25196]
 gi|123754345|sp|Q2Y8T1|NHAA_NITMU RecName: Full=Na(+)/H(+) antiporter nhaA; AltName:
           Full=Sodium/proton antiporter nhaA
 gi|82410731|gb|ABB74840.1| sodium/proton antiporter, NhaA family [Nitrosospira multiformis
           ATCC 25196]
          Length = 624

 Score = 41.6 bits (96), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 67/170 (39%), Gaps = 38/170 (22%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D ++G  DA +T+VEY S         H +  + L  ++    ++RY+ R  PL   S +
Sbjct: 19  DHTLGPADAEITLVEYGSYADAPSRSAHERVAE-LRSRF--GNRMRYVFRHRPLAG-SKI 74

Query: 117 AVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           A   A   E   + G +W     L ++ D                     S +D  T ++
Sbjct: 75  ARRAAELVESHNNSGRFWDLHVALMSRSDK-------------------LSADDLCTIIS 115

Query: 176 DQNILDDIKAGKKRASE--------DFA------IDSTPVFFIGGNLYLG 211
           D  +  + +AG++  +E        D A      +  TP FFI G  Y G
Sbjct: 116 DLKLEGNKEAGQEETAERARDRVEADIASANASGVIVTPTFFINGRRYDG 165


>gi|299822507|ref|ZP_07054393.1| thioredoxin superfamily protein [Listeria grayi DSM 20601]
 gi|299816036|gb|EFI83274.1| thioredoxin superfamily protein [Listeria grayi DSM 20601]
          Length = 179

 Score = 41.6 bits (96), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 36/193 (18%), Positives = 82/193 (42%), Gaps = 21/193 (10%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A        + IG++DAPV ++ + ++ C  C ++ +K+ + + + +I+ GK+
Sbjct: 1   MDISQIKANEVDAKTGIHIGREDAPVKVISFVNLRCPFCRQWQDKSREVIAE-FIEEGKI 59

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF----VSLLFNKQDDWINSKNYRDALL 157
             I++ F  +  S   +       + +D          +  ++N QDDW          L
Sbjct: 60  ELIVKPFDKEKES---LQRGNVTHRYLDYENPKIALQQIEEIYNTQDDW--------GSL 108

Query: 158 NMAKFAGFSKNDFD-TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
            + +  G+ +     T  N+Q+  + I     RA+  F     P   +G  ++   +   
Sbjct: 109 PLDEVGGYMEQTLGYTEKNNQSAAEKIVEEANRANIVF----VPTVIVGEYIFDEHIEPK 164

Query: 217 VFSKIIDSMIQDS 229
             + ++D  ++ S
Sbjct: 165 ELANLLDKEVEKS 177


>gi|300777598|ref|ZP_07087456.1| thioredoxin domain protein [Chryseobacterium gleum ATCC 35910]
 gi|300503108|gb|EFK34248.1| thioredoxin domain protein [Chryseobacterium gleum ATCC 35910]
          Length = 172

 Score = 41.6 bits (96), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 25/173 (14%)

Query: 48  LAASPS-TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYIL 105
           ++  PS +  D + G  DA + +VEY    C +C       +  L++   + G ++R++ 
Sbjct: 1   MSLKPSVSNADHTQGNSDASLVIVEYGDYQCPYCG----AAYPVLKELMKEFGNQIRFVF 56

Query: 106 REFPLDSVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
           R FPL  +               + G +W     ++  Q +++N+    D  L +A+  G
Sbjct: 57  RNFPLSEMHQYARTAALAAEAAALQGKFWEMHDAIYENQ-EYLNA----DLPLKLAEKLG 111

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDF------AIDSTPVFFIGGNLYLG 211
            +   F   ++ + + + +         DF       ++ TP FFI GN + G
Sbjct: 112 LNIPQFKADIHKKELAEKVDT-------DFESGIISGVNGTPSFFINGNKFNG 157


>gi|225020231|ref|ZP_03709423.1| hypothetical protein CORMATOL_00234 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946975|gb|EEG28184.1| hypothetical protein CORMATOL_00234 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 287

 Score = 41.6 bits (96), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 63/170 (37%), Gaps = 4/170 (2%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DAPV + E++   C  CA + N   K +  +Y+  G +R    +FP++       
Sbjct: 110 AVGAVDAPVVISEFSDFECPFCALYVNGARKQILSEYVDQGLVRLEWNDFPING-PNAVA 168

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-LLNMAKFAGFSK-NDFDTCLND 176
                      G +  F   L+            + A  +  AK AG      F+    D
Sbjct: 169 AAKAGRAAAAQGKFHEFHDALYQASAGVKGHPENKTADFVRFAKEAGVPDLAKFEEQATD 228

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
               + IK  +   S    ID  P   +G     G     VF ++I++ +
Sbjct: 229 STYDEVIKKAQGYGS-SLGIDGVPAALVGTQFVSGAQPIEVFRQVIETEL 277


>gi|114764673|ref|ZP_01443858.1| 27 kDa outer membrane protein, putative [Pelagibaca bermudensis
           HTCC2601]
 gi|114542873|gb|EAU45894.1| 27 kDa outer membrane protein, putative [Roseovarius sp. HTCC2601]
          Length = 257

 Score = 41.6 bits (96), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 63/154 (40%), Gaps = 14/154 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTVA 117
           G  D  +T+VE++   C +C     + F  +E+     G +R+I++EFP+    SV++  
Sbjct: 97  GNPDGDITIVEFSDYRCGYC----RRAFPEVEELISSDGNIRFIMKEFPILGEASVTSSR 152

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             +A   E   D  Y      L       +  +     L  +A   G         ++D+
Sbjct: 153 FAIATLMEA-GDEAYKAVHDALIT-----LEGEPSEPVLRRLADTLGLDAEAIIARMSDE 206

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            +   I+  ++ A+    I+ TP F  G  +  G
Sbjct: 207 EVTRRIQETRELATR-LQINGTPSFVFGDQMLRG 239


>gi|126458872|ref|YP_001055150.1| protein-disulfide isomerase-like protein [Pyrobaculum calidifontis
           JCM 11548]
 gi|126248593|gb|ABO07684.1| Protein-disulfide isomerase-like protein [Pyrobaculum calidifontis
           JCM 11548]
          Length = 217

 Score = 41.6 bits (96), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
           L   P  M+    G   APV +VE+  + C +CA  H +    +++K ++ GKL YIL +
Sbjct: 43  LPIPPWAMR---FGNGSAPVVLVEFFDLLCPYCAYAHVELGPLIKEK-VQEGKLYYILVD 98

Query: 108 FPLD 111
           FP+ 
Sbjct: 99  FPVH 102


>gi|260576051|ref|ZP_05844045.1| DSBA oxidoreductase [Rhodobacter sp. SW2]
 gi|259021750|gb|EEW25052.1| DSBA oxidoreductase [Rhodobacter sp. SW2]
          Length = 219

 Score = 41.6 bits (96), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 62/158 (39%), Gaps = 25/158 (15%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           S G +DAPVT+VE+   +C  C  +H       E + +   ++R +LR       S  A 
Sbjct: 55  SFGPEDAPVTLVEFFDPSCEACRAYHPVV---EEIRRMFPDQVRIVLRYALFHEGSDEAA 111

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDW-INSKNYRDALLNMAKFAGFSKNDFDT----- 172
            +   A  RM   +   +  LF +Q  W ++     D    +A  AG      +T     
Sbjct: 112 RILEAA--RMQNKFEPVLDALFEEQPGWAVHGSPEMDVAWEIAANAGLDVERAETDKLFP 169

Query: 173 ----CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                LN Q++ D          E   I  TP FF+ G
Sbjct: 170 GITGTLN-QDMAD---------VEALGIRQTPTFFLNG 197


>gi|329889581|ref|ZP_08267924.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328844882|gb|EGF94446.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 226

 Score = 41.6 bits (96), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 10/164 (6%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           IG ++A + ++ +    C +C          LE       K+R + +E+P+     V+  
Sbjct: 62  IGAENADIIIIGFMDYNCPYC----KMMIPELEGLMKADPKVRILYKEWPI--FGAVSEN 115

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL-NDQN 178
           +AR A      G +  V   F      I +     +L   A+ AG   N  D  L   + 
Sbjct: 116 VARLAMAANYQGKYHEVHKAFMGAKGRIETDQQARSL---ARAAGVDMNQLDRDLATHRE 172

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            +D +     R +   A+  TP F I GNL  G M +     +I
Sbjct: 173 EIDAVILRNTREASALALSGTPAFIINGNLIPGGMPQAQLEAVI 216


>gi|323463203|gb|ADX75356.1| protein-disulfide isomerase, putative [Staphylococcus
           pseudintermedius ED99]
          Length = 229

 Score = 41.6 bits (96), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 3/95 (3%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL--RYILREF 108
           +  T K  + G+KD+ V +VE+    C +C +F       LE +YI   K+  RY+    
Sbjct: 42  AAETQKQPTQGKKDSKVLLVEFGDFKCPYCGDFERNIKPKLEKEYIDNNKVEFRYV-NVL 100

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                S +    A    +     YW F   LF +Q
Sbjct: 101 IHGEESELGAKAALAVNQYAPDKYWQFHHALFEQQ 135


>gi|306845002|ref|ZP_07477583.1| DSBA oxidoreductase [Brucella sp. BO1]
 gi|306274634|gb|EFM56423.1| DSBA oxidoreductase [Brucella sp. BO1]
          Length = 204

 Score = 41.6 bits (96), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 60/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGENSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +D I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIDGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 191


>gi|86136659|ref|ZP_01055238.1| 27 kDa outer membrane protein, putative [Roseobacter sp. MED193]
 gi|85827533|gb|EAQ47729.1| 27 kDa outer membrane protein, putative [Roseobacter sp. MED193]
          Length = 256

 Score = 41.6 bits (96), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 71/172 (41%), Gaps = 12/172 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVM 119
           G  D  +T+VE+    C +C +   +  K L+      G +R I++EFP L   S  A  
Sbjct: 95  GNPDGDITLVEFMDYRCGYCRKAAPEVAKLLQ----ADGNIRLIVKEFPILGEASLFASR 150

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
            A   ++      +  V     +    +N    R     +A       +     ++ + +
Sbjct: 151 FAVATKQVAGNDAYKQVHEALIEMTSELNEVTMR----RLANGLSLDADAIWEAMDSEAV 206

Query: 180 LDDIKAGKKRA-SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            D+++  + RA +++ AI  TP F +G  L  G +       I+D   ++++
Sbjct: 207 TDELR--RTRALAQNLAISGTPTFVLGNQLLRGYLPADQLKIIVDEQREENS 256


>gi|293568093|ref|ZP_06679430.1| thioredoxin family protein [Enterococcus faecium E1071]
 gi|294617419|ref|ZP_06697053.1| thioredoxin family protein [Enterococcus faecium E1679]
 gi|291589175|gb|EFF20986.1| thioredoxin family protein [Enterococcus faecium E1071]
 gi|291596325|gb|EFF27584.1| thioredoxin family protein [Enterococcus faecium E1679]
          Length = 173

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 86/188 (45%), Gaps = 19/188 (10%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T K +  G  +AP  MVE+ ++ C +C ++  ++++ LE+  +++G+L
Sbjct: 1   MDISVIDATKTNTQKGILYGSSNAPKKMVEFINLACPYCRQWFEESYELLEE-AVQSGQL 59

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGY-WGFVSLLFNKQDDWINSKNYRDALLNMA 160
           + +++ F  +  S +   +        DG      +  +F+ QD+W +        L++ 
Sbjct: 60  QRVIKLFDKEKESLLRGNVMHRYLTISDGQKAIKEIKQIFDTQDEWKH--------LSLQ 111

Query: 161 KFAGFSKNDFD-TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           + A F+ +    T L D+ +   +    ++A   F     P   +G  ++     E +  
Sbjct: 112 EVADFAVDKLKLTELKDEQLSQAVINEAEQAHIRF----VPTVILGKEIF----DESISI 163

Query: 220 KIIDSMIQ 227
           K +  +IQ
Sbjct: 164 KELKELIQ 171


>gi|163789794|ref|ZP_02184231.1| hypothetical protein CAT7_06166 [Carnobacterium sp. AT7]
 gi|159875016|gb|EDP69083.1| hypothetical protein CAT7_06166 [Carnobacterium sp. AT7]
          Length = 175

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 59/121 (48%), Gaps = 3/121 (2%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG +DAPV ++E+ ++ C +C  ++  + K L  +Y+  GK+
Sbjct: 1   MDISTIKAEKVNTTIGIKIGSEDAPVKVIEFINLKCPYCKMWYEDS-KDLLAEYVSAGKV 59

Query: 102 RYILREFPLDSVS-TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
           + +++ F  +  S     +L R  +          +   F  QD+W N  ++ DA+   A
Sbjct: 60  QRVIKHFDKEKPSLKKGNVLHRYLDYTNPEKALEEIDYFFAHQDEWGNLGDF-DAIAEYA 118

Query: 161 K 161
           +
Sbjct: 119 E 119


>gi|295839895|ref|ZP_06826828.1| conserved hypothetical protein [Streptomyces sp. SPB74]
 gi|295827700|gb|EDY43656.2| conserved hypothetical protein [Streptomyces sp. SPB74]
          Length = 274

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 50/123 (40%), Gaps = 4/123 (3%)

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +L   LR FPL+             E    G  W FV+ +  + +D   S      L+  
Sbjct: 145 RLEIRLRHFPLEKHRHAFAAAQAAEEAFAQGQGWPFVAAVLRRVEDLAASGE--PLLVRT 202

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-EGVF 218
           A   G    +FDT L D   +  + A +    +   +  TP + IGG L  G  S EG+ 
Sbjct: 203 AAELGLDSEEFDTALIDGRHILTVDADQA-EGKALGVKGTPTYEIGGTLLDGSTSQEGLR 261

Query: 219 SKI 221
           ++I
Sbjct: 262 ARI 264


>gi|315654544|ref|ZP_07907450.1| hcca isomerase [Mobiluncus curtisii ATCC 51333]
 gi|315491008|gb|EFU80627.1| hcca isomerase [Mobiluncus curtisii ATCC 51333]
          Length = 284

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 67/161 (41%), Gaps = 16/161 (9%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE---FPLDSVST 115
           ++G+ DAPVT+   +  +C  C  + N T   L+ KY+  G L+        F     S 
Sbjct: 112 TLGKPDAPVTLTVLSDFSCPMCTSWGNDTLPKLQ-KYVDDGTLKIQWHNMVIFADQYQSD 170

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS-----KNDF 170
           +A   +  A K+  G  W FV   ++   +  +     + ++ +A+  G +     K D 
Sbjct: 171 IAAKASIAAMKQ--GKLWDFVRAAYHTAPEGEHPTYDENKVIQIAQSIGITDLGRFKTDM 228

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           ++      + ++  +G         ++ TP F +G +   G
Sbjct: 229 NSPETQATVSEETDSG-----HSVGVNGTPFFVLGDSTISG 264


>gi|294811606|ref|ZP_06770249.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|294324205|gb|EFG05848.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
          Length = 239

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 13/171 (7%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           M D + G   APV +  +  ++C  C    +   + L ++Y    +L   LR FPL+  +
Sbjct: 65  MSDSTTGSPTAPVVLDVWCDLSCPDCRTALDD-IRALRERYGD--RLDIRLRHFPLEK-N 120

Query: 115 TVAVMLARCAEKRMDGGYW-GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
             + + A+ AE+ ++ G    +   L  + D+    +     LL  A+  G    + DT 
Sbjct: 121 KHSYVSAQAAEEAVEQGRGREYAEELLARVDEL--RERGAPVLLETARDLGLDAEEIDTA 178

Query: 174 LND--QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE-GVFSKI 221
           L D    ++ D    + +A     +  TP + +GG    G  S+ G+ ++I
Sbjct: 179 LIDGRHTLIVDADQAEGKA---LGVSGTPTYVVGGQRLDGGQSQDGLRARI 226


>gi|254718554|ref|ZP_05180365.1| DSBA oxidoreductase [Brucella sp. 83/13]
 gi|265983527|ref|ZP_06096262.1| DSBA oxidoreductase [Brucella sp. 83/13]
 gi|306837290|ref|ZP_07470173.1| DSBA oxidoreductase [Brucella sp. NF 2653]
 gi|264662119|gb|EEZ32380.1| DSBA oxidoreductase [Brucella sp. 83/13]
 gi|306407603|gb|EFM63799.1| DSBA oxidoreductase [Brucella sp. NF 2653]
          Length = 204

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 60/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGENSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGHYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +D I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIDGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 191


>gi|162456356|ref|YP_001618724.1| hypothetical protein sce8074 [Sorangium cellulosum 'So ce 56']
 gi|161166938|emb|CAN98243.1| hypothetical protein sce8074 [Sorangium cellulosum 'So ce 56']
          Length = 248

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/59 (22%), Positives = 34/59 (57%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           + +G   AP+T+VE++ + C HC ++  +    + +++++T +++ + R       S+V
Sbjct: 69  IVLGDPSAPITLVEFSDLRCSHCRDYGLEILPVILERHVRTKQVKLVFRNLAFLGPSSV 127


>gi|299134455|ref|ZP_07027648.1| DSBA oxidoreductase [Afipia sp. 1NLS2]
 gi|298591202|gb|EFI51404.1| DSBA oxidoreductase [Afipia sp. 1NLS2]
          Length = 252

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 76/178 (42%), Gaps = 19/178 (10%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LD 111
           S+   + +G  +  V MV +    C  C    +     +E        LR +L+EFP L 
Sbjct: 86  SSRGSIVLGNPNGTVNMVAFFDYNCPFCRASVDDIQTLIE----ANPDLRVVLKEFPILG 141

Query: 112 SVSTVAVMLARCAEKR-----MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
             ST A  +A  A ++     +   Y+   +L+  K      + N   ALL   KF G +
Sbjct: 142 QESTEASHVALAASRQFQNADLQAHYYR--ALMKVK-----GTMNGELALLIGEKF-GLN 193

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           +      L+D+ I D I +     +E   ++ TP F IG NL +G +      +IID+
Sbjct: 194 ETQARKDLHDKQI-DAILSENMSIAEALGVNGTPSFVIGNNLIVGAVGAVQIQQIIDT 250


>gi|124266839|ref|YP_001020843.1| disulfide isomerase-like protein [Methylibium petroleiphilum PM1]
 gi|124259614|gb|ABM94608.1| disulfide isomerase-like protein [Methylibium petroleiphilum PM1]
          Length = 204

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 59/150 (39%), Gaps = 11/150 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
             K APVT+VE+    C  C  F+    K L  KY     +R ++R  P    S   V L
Sbjct: 40  APKGAPVTIVEFFDPACETCRAFY-PIVKSLMAKY--PDDVRLVIRYAPFHQGSDQVVKL 96

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKNDFDTCLND--Q 177
              A+++  G +   +  +   Q  W  + +   D    +AK AG    D +    D  Q
Sbjct: 97  LEAAKRQ--GKFLPVLEAVLQAQPTWADHGRPNPDLTFEIAKAAGL---DIERAREDMAQ 151

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
             +  + A +        +  TP FF+ G 
Sbjct: 152 PAMQTLLAQEVEDLTALQVQRTPTFFVNGR 181


>gi|326440206|ref|ZP_08214940.1| hypothetical protein SclaA2_04024 [Streptomyces clavuligerus ATCC
           27064]
          Length = 175

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 13/171 (7%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           M D + G   APV +  +  ++C  C    +   + L ++Y    +L   LR FPL+  +
Sbjct: 1   MSDSTTGSPTAPVVLDVWCDLSCPDCRTALDD-IRALRERY--GDRLDIRLRHFPLEK-N 56

Query: 115 TVAVMLARCAEKRMDGGYW-GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
             + + A+ AE+ ++ G    +   L  + D+    +     LL  A+  G    + DT 
Sbjct: 57  KHSYVSAQAAEEAVEQGRGREYAEELLARVDEL--RERGAPVLLETARDLGLDAEEIDTA 114

Query: 174 LND--QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE-GVFSKI 221
           L D    ++ D    + +A     +  TP + +GG    G  S+ G+ ++I
Sbjct: 115 LIDGRHTLIVDADQAEGKA---LGVSGTPTYVVGGQRLDGGQSQDGLRARI 162


>gi|86160465|ref|YP_467250.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776976|gb|ABC83813.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 671

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 78/211 (36%), Gaps = 28/211 (13%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
           G+     P+ D    +R     SP        G  DA VT+VE +   C +C +    T 
Sbjct: 36  GAPTRARPVEDPKAVYRVPADDSPVR------GPADALVTIVESSDFQCPYC-KRGAATM 88

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN 148
           K +ED Y   GK+R++ +  PL              E R  GG   F +L     D   +
Sbjct: 89  KQVEDAY--RGKVRFVFKHNPLSFHPQAMPAALAAEEARAQGGDEKFWAL----HDKLFD 142

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASED--------FAIDSTP 200
           S    D        A   K   +  L+   + + +++G  RA  +            +TP
Sbjct: 143 SAPALDQ-------AAIEKAAGELGLDVAKVREAMQSGTHRARIERDQKLVVGLGAPATP 195

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            FF+ G    G      F  +ID  ++ + +
Sbjct: 196 TFFVNGRKIAGAQPIEAFRTVIDEELRKAEQ 226


>gi|300865534|ref|ZP_07110319.1| DSBA oxidoreductase [Oscillatoria sp. PCC 6506]
 gi|300336477|emb|CBN55469.1| DSBA oxidoreductase [Oscillatoria sp. PCC 6506]
          Length = 257

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 74/185 (40%), Gaps = 26/185 (14%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +A +A SP+T      G     + ++E++   C  C+  HN   +++        K+   
Sbjct: 89  QAAIADSPTT------GSPSQKIVLIEFSDFQCPFCSRAHNTVNQFMAK---HQDKVTLA 139

Query: 105 LREFPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQD---DWINSKNYRDALLNMA 160
            + FPL  +              +  G +W + + LF +Q    + + S   ++  LN+ 
Sbjct: 140 FKHFPLVQIHPQALPAAKAAWAAQQQGKFWEYHNALFEQQQQLSEELYSAIAKNLNLNLE 199

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS----EG 216
           KF     +D ++      I  DI+       +   ID TP F + G  + G +     E 
Sbjct: 200 KF----NSDRNSPAAAAAIQKDIQIA-----QTLGIDGTPFFILKGETFSGAVELSEMES 250

Query: 217 VFSKI 221
           + +K+
Sbjct: 251 ILAKV 255


>gi|254501932|ref|ZP_05114083.1| DSBA-like thioredoxin domain protein [Labrenzia alexandrii DFL-11]
 gi|222438003|gb|EEE44682.1| DSBA-like thioredoxin domain protein [Labrenzia alexandrii DFL-11]
          Length = 269

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 61/160 (38%), Gaps = 11/160 (6%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LD 111
           ++ + V +G  D  VT+VE+    C +C   +    + +++       LR +L+EFP L 
Sbjct: 98  NSTRQVVLGNPDGSVTLVEFFDYNCGYCKRAYGDMVRLMDEN----PDLRVVLKEFPVLG 153

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             S  A  +A          Y  F   L  ++       N   A +  A  AG S  D  
Sbjct: 154 QPSVEAAQVAIAVNSVAPEKYHAFHEALMTRR----GQANLASA-MEAATGAGISTEDLQ 208

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             +        I+     A+    +  TP + IG  + +G
Sbjct: 209 AAMTTDEAGQTIEEVYSLANR-LGLTGTPSYVIGDEVVMG 247


>gi|292655399|ref|YP_003535296.1| DSBA-like thioredoxin domain [Haloferax volcanii DS2]
 gi|291372167|gb|ADE04394.1| DSBA-like thioredoxin domain, putative [Haloferax volcanii DS2]
          Length = 227

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 63/164 (38%), Gaps = 12/164 (7%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-- 110
           S++    IG +DA V +  +    C HCA F       L  +Y+  G +RY   +FP+  
Sbjct: 50  SSLPTPVIGSEDASVVVDVWEDFACPHCATFAVDVAPQLRSEYVSEGIVRYRHHDFPIPV 109

Query: 111 -DSVSTVAVMLARCAEKRMDG-GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
            +  S      AR  +   D   ++ F   L+  Q +     +   +L  +   A  +  
Sbjct: 110 DEWWSWKGASAARAVQDEADDETFFDFAHTLYENQSE-FGGGDAEGSLSTLQSLA--ADA 166

Query: 169 DFDTC-----LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           D D C      + +     ++A +  A ++     TP   I G 
Sbjct: 167 DLDGCSVAAAASRERYRPLVEAERTEAVDERGFQGTPTVLIDGE 210


>gi|69245965|ref|ZP_00603737.1| conserved hypothetical protein [Enterococcus faecium DO]
 gi|257878480|ref|ZP_05658133.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257882902|ref|ZP_05662555.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257889320|ref|ZP_05668973.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257894333|ref|ZP_05673986.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|258615995|ref|ZP_05713765.1| hypothetical protein EfaeD_09803 [Enterococcus faecium DO]
 gi|260560069|ref|ZP_05832247.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|261209138|ref|ZP_05923537.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289566457|ref|ZP_06446882.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|293557152|ref|ZP_06675706.1| thioredoxin family protein [Enterococcus faecium E1039]
 gi|293559804|ref|ZP_06676322.1| thioredoxin family protein [Enterococcus faecium E1162]
 gi|294616488|ref|ZP_06696269.1| thioredoxin family protein [Enterococcus faecium E1636]
 gi|294623417|ref|ZP_06702273.1| thioredoxin family protein [Enterococcus faecium U0317]
 gi|314939690|ref|ZP_07846914.1| conserved hypothetical protein [Enterococcus faecium TX0133a04]
 gi|314942219|ref|ZP_07849071.1| conserved hypothetical protein [Enterococcus faecium TX0133C]
 gi|314948852|ref|ZP_07852222.1| conserved hypothetical protein [Enterococcus faecium TX0082]
 gi|314950794|ref|ZP_07853866.1| conserved hypothetical protein [Enterococcus faecium TX0133A]
 gi|314992226|ref|ZP_07857666.1| conserved hypothetical protein [Enterococcus faecium TX0133B]
 gi|314995216|ref|ZP_07860329.1| conserved hypothetical protein [Enterococcus faecium TX0133a01]
 gi|68195495|gb|EAN09939.1| conserved hypothetical protein [Enterococcus faecium DO]
 gi|257812708|gb|EEV41466.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257818560|gb|EEV45888.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257825680|gb|EEV52306.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257830712|gb|EEV57319.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|260073904|gb|EEW62228.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|260076892|gb|EEW64620.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289161722|gb|EFD09597.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|291590636|gb|EFF22364.1| thioredoxin family protein [Enterococcus faecium E1636]
 gi|291597183|gb|EFF28378.1| thioredoxin family protein [Enterococcus faecium U0317]
 gi|291600721|gb|EFF31019.1| thioredoxin family protein [Enterococcus faecium E1039]
 gi|291606223|gb|EFF35639.1| thioredoxin family protein [Enterococcus faecium E1162]
 gi|313590546|gb|EFR69391.1| conserved hypothetical protein [Enterococcus faecium TX0133a01]
 gi|313593226|gb|EFR72071.1| conserved hypothetical protein [Enterococcus faecium TX0133B]
 gi|313597009|gb|EFR75854.1| conserved hypothetical protein [Enterococcus faecium TX0133A]
 gi|313598991|gb|EFR77836.1| conserved hypothetical protein [Enterococcus faecium TX0133C]
 gi|313641025|gb|EFS05605.1| conserved hypothetical protein [Enterococcus faecium TX0133a04]
 gi|313644725|gb|EFS09305.1| conserved hypothetical protein [Enterococcus faecium TX0082]
          Length = 173

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T K +  G  +AP  MVE+ ++ C +C ++  ++++ LE+  +++G+L
Sbjct: 1   MDISVIDATKTNTQKGILYGSSNAPKKMVEFINLACPYCRQWFEESYELLEE-AVQSGQL 59

Query: 102 RYILREF 108
           + +++ F
Sbjct: 60  QRVIKLF 66


>gi|328543665|ref|YP_004303774.1| DSBA-like thioredoxin domain protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413409|gb|ADZ70472.1| DSBA-like thioredoxin domain protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 256

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 69/174 (39%), Gaps = 11/174 (6%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LD 111
           ++ +   +G  D  VTMVE+    C +C     +    ++    +   LR +L+EFP L 
Sbjct: 85  NSTRQAVLGNPDGGVTMVEFFDYNCGYC----KRALGDMDRLIAEDPNLRVVLKEFPVLG 140

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             S  A  +A          Y  F + L N +      +  + + L +A   G S  D +
Sbjct: 141 QGSMEAAQVAIAVNTVAPEKYGDFHAALLNHR-----GQANKASALEIAASIGLSGADLE 195

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
             L    +   ++     A+    +  TP + IG  + +G +      + I++M
Sbjct: 196 AALASPEVGATVEEVYTLANR-LGLTGTPSYVIGTEVIMGAVGYNELRQKIEAM 248


>gi|229492049|ref|ZP_04385863.1| Na+/H+ antiporter NhaA [Rhodococcus erythropolis SK121]
 gi|229321073|gb|EEN86880.1| Na+/H+ antiporter NhaA [Rhodococcus erythropolis SK121]
          Length = 591

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 85/219 (38%), Gaps = 25/219 (11%)

Query: 8   IGVLGGIVLLFIASYFFY----TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           +GVL  +VL  +     +    T+ G A  +LPI         +L        D   G +
Sbjct: 378 VGVLVAMVLAAVLGAVIFRVAATKLGEAEADLPI---------VLEPPVDPEIDHIRGPE 428

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPL-DSVSTVAVMLA 121
           DA +T+VE+    C  CA   + T  + +D ++  G  LRY++R  PL D      V   
Sbjct: 429 DAQLTLVEFVDFECGFCA---HATGGW-DDLHVHFGDDLRYVVRHLPLVDIHPHALVAAH 484

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                     +W ++  +F +Q+        R  L+  A   G   + F   L+   + +
Sbjct: 485 AAEAAARQHMFWEWLDFVFTRQN-----ALARTDLIGYAAEIGLDVDQFVADLDSDAVAE 539

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
            ++     A    A   TP FF+ G   +G       +K
Sbjct: 540 RVQRDISSAQSSGA-RETPTFFVEGCRIIGSYDARTLTK 577


>gi|298345954|ref|YP_003718641.1| putative DSBA oxidoreductase [Mobiluncus curtisii ATCC 43063]
 gi|304390343|ref|ZP_07372296.1| hcca isomerase [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|315657551|ref|ZP_07910433.1| hcca isomerase [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|298236015|gb|ADI67147.1| possible DSBA oxidoreductase [Mobiluncus curtisii ATCC 43063]
 gi|304326099|gb|EFL93344.1| hcca isomerase [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|315492023|gb|EFU81632.1| hcca isomerase [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 284

 Score = 40.4 bits (93), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 67/161 (41%), Gaps = 16/161 (9%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE---FPLDSVST 115
           ++G+ DAPVT+   +  +C  C  + N T   L+ KY+  G L+        F     S 
Sbjct: 112 TLGKPDAPVTLTVLSDFSCPMCTSWGNDTLPKLQ-KYVDDGTLKIQWHNMVIFADQYQSD 170

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS-----KNDF 170
           +A   +  A K+  G  W FV   ++   +  +     + ++ +A+  G +     K D 
Sbjct: 171 IAAKASIAAMKQ--GKLWDFVRAAYHTAPEGEHPTYDENKVIQIAQSIGITDLGRFKTDM 228

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           ++      + ++  +G         ++ TP F +G +   G
Sbjct: 229 NSPEAQATVSEETDSG-----HSVGVNGTPFFVLGDSTISG 264


>gi|225872336|ref|YP_002753791.1| DSBA-like thioredoxin domain protein [Acidobacterium capsulatum
           ATCC 51196]
 gi|225793402|gb|ACO33492.1| DSBA-like thioredoxin domain protein [Acidobacterium capsulatum
           ATCC 51196]
          Length = 334

 Score = 40.4 bits (93), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 90/241 (37%), Gaps = 30/241 (12%)

Query: 2   VMSTTRIGVLGGIVLLFIAS---------YFFYTRKGSAL--NELPIPDGVVDFRALLAA 50
           ++ T   GV    V++F+A           FF T  G  L  N+  IP G   F A  A 
Sbjct: 92  ILKTPAPGV--SKVIIFVAEKGRPQVAGLTFFVTPDGHYLIANDSIIPFGPHPFAAARAT 149

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
                     G       +VE+A   C HC        K + D        RY+ + FPL
Sbjct: 150 LQQDATGAWQGSASKQHELVEFADFQCPHCKAAQPTAKKLVAD----FPNARYVYQPFPL 205

Query: 111 DSVSTVAVMLA---RCAEKRMDG--GYWGFVSLLFNKQDDWINSKNYR--DALLNMAKFA 163
            +V   A   A    C   R+ G   ++ F   +F  Q+D +N    +  DA +     A
Sbjct: 206 VNVHPEAFKAADYGNCV-TRIGGNTAFFKFADSVFANQNDLVNDGGTKTLDAAVTA---A 261

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN-LYLGDMSEGVFSKII 222
           G        C         ++A  K A+E   ++ TP  F+ G  + + ++      KII
Sbjct: 262 GLDPAKVAACAASPAGKAAVQADLKLANE-LNVNETPTLFVDGRPVPMTELPYPELKKII 320

Query: 223 D 223
           +
Sbjct: 321 E 321


>gi|162455855|ref|YP_001618222.1| hypothetical protein sce7573 [Sorangium cellulosum 'So ce 56']
 gi|161166437|emb|CAN97742.1| hypothetical protein sce7573 [Sorangium cellulosum 'So ce 56']
          Length = 364

 Score = 40.4 bits (93), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 66/160 (41%), Gaps = 22/160 (13%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT--GKLRYILREFPLDSVSTV 116
            +G  DAP+T+VE+A   C  C     +    L +  +K   G++R + + +PL +    
Sbjct: 134 EMGPPDAPITIVEWADFECPFC-----RLMAPLLEGLVKRFDGQVRLVFKFYPLSAHVHG 188

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQD--DWINSKNYRDAL-LNMAKFAGFSKNDFDTC 173
                        G +W    LLF  QD  +  + + Y   L L+M KF    + D  + 
Sbjct: 189 EPAARAATAALNQGKFWEMHHLLFENQDKLEQADLERYAQRLKLDMVKF----RADLVST 244

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG---NLYL 210
                I  D     K  ++   ++ TP+ FI G   NL L
Sbjct: 245 DTKARIDKD-----KLQADGVGLEGTPLVFINGREVNLQL 279


>gi|148273667|ref|YP_001223228.1| hypothetical protein CMM_2484 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147831597|emb|CAN02565.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 305

 Score = 40.4 bits (93), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 71/182 (39%), Gaps = 19/182 (10%)

Query: 48  LAASPSTMKD-----VSIGQKDAPVTMVE-YASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           LAA+P+   D     V  G + A V  +  Y    C  C EF +     +E  ++++G  
Sbjct: 87  LAATPTKALDPEQDPVPTGSEAAGVAHIRVYVDYLCTACKEFQDTNGAQME-GWLQSGAA 145

Query: 102 RYILREFPLDSVSTVAVML-----ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
              +    + +  + A  L     A C        +W F S LF +Q    ++    D +
Sbjct: 146 TVEIHPVAILTSKSQAYSLRAANAAACVADSAPDDFWAFNSALFAEQPAEQSTGLSDDRI 205

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS-------TPVFFIGGNLY 209
           + +A  AG S +D   C++DQ     + A   R  +    DS        P+  +G   Y
Sbjct: 206 VELAGQAGASSSDIAKCVSDQRFQSWVNAATDRVLDGEIPDSNVDKVVGAPIIVVGDRQY 265

Query: 210 LG 211
            G
Sbjct: 266 TG 267


>gi|84684924|ref|ZP_01012824.1| 27 kDa outer membrane protein, putative [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667259|gb|EAQ13729.1| 27 kDa outer membrane protein, putative [Rhodobacterales bacterium
           HTCC2654]
          Length = 252

 Score = 40.4 bits (93), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 68/176 (38%), Gaps = 22/176 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVST-- 115
           G  D  VT+VE+    C +C     K F  +       G +R I +EFP+   +SV++  
Sbjct: 92  GNPDGDVTLVEFVDYRCGYC----RKAFPEINALLESDGNIRLIYKEFPILGQESVTSAR 147

Query: 116 --VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
             +A  LA       D  Y      L       + +    + L  MA   G+   +    
Sbjct: 148 FAIATKLAHG-----DEAYGEMHDALMT-----LRANATEEVLARMADDMGYDSQEILAK 197

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           + D  +   I+     A +   I  TP F +GG +  G +      +++ +  +DS
Sbjct: 198 MEDPEVNRQIEENHLLA-QRLEISGTPTFVLGGQMIRGYVPLEAMQEMVAAEREDS 252


>gi|222150255|ref|YP_002559408.1| thiol-disulfide oxidoreductase DsbD [Macrococcus caseolyticus
           JCSC5402]
 gi|222119377|dbj|BAH16712.1| thiol-disulfide oxidoreductase DsbD [Macrococcus caseolyticus
           JCSC5402]
          Length = 235

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 63/171 (36%), Gaps = 5/171 (2%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV-STVAV 118
           IG+ +A VT++E+    C  C  F       L+ KYI +GK +      P     S +  
Sbjct: 66  IGKDEAKVTIIEFGDFKCPACKVFELDIKPDLKKKYIDSGKAKLYFINTPFHGEGSMLGS 125

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           + A    K+    Y  F   LF  Q D    + +             + ++ D  + D  
Sbjct: 126 LAAETLIKQEPDKYSAFQQALFEMQPD--TEEEWLTIDAVKKAAKTAAVSNIDKLVKDVE 183

Query: 179 ILDDIKAGKKRAS--EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            L +  A KK  +  E   +  TP   + G      M      K+ID  ++
Sbjct: 184 ALKEKAAVKKDINLVEKHNVTMTPTIIVNGKEVKNPMDPAEVDKVIDEAVK 234


>gi|282896450|ref|ZP_06304471.1| DSBA oxidoreductase [Raphidiopsis brookii D9]
 gi|281198738|gb|EFA73618.1| DSBA oxidoreductase [Raphidiopsis brookii D9]
          Length = 252

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 10/100 (10%)

Query: 47  LLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR 106
           ++A SP+      IG       ++E++   C +C+E H KT K L +KY    +   + +
Sbjct: 87  VIANSPT------IGSSKLQTVLLEFSDFECPYCSEAH-KTLKNLLNKY--PNRFTLVYK 137

Query: 107 EFPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
            FPL  + S               G +W +   LF KQ+ 
Sbjct: 138 HFPLFQIHSQALPAARAAWAAHQQGKFWQYHDTLFTKQNQ 177


>gi|182439786|ref|YP_001827505.1| hypothetical protein SGR_5993 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326780450|ref|ZP_08239715.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
 gi|178468302|dbj|BAG22822.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326660783|gb|EGE45629.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
          Length = 172

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 61/162 (37%), Gaps = 6/162 (3%)

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APV +  +  + C  C    +   + L  +Y    ++R  LR FPLD             
Sbjct: 8   APVVLDLWCDLECPDCHRALDD-VRALRARYGDGVEIR--LRHFPLDKHKHAYAAAQAAE 64

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
           E    G  W ++  L ++  D    +     LL +A+  G    +FDT L D   L  + 
Sbjct: 65  EATDQGKGWPYIEALLSRTADL--GRTGEPVLLAVARELGLDAEEFDTALIDGRHLLIVD 122

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A          +  TP + IG     G  S+    + I+ ++
Sbjct: 123 ADHAEGKA-IGVTGTPTYVIGDERLDGGKSQDGLRERIEEIV 163


>gi|197124546|ref|YP_002136497.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
 gi|196174395|gb|ACG75368.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
          Length = 671

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 66/174 (37%), Gaps = 22/174 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DA VT+VE +   C +C +    T K +E+ Y   GK+R++ +  PL          
Sbjct: 62  GPADALVTIVESSDFQCPYC-KRGAATMKQVEEAY--RGKVRFVFKHNPLSFHPQAMPAA 118

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
               E R  GG   F +L     D   +S    D        A   K   +  L+   + 
Sbjct: 119 LAAEEARAQGGDEKFWAL----HDKLFDSAPALDQ-------AAIEKAAGELGLDVAKVR 167

Query: 181 DDIKAGKKRASED--------FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + ++AG  RA  +            +TP FF+ G    G      F  +ID  +
Sbjct: 168 EAMQAGTHRARIERDQKLVVGLGAPATPTFFVNGRKIAGAQPIEAFRAVIDEEL 221


>gi|330466080|ref|YP_004403823.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
 gi|328809051|gb|AEB43223.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
          Length = 238

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 56/134 (41%), Gaps = 10/134 (7%)

Query: 50  ASPSTMKD-VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI---- 104
           A P   +D   I     PVT+  Y    C  C +F   +   +E + +  GK R +    
Sbjct: 59  APPGATEDGTGIVVGSGPVTIDVYEDYLCPACKQFEQTSGATIE-QLVSDGKARVVYHPV 117

Query: 105 --LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
             L  F     ST A   + CA +   G +  F   LF+KQ     ++   + L+++   
Sbjct: 118 AYLNRFSSTQYSTRASAASGCAAE--GGKFTEFSKALFDKQPPENGAQLSDNELIDIGAE 175

Query: 163 AGFSKNDFDTCLND 176
            G +++ F +C+ D
Sbjct: 176 VGLNRDSFGSCVRD 189


>gi|75910703|ref|YP_324999.1| DSBA oxidoreductase [Anabaena variabilis ATCC 29413]
 gi|75704428|gb|ABA24104.1| DSBA oxidoreductase [Anabaena variabilis ATCC 29413]
          Length = 248

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 74/177 (41%), Gaps = 26/177 (14%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +A++  SP+T    S  Q  A V  VE++   C +CA+ H+ T K L  K+   G++  +
Sbjct: 83  QAVIGDSPTT----SATQSKAVV--VEFSDFQCPYCAKAHD-TLKQLLAKH--PGEITLV 133

Query: 105 LREFPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKF 162
            +  PL  + +               G +W +   LF       N K   + L L++AK 
Sbjct: 134 YKHLPLIPIHNEAMPAAKAAWAATQQGKFWEYHDALFT------NQKQLGETLYLDIAKK 187

Query: 163 AGFSKNDF--DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG--DMSE 215
                  F  D  L D  I  DI+  +K      AI  TP F +    + G  ++SE
Sbjct: 188 LNLDLEKFNSDRLLADAAISKDIQIAQK-----LAIAGTPFFIMNSKTFSGGIELSE 239


>gi|220919271|ref|YP_002494575.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957125|gb|ACL67509.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 671

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 66/174 (37%), Gaps = 22/174 (12%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DA VT+VE +   C +C +    T K +E+ Y   GK+R++ +  PL          
Sbjct: 62  GPADALVTIVESSDFQCPYC-KRGAATMKQVEEAY--RGKVRFVFKHNPLSFHPQAMPAA 118

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
               E R  GG   F +L     D   +S    D        A   K   +  L+   + 
Sbjct: 119 LAAEEARAQGGDEKFWAL----HDKLFDSAPALDQ-------AAIEKAAGELGLDVAKVR 167

Query: 181 DDIKAGKKRASED--------FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + ++AG  RA  +            +TP FF+ G    G      F  +ID  +
Sbjct: 168 EAMQAGTHRARIERDQKLVVGLGAPATPTFFVNGRKIAGAQPIEAFRAVIDEEL 221


>gi|315031466|gb|EFT43398.1| conserved hypothetical protein [Enterococcus faecalis TX0017]
          Length = 172

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 42/67 (62%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+++APV M+E+ ++ C +C ++  ++ + L  +++K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGERNAPVKMIEFINVRCPYCRKWFEESEELL-AQFVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|257083691|ref|ZP_05578052.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|256991721|gb|EEU79023.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
          Length = 176

 Score = 40.0 bits (92), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 42/67 (62%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+++APV M+E+ ++ C +C ++  ++ + L  +++K+GK+
Sbjct: 5   MDISVIDATKVNTETGLHIGERNAPVKMIEFINVRCPYCRKWFEESEELL-AQFVKSGKV 63

Query: 102 RYILREF 108
             I++ F
Sbjct: 64  ERIIKLF 70


>gi|315504345|ref|YP_004083232.1| dsba oxidoreductase [Micromonospora sp. L5]
 gi|315410964|gb|ADU09081.1| DSBA oxidoreductase [Micromonospora sp. L5]
          Length = 184

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 36/94 (38%), Gaps = 4/94 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P T +D   G  DAPVT+VEY    C  C   +    + L     +   +R + R FP+ 
Sbjct: 15  PVTERDHVRGPVDAPVTVVEYGDFQCRFCGAAYPNLAEVLRQ---RADMVRLVYRHFPIT 71

Query: 112 SVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
           +V                 G +W     L+  QD
Sbjct: 72  NVHPYAETAAETAEAAAARGRFWEMYDWLYQHQD 105


>gi|86160059|ref|YP_466844.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776570|gb|ABC83407.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 311

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
            +G   APVT+VE++  TC  C     +  +++E+     G+++ + + FP+++    A+
Sbjct: 141 PLGDAAAPVTLVEFSDFTCPFCRGLRPQLERFVEE---HAGRVKLVFKPFPIEA-HPGAL 196

Query: 119 MLARCAEKRMDGG-YWGFVSLLFNKQ 143
             A+  E   D G +W     LF  +
Sbjct: 197 EAAQAGEWARDQGVFWPLHDALFEAE 222


>gi|256044089|ref|ZP_05447000.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563449|ref|ZP_05833935.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|265990503|ref|ZP_06103060.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260153465|gb|EEW88557.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|263001287|gb|EEZ13862.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 204

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 59/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +  I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIGGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 191


>gi|269959125|ref|YP_003328914.1| putative disulfide oxidoreductase DsbA [Anaplasma centrale str.
           Israel]
 gi|269848956|gb|ACZ49600.1| putative disulfide oxidoreductase DsbA [Anaplasma centrale str.
           Israel]
          Length = 251

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 81/192 (42%), Gaps = 24/192 (12%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVS---IGQKDAPVTMVEYASMTCFHCAE 82
           ++  +A+NE        + R  +A +   + DVS    G +++ V +VE+   +C +C  
Sbjct: 55  SKGQAAMNE-------AEMRKRVAENRVALDDVSYPSFGNRESKVLLVEFFDFSCGYCKS 107

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
             +   + L+D     GK R + R+ P L   ST+A   AR A          +V   + 
Sbjct: 108 MLSHIKQLLDD-----GKARIVFRDLPALGEASTLA---ARAALAVHFINPEKYVDFYYA 159

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL--NDQNILDDIKAGKKRASEDFAIDST 199
             D   N +   D ++ +A+  G  + D    L  ND  I   I A +  A E   I  T
Sbjct: 160 ALDH--NKRFTDDGVVEIAESIGIKEEDLKKSLEQNDSKINAMINATRDLA-ERLNIGGT 216

Query: 200 PVFFIGGNLYLG 211
           P   +G  + +G
Sbjct: 217 PSVVVGDTVLVG 228


>gi|257415339|ref|ZP_05592333.1| conserved hypothetical protein [Enterococcus faecalis AR01/DG]
 gi|257157167|gb|EEU87127.1| conserved hypothetical protein [Enterococcus faecalis ARO1/DG]
          Length = 176

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 42/67 (62%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+++APV M+E+ ++ C +C ++  ++ + L  +++K+GK+
Sbjct: 5   MDISVIDATKVNTETGLHIGERNAPVKMIEFINVRCPYCRKWFEESEELL-AQFVKSGKV 63

Query: 102 RYILREF 108
             I++ F
Sbjct: 64  ERIIKLF 70


>gi|114330112|ref|YP_746334.1| DSBA oxidoreductase [Nitrosomonas eutropha C91]
 gi|114307126|gb|ABI58369.1| DSBA oxidoreductase [Nitrosomonas eutropha C91]
          Length = 219

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 63/150 (42%), Gaps = 11/150 (7%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK--LRYILREFPLDSVSTVA 117
           IG+ DAP+T+VE+   +C  C  F+    K +  KY    +  LRY+L  F   S  TV 
Sbjct: 56  IGRLDAPITIVEFFDPSCEGCRAFYPHV-KQILSKYPNDVRLVLRYVL--FHEGSEQTVR 112

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
           ++ A     R  G +   +  +   Q +W +      A    A   G ++    T + + 
Sbjct: 113 MLEA----ARKQGLFQPVLEAILEAQPEWHDDPKV-TAAWRAAVRVGLNEGRARTDIQEA 167

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            I   IK  +   +    I  TP FF+ G 
Sbjct: 168 AISALIKMDEADVNA-VGIKGTPTFFVDGK 196


>gi|89071341|ref|ZP_01158486.1| 27 kDa outer membrane protein, putative [Oceanicola granulosus
           HTCC2516]
 gi|89043154|gb|EAR49395.1| 27 kDa outer membrane protein, putative [Oceanicola granulosus
           HTCC2516]
          Length = 249

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 66/154 (42%), Gaps = 14/154 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVM 119
           G  D  VT+VE+    C +C   H +    +E+     G +R++++EFP L   ST++  
Sbjct: 89  GNPDGDVTLVEFVDYRCGYCRRAHAE----VEELLASDGNIRFVVKEFPILGEGSTLSSQ 144

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKFAGFSKNDFDTCLNDQ 177
            A  A K++ G      +   N  D  I  ++  D  +L  +A+  G   ++    +   
Sbjct: 145 FA-IAVKQLHGD-----AAYKNVHDALITLRSDADEPSLRRLAEGFGLEADEIFARMGSD 198

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            + D+I   +  A     I  TP F +   +  G
Sbjct: 199 EVADEINETRALAQR-LQITGTPTFVLEDQMLRG 231


>gi|17987844|ref|NP_540478.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|17983573|gb|AAL52742.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
          Length = 197

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 59/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 38  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 93

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 94  RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 146

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +  I     +  E F    TP F IG  LY G M E
Sbjct: 147 KRIGGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 184


>gi|332706392|ref|ZP_08426454.1| protein-disulfide isomerase [Lyngbya majuscula 3L]
 gi|332354829|gb|EGJ34307.1| protein-disulfide isomerase [Lyngbya majuscula 3L]
          Length = 252

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 68/169 (40%), Gaps = 20/169 (11%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +A + +SP+T      G  +  + +VE++   C  CA  H+   +++ +      ++  +
Sbjct: 87  QAFIGSSPAT------GSTEDKIVLVEFSDFQCPFCARAHDTVNQFIAN---HGDEVTLV 137

Query: 105 LREFPLDSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKF 162
            + FPL S+ S               G +W +   LF       N K   + L L +A+ 
Sbjct: 138 YKHFPLTSIHSQALPAAQAAWAATQQGKFWQYHDALF------ANQKQLGEELYLAIAQD 191

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
                 +F+    D+N  D   A   + +E   +  TP F + G  + G
Sbjct: 192 LNLDLEEFN---RDRNAADRAIAEDMQLAEILGLSGTPFFVMNGEAFSG 237


>gi|56416462|ref|YP_153536.1| hypothetical protein AM139 [Anaplasma marginale str. St. Maries]
 gi|254994689|ref|ZP_05276879.1| hypothetical protein AmarM_00570 [Anaplasma marginale str.
           Mississippi]
 gi|255002805|ref|ZP_05277769.1| hypothetical protein AmarPR_00530 [Anaplasma marginale str. Puerto
           Rico]
 gi|255003937|ref|ZP_05278738.1| hypothetical protein AmarV_00540 [Anaplasma marginale str.
           Virginia]
 gi|56387694|gb|AAV86281.1| hypothetical protein AM139 [Anaplasma marginale str. St. Maries]
          Length = 251

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 91/216 (42%), Gaps = 36/216 (16%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
           ++  +A+NE  +   V + RA L      +   S G +++ V +VE+   +C +C    +
Sbjct: 55  SKGQAAMNEAEMRKKVAENRAAL----DDVSYPSFGNRESKVLLVEFFDFSCGYCKSMLS 110

Query: 86  KTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCA-----EKRMDGGYWGFVSLL 139
              + LED     GK R + R+ P L   ST+A   A        EK +D   + + +L 
Sbjct: 111 HIKQLLED-----GKARIVFRDLPALGEASTLAARAALAVHFINPEKYVD---FYYAALG 162

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL--NDQNILDDIKAGKKRASEDFAID 197
            NK       +   D ++ +A+  G    D    L  N   I   I A +  A E   I 
Sbjct: 163 HNK-------RFTDDGVVEIAESIGVKGEDLKKSLEQNGSKINAMIDATRGLA-ERLNIG 214

Query: 198 STPVFFIGGNLYLG--DMSEGVFSKIIDSMIQDSTR 231
            TP   IG  + +G  D+      + +  +IQ +TR
Sbjct: 215 GTPSVVIGDTVLVGVSDL------QTLRDLIQGATR 244


>gi|306842341|ref|ZP_07475000.1| DSBA oxidoreductase [Brucella sp. BO2]
 gi|306287557|gb|EFM59016.1| DSBA oxidoreductase [Brucella sp. BO2]
          Length = 204

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 59/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  V +VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVAIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGENSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +D I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIDGILQRNMKQGEAFNFGGTPSFVIGTRLYGGVMKE 191


>gi|163795156|ref|ZP_02189124.1| putative outer membrane protein [alpha proteobacterium BAL199]
 gi|159179554|gb|EDP64083.1| putative outer membrane protein [alpha proteobacterium BAL199]
          Length = 250

 Score = 40.0 bits (92), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 60/155 (38%), Gaps = 11/155 (7%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  +G  +  VT+VE+    C +C        + +       G +R +L+EFP+   +++
Sbjct: 88  DPVLGNPNGDVTVVEFFDYQCGYCKTMMAPLMELVHGD----GNIRLVLKEFPILGPASL 143

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
               A  A   M G Y  F   L       +  +    A+   A  AG   +     + D
Sbjct: 144 VAARASLA-ANMQGKYEPFHVTLMG-----LRGRLSEGAIWQAASEAGLDLDRLKKDMED 197

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             +   I A  + A +   I+ TP F IG  +  G
Sbjct: 198 PAVTATIDANYQLA-QALQIEGTPAFTIGQTVVPG 231


>gi|120556184|ref|YP_960535.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
 gi|120326033|gb|ABM20348.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
          Length = 212

 Score = 40.0 bits (92), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 60/157 (38%), Gaps = 23/157 (14%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           IG +DAPVT+VE+   +C  C   H    K ++  Y     +R +LR       S  AV 
Sbjct: 50  IGPEDAPVTIVEFFDPSCEGCRAMH-PYVKQIQAAY--PDNVRLVLRYVLFHKGSEEAVR 106

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM--------AKFAGFSKNDFD 171
           +   A  R  G Y   +  +   Q  W +      A            A  AG +  + D
Sbjct: 107 ILETA--REQGIYEPVLDAVMEAQPKWHDDPKVTAAWDAAASAGLDVEAARAGMNSPEID 164

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
             +  Q    D+KA          I  TP F++ G++
Sbjct: 165 GII--QQDAADVKA--------VGISGTPTFYVNGDI 191


>gi|162448783|ref|YP_001611150.1| disulfide bond formation protein D precursor [Sorangium cellulosum
           'So ce 56']
 gi|161159365|emb|CAN90670.1| possible Disulfide bond formation protein D precursor [Sorangium
           cellulosum 'So ce 56']
          Length = 853

 Score = 40.0 bits (92), Expect = 0.29,   Method: Composition-based stats.
 Identities = 44/180 (24%), Positives = 69/180 (38%), Gaps = 10/180 (5%)

Query: 47  LLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR 106
           +LA +P+        +  A VT+  +A   C  C      T   +   Y   GK+R + R
Sbjct: 478 ILAPAPTRDNPGKGAKPGAKVTIQMFADFECPFCMRVQ-ATIDGIIAAY--PGKVRVVFR 534

Query: 107 EFPLDSVSTVAVMLARCAE---KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
             PL S S   +      E   ++ + G+W     L+  Q +   +   R+AL   A   
Sbjct: 535 HLPLPSHSRAPLAAEASIEAFRQKGEAGFWAMAQRLWQDQSE---NGLGREALERHAAAI 591

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G     F   L+       ++A +K A E   I  TP F I      G  S   F +++D
Sbjct: 592 GLDVAKFGAALDSGAHRAAVEADRKLA-ERLHITGTPSFAINDYFLGGAQSTRHFKRLVD 650


>gi|225851910|ref|YP_002732143.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
 gi|256264580|ref|ZP_05467112.1| DSBA oxidoreductase [Brucella melitensis bv. 2 str. 63/9]
 gi|225640275|gb|ACO00189.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
 gi|263094944|gb|EEZ18652.1| DSBA oxidoreductase [Brucella melitensis bv. 2 str. 63/9]
          Length = 204

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 59/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 45  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 101 RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 153

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +  I     +  E F    TP F IG  LY G M E
Sbjct: 154 KRIGGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 191


>gi|254830172|ref|ZP_05234827.1| hypothetical protein Lmon1_02385 [Listeria monocytogenes 10403S]
          Length = 176

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 79/169 (46%), Gaps = 17/169 (10%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS-TV 116
           + +G+K APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S   
Sbjct: 17  IHVGEKAAPVKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKESLQR 75

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
             +  R  +          ++ +++KQD+W          L++ + A + +++    L +
Sbjct: 76  GNVTHRYLDYSTPEKTRETINKIYSKQDEW--------GSLSLDEVATYMESELG--LTE 125

Query: 177 QNILDDIKAGKKRASEDFAIDS--TPVFFIGGNLYLGDMSEGVFSKIID 223
           Q   D+  A +K  +E  A +    P   +G +++   +S      ++D
Sbjct: 126 Q---DNKAASEKIVAEANAANVVFVPTIIVGEHIFDEHISPEELRSLLD 171


>gi|256112884|ref|ZP_05453805.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|265994331|ref|ZP_06106888.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|262765444|gb|EEZ11233.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
          Length = 175

 Score = 39.7 bits (91), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 59/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 16  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 71

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 72  RLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 124

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +  I     +  E F    TP F IG  LY G M E
Sbjct: 125 KRIGGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 162


>gi|257884387|ref|ZP_05664040.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257820225|gb|EEV47373.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
          Length = 173

 Score = 39.7 bits (91), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T K +  G  +AP  MVE+ ++ C +C ++  +++  LE+  +++G+L
Sbjct: 1   MDISVIDATKTNTQKGILYGSSNAPKKMVEFINLACPYCRQWFEESYDLLEE-AVQSGQL 59

Query: 102 RYILREF 108
           + +++ F
Sbjct: 60  QRVIKLF 66


>gi|58584639|ref|YP_198212.1| protein-disulfide isomerase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58418955|gb|AAW70970.1| Protein-disulfide isomerase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 252

 Score = 39.7 bits (91), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 31/168 (18%), Positives = 78/168 (46%), Gaps = 12/168 (7%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G +++ +  V +   +C +C    +   + + D     GK++YI R+ P+   +++   
Sbjct: 90  LGNENSNIIAVGFFDYSCGYCKAIKDDIKQLIND-----GKIKYIFRDTPILGNNSLKAA 144

Query: 120 LARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL-NDQ 177
            +  A   +D G Y+ F   + + + ++ +     + +L++ K  G ++++F+  + N+ 
Sbjct: 145 KSALAVYFIDKGKYFDFHYAILDHKGEFSD-----ENILDIVKSIGINEDNFNNSMKNNA 199

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
             ++ +    K    +     TP   IG +L++G     V  K +D +
Sbjct: 200 GKIEQMINDSKFLVRELGAGGTPFLIIGDSLFIGATDLDVLRKKVDEL 247


>gi|16803099|ref|NP_464584.1| hypothetical protein lmo1059 [Listeria monocytogenes EGD-e]
 gi|47096148|ref|ZP_00233748.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224502627|ref|ZP_03670934.1| hypothetical protein LmonFR_08919 [Listeria monocytogenes FSL
           R2-561]
 gi|254828436|ref|ZP_05233123.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254898768|ref|ZP_05258692.1| hypothetical protein LmonJ_03095 [Listeria monocytogenes J0161]
 gi|254911743|ref|ZP_05261755.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936069|ref|ZP_05267766.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|255028502|ref|ZP_05300453.1| hypothetical protein LmonL_03546 [Listeria monocytogenes LO28]
 gi|284801391|ref|YP_003413256.1| hypothetical protein LM5578_1142 [Listeria monocytogenes 08-5578]
 gi|284994533|ref|YP_003416301.1| hypothetical protein LM5923_1096 [Listeria monocytogenes 08-5923]
 gi|16410461|emb|CAC99137.1| lmo1059 [Listeria monocytogenes EGD-e]
 gi|47015497|gb|EAL06430.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258600832|gb|EEW14157.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258608659|gb|EEW21267.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284056953|gb|ADB67894.1| hypothetical protein LM5578_1142 [Listeria monocytogenes 08-5578]
 gi|284060000|gb|ADB70939.1| hypothetical protein LM5923_1096 [Listeria monocytogenes 08-5923]
 gi|293589694|gb|EFF98028.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 176

 Score = 39.7 bits (91), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS-TV 116
           + +G+K APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S   
Sbjct: 17  IHVGEKAAPVKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKESLQR 75

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDW 146
             +  R  +          ++ +++KQD+W
Sbjct: 76  GNVTHRYLDYSTPEKTRETINKIYSKQDEW 105


>gi|46198553|ref|YP_004220.1| hypothetical protein TTC0245 [Thermus thermophilus HB27]
 gi|46196175|gb|AAS80593.1| hypothetical conserved protein [Thermus thermophilus HB27]
          Length = 287

 Score = 39.7 bits (91), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 55/147 (37%), Gaps = 14/147 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV- 118
           +G+K   V +  ++   C +C     +    L+    + G+LR   R FPL  +   AV 
Sbjct: 131 LGEKG--VVVRVFSDFQCPYCQRLAREVLPALK-AMAREGRLRLAYRHFPLYEIHPEAVP 187

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                      G +W +  LL      W    +Y      +A+  G     F  CL D  
Sbjct: 188 AAVASECAAAQGAFWAYHDLLMAG-SGW----DYP----ALARRLGLDPKAFQACLEDPA 238

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIG 205
               ++A +  A E   +  TP  F+G
Sbjct: 239 SRAPVEADRALA-ERLGLPGTPSVFVG 264


>gi|255027314|ref|ZP_05299300.1| hypothetical protein LmonocytFSL_14963 [Listeria monocytogenes FSL
           J2-003]
          Length = 176

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS-TV 116
           + +G+K APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S   
Sbjct: 17  IHVGEKAAPVKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKESLQR 75

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDW 146
             +  R  +          ++ +++KQD+W
Sbjct: 76  GNVTHRYLDYSTPEKTRETINKIYSKQDEW 105


>gi|319893738|ref|YP_004150613.1| Protein-disulfide isomerase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317163434|gb|ADV06977.1| Protein-disulfide isomerase [Staphylococcus pseudintermedius
           HKU10-03]
          Length = 229

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 66/171 (38%), Gaps = 20/171 (11%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL--RYILREF 108
           +  T    + G+KD+ V +VE+    C +C +F       LE +YI   K+  RY+    
Sbjct: 42  AAETQMQPTQGKKDSKVLLVEFGDFKCPYCGDFERNIKPKLEKEYIDNNKVEFRYV-NVL 100

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ---DDWINSKNY-RDALLNMAKFAG 164
                S +    A    +     YW F   LF +Q    D + S+++  D L+       
Sbjct: 101 IHGEESELGAKAALAVNQYAPDKYWQFHHALFEQQPNNKDDVGSQHWLTDDLIQQQ---- 156

Query: 165 FSKNDFDTCLNDQNIL---DDIKAGKKRASEDFAIDS------TPVFFIGG 206
             K D       Q  +   D+  A  KRA ED A+         P  ++ G
Sbjct: 157 LQKLDLSEQERKQITVAYRDEKGAIAKRAQEDHALAKKEEVPYVPALYVNG 207


>gi|222474831|ref|YP_002563246.1| disulfide oxidoreductase [Anaplasma marginale str. Florida]
 gi|222418967|gb|ACM48990.1| disulfide oxidoreductase [Anaplasma marginale str. Florida]
          Length = 251

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 89/212 (41%), Gaps = 36/212 (16%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
           +A+NE  +   V + RA L      +   S G +++ V +VE+   +C +C    +   +
Sbjct: 59  AAMNEAEMRKKVAENRAAL----DDVSYPSFGNRESRVLLVEFFDFSCGYCKSMLSHIKQ 114

Query: 90  YLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCA-----EKRMDGGYWGFVSLLFNKQ 143
            LED     GK R + R+ P L   ST+A   A        EK +D   + + +L  NK 
Sbjct: 115 LLED-----GKARIVFRDLPALGEASTLAARAALAVHFINPEKYVD---FYYAALGHNK- 165

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCL--NDQNILDDIKAGKKRASEDFAIDSTPV 201
                 +   D ++ +A+  G    D    L  N   I   I A +  A E   I  TP 
Sbjct: 166 ------RFTDDGVVEIAESIGVKGEDLKKSLEQNGSKINAMIDATRGLA-ERLNIGGTPS 218

Query: 202 FFIGGNLYLG--DMSEGVFSKIIDSMIQDSTR 231
             IG  + +G  D+      + +  +IQ +TR
Sbjct: 219 VVIGDTVLVGVSDL------QTLRDLIQGATR 244


>gi|25026869|ref|NP_736923.1| hypothetical protein CE0313 [Corynebacterium efficiens YS-314]
 gi|259506068|ref|ZP_05748970.1| protein-disulfide isomerase [Corynebacterium efficiens YS-314]
 gi|23492149|dbj|BAC17123.1| hypothetical protein [Corynebacterium efficiens YS-314]
 gi|259166356|gb|EEW50910.1| protein-disulfide isomerase [Corynebacterium efficiens YS-314]
          Length = 253

 Score = 39.7 bits (91), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 64/162 (39%), Gaps = 3/162 (1%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV +V ++   C +CA++  +T   +  ++ + G LR   R+  L   ++  
Sbjct: 82  LAVGPVDAPVGLVIFSDYQCPYCAKWSAETLPLML-EHAEAGDLRIEWRDLNLFGPASER 140

Query: 118 VMLARCAEKRMDG-GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
              A  A     G  Y  +   LF       +++   D L+ +A   G     F      
Sbjct: 141 ASRAAYAAALQGGDAYLDYHHALFKDGTSRSDNELDDDQLIALAHTLGLDTEAFTADFTS 200

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
                 + A   +      + STP F +GG   +G     VF
Sbjct: 201 PETAGTVAA-HAQLGITLGVYSTPAFILGGQPIMGAQPSEVF 241


>gi|55980579|ref|YP_143876.1| hypothetical protein TTHA0610 [Thermus thermophilus HB8]
 gi|55771992|dbj|BAD70433.1| conserved hypothetical protein [Thermus thermophilus HB8]
          Length = 287

 Score = 39.7 bits (91), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 55/147 (37%), Gaps = 14/147 (9%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV- 118
           +G+K   V +  ++   C +C     +    L+    + G+LR   R FPL  +   AV 
Sbjct: 131 LGEKG--VVVRVFSDFQCPYCQRLAREVLPALK-AMAREGRLRLAYRHFPLYEIHPEAVP 187

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                      G +W +  LL      W    +Y      +A+  G     F  CL D  
Sbjct: 188 AAVASECAAAQGAFWAYHDLLMAG-SGW----DYP----ALARRLGLDPKAFQACLEDPA 238

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIG 205
               ++A +  A E   +  TP  F+G
Sbjct: 239 SRAPVEADRALA-ERLGLPGTPSVFVG 264


>gi|326408407|gb|ADZ65472.1| DSBA oxidoreductase [Brucella melitensis M28]
 gi|326538121|gb|ADZ86336.1| DSBA oxidoreductase [Brucella melitensis M5-90]
          Length = 203

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 59/158 (37%), Gaps = 13/158 (8%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H    + +     K G +R +++++ +    S  A 
Sbjct: 44  LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVR----KDGNVRLVMKDWIIFGETSAYAA 99

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQ 177
            L   AEK   G Y   +  L          +  RD +    K AG            D 
Sbjct: 100 SLVLAAEK--SGNYEKAMEALMT-----TPGRLTRDQVDGALKKAGLDAAKLQAAYKADA 152

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
             +  I     +  E F    TP F IG  LY G M E
Sbjct: 153 KRIGGILQRNMKQGEAFNFAGTPSFVIGTRLYGGVMKE 190


>gi|255326076|ref|ZP_05367163.1| DsbA oxidoreductase [Rothia mucilaginosa ATCC 25296]
 gi|255296787|gb|EET76117.1| DsbA oxidoreductase [Rothia mucilaginosa ATCC 25296]
          Length = 256

 Score = 39.3 bits (90), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 56/148 (37%), Gaps = 9/148 (6%)

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T   Y    C +CA+   K   + E      G +   +R  PL+  +             
Sbjct: 93  TATLYTDYQCPYCAKAEPK---FEEAAKKLDGIMNVTVRHMPLNMHANAVPAALAVEAAT 149

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNM----AKFAGFSKNDFDTCLNDQNILDDI 183
             G +    + LFN Q+DW N K  RD L  +    AK  G +  +FD  L   + +  I
Sbjct: 150 AQGKHLEMANKLFNTQNDWKNIKE-RDKLRTLFNDYAKELGLNVEEFDKTLVASDTVKPI 208

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           +   + A +   +  TP F +   +  G
Sbjct: 209 QRDYEHAVK-IGVKGTPTFVVNDKVVEG 235


>gi|83951919|ref|ZP_00960651.1| 27 kDa outer membrane protein, putative [Roseovarius nubinhibens
           ISM]
 gi|83836925|gb|EAP76222.1| 27 kDa outer membrane protein, putative [Roseovarius nubinhibens
           ISM]
          Length = 248

 Score = 39.3 bits (90), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 65/154 (42%), Gaps = 14/154 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +  +T+VE+    C +C     + F  +++     G +R+I++EFP+  +   +VM 
Sbjct: 89  GNPEGDITIVEFLDYRCGYC----KRAFGEVKELLETDGNIRFIVKEFPI--LGEASVMA 142

Query: 121 ARCA-EKRMDGGYWGFVSLLFNKQDDWI--NSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
           +R A   +++ G   + SL     D  +  N      AL  +A   G   +     + D+
Sbjct: 143 SRFAIATKLEAGDEAYESL----HDGLMAFNGDITEAALKRLATSFGLDADAIAARMEDE 198

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            + + I      A     I  TP F +G  +  G
Sbjct: 199 EVSEAIAQNHALAGA-LQITGTPTFVMGDQMVRG 231


>gi|328956748|ref|YP_004374134.1| thiol-disulfide oxidoreductase [Carnobacterium sp. 17-4]
 gi|328673072|gb|AEB29118.1| thiol-disulfide oxidoreductase [Carnobacterium sp. 17-4]
          Length = 182

 Score = 39.3 bits (90), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 55/115 (47%), Gaps = 2/115 (1%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
           ++D   + A   +T   + IG  DAPV ++E+ ++ C +C  ++  +   L + Y+  GK
Sbjct: 7   LMDISNIKADKVNTAYGIKIGSDDAPVKVIEFINLKCPYCKMWYEDSKDVLTE-YVFAGK 65

Query: 101 LRYILREFPLDSVS-TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           ++ I++ F  +  S     ++ R  +          +   F  QD+W N +++ D
Sbjct: 66  VQRIIKHFDKEKPSLKKGNIVHRYLDYSNPEKALEDIDFFFAHQDEWGNLESFDD 120


>gi|37521061|ref|NP_924438.1| hypothetical protein glr1492 [Gloeobacter violaceus PCC 7421]
 gi|35212057|dbj|BAC89433.1| glr1492 [Gloeobacter violaceus PCC 7421]
          Length = 261

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 70/167 (41%), Gaps = 15/167 (8%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           ++G  DA +T+VE++   C +C+   + T K L +KY   G++R +    PL   S    
Sbjct: 99  TLGPADAALTLVEFSDFQCPYCSRAQS-TVKALLEKY--KGRIRLVYLHLPLPVHSQAKA 155

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWIN---SKNYRDALLNMAKFAGFSKNDFDTCLN 175
                      G ++ +   LF   +  +     +  R+  L++A+F      D ++   
Sbjct: 156 AALAAFAAGEQGKFFAYHDRLFALGEQLVPESFEQIARELNLDVARF----NRDRESPQA 211

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
              +  D+   ++       +D+TP F + G +  G +    F + I
Sbjct: 212 LARLEADLAQARR-----LELDATPSFVLNGIVLKGALPIEEFEEAI 253


>gi|84496057|ref|ZP_00994911.1| hypothetical protein JNB_01020 [Janibacter sp. HTCC2649]
 gi|84382825|gb|EAP98706.1| hypothetical protein JNB_01020 [Janibacter sp. HTCC2649]
          Length = 228

 Score = 39.3 bits (90), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/143 (18%), Positives = 56/143 (39%), Gaps = 7/143 (4%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLED-KYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           V +VE+    C  C       F  +E+ +    GK+ +++R FP+DS +           
Sbjct: 71  VVLVEFLDFECESC----RAAFPVVEELRATYAGKVDFVVRYFPIDSHANAVNSAVAVEA 126

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN-MAKFAGFSKNDFDTCLNDQNILDDIK 184
                 +      ++  Q  W   +  + ++    A+  G     +D  + D+  L+ ++
Sbjct: 127 AAQQDKFEEMYKRMYETQAAWGEQRESKASVFRGFAQELGLDMAAYDKAVADKATLERVE 186

Query: 185 AGKKRASEDFAIDSTPVFFIGGN 207
             ++    D  +  TP FF+ G 
Sbjct: 187 RDRQDGL-DLGVQGTPTFFLNGK 208


>gi|296269433|ref|YP_003652065.1| protein-disulfide isomerase-like protein [Thermobispora bispora DSM
           43833]
 gi|296092220|gb|ADG88172.1| Protein-disulfide isomerase-like protein [Thermobispora bispora DSM
           43833]
          Length = 247

 Score = 39.3 bits (90), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 60/151 (39%), Gaps = 12/151 (7%)

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR---YILREF---PLDSVSTVA 117
           +APV  V Y    C  C EF   +   L++   K GK +   ++L  F   P  S S  A
Sbjct: 80  EAPVVDV-YEDFQCPVCKEFGKTSGSTLKN-LAKEGKAKVVYHVLTIFGQDPTRSNSIRA 137

Query: 118 VMLARCAEKRMDGGYW-GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
              ARC     DG  W  +   L+ +Q     S    D L+   K  G +   F++C+ D
Sbjct: 138 AAAARCV---TDGVKWMEYHEKLYEEQPRETVSGFAIDDLVKWGKEVGITDPGFESCVRD 194

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
           Q    + +   ++      I  TP   + G 
Sbjct: 195 QKHAAEHEKYSEQTINSAQIGGTPTVKVNGQ 225


>gi|224500298|ref|ZP_03668647.1| hypothetical protein LmonF1_11759 [Listeria monocytogenes Finland
           1988]
          Length = 176

 Score = 39.3 bits (90), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS-TV 116
           + +G+K AP+ ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S   
Sbjct: 17  IHVGEKAAPIKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKESLQR 75

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDW 146
             +  R  +          ++ +++KQD+W
Sbjct: 76  GNVTHRYLDYSTPEKTRETINKIYSKQDEW 105


>gi|256959900|ref|ZP_05564071.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256950396|gb|EEU67028.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
          Length = 155

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  +++K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQFVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|304406113|ref|ZP_07387770.1| DSBA oxidoreductase [Paenibacillus curdlanolyticus YK9]
 gi|304344697|gb|EFM10534.1| DSBA oxidoreductase [Paenibacillus curdlanolyticus YK9]
          Length = 244

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 58/153 (37%), Gaps = 6/153 (3%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTV 116
            ++G KDA V +VE+    C  C  F       L+ +YI  G +      +P +   S  
Sbjct: 64  ATLGSKDAKVKIVEFGDFKCPACQVFSQDVEPQLKAEYIDKGLVSLSFMNYPFIGPDSRT 123

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A +       + +  +W +   L+  Q +        D L+ +A+       DFD   +D
Sbjct: 124 AALAGLSVYHQNNDAFWKYYDALYKNQPNESEIWATPDYLVQLAQSEKLDI-DFDKLRSD 182

Query: 177 ---QNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
              +   D +     R  +   +  TP  F+ G
Sbjct: 183 IENETYADQLSDQMSRV-KPLGVTGTPTLFVNG 214


>gi|293384731|ref|ZP_06630585.1| conserved hypothetical protein [Enterococcus faecalis R712]
 gi|293387457|ref|ZP_06632009.1| conserved hypothetical protein [Enterococcus faecalis S613]
 gi|312908570|ref|ZP_07767513.1| conserved hypothetical protein [Enterococcus faecalis DAPTO 512]
 gi|312910495|ref|ZP_07769340.1| conserved hypothetical protein [Enterococcus faecalis DAPTO 516]
 gi|291077981|gb|EFE15345.1| conserved hypothetical protein [Enterococcus faecalis R712]
 gi|291083108|gb|EFE20071.1| conserved hypothetical protein [Enterococcus faecalis S613]
 gi|310625456|gb|EFQ08739.1| conserved hypothetical protein [Enterococcus faecalis DAPTO 512]
 gi|311289191|gb|EFQ67747.1| conserved hypothetical protein [Enterococcus faecalis DAPTO 516]
          Length = 172

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  +++K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQFVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|257081031|ref|ZP_05575392.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|307289537|ref|ZP_07569482.1| hypothetical protein HMPREF9505_02899 [Enterococcus faecalis
           TX0109]
 gi|256989061|gb|EEU76363.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|306499498|gb|EFM68870.1| hypothetical protein HMPREF9505_02899 [Enterococcus faecalis
           TX0109]
 gi|315164640|gb|EFU08657.1| conserved hypothetical protein [Enterococcus faecalis TX1302]
          Length = 172

 Score = 39.3 bits (90), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  +++K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQFVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|302869178|ref|YP_003837815.1| DSBA oxidoreductase [Micromonospora aurantiaca ATCC 27029]
 gi|302572037|gb|ADL48239.1| DSBA oxidoreductase [Micromonospora aurantiaca ATCC 27029]
          Length = 184

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 35/94 (37%), Gaps = 4/94 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P T +D   G  DAPVT+VEY    C  C   +    + L     +   +R   R FP+ 
Sbjct: 15  PVTERDHVRGPVDAPVTIVEYGDFQCRFCGAAYPNLTEVLRQ---RADTVRLAYRHFPIT 71

Query: 112 SVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
           +V                 G +W     L+  QD
Sbjct: 72  NVHPYAESAAETAEAAAARGRFWEMYDWLYQHQD 105


>gi|322433276|ref|YP_004210497.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
 gi|321165668|gb|ADW71370.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
          Length = 178

 Score = 38.9 bits (89), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 66/179 (36%), Gaps = 16/179 (8%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P + +D   G   A  ++VEY    C  C E      + L+  +    ++ ++ R FPL 
Sbjct: 7   PVSTQDHLQGDPHAACSLVEYGDYECPSCGEVQ-PIIQSLQRHF--GNQMSFVFRNFPLR 63

Query: 112 SVST-VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
            +                 G +W   +LLF  Q+D          L  +    G S+   
Sbjct: 64  EIHPWAEAAAEVAELAGSQGKFWEMHNLLFQHQEDL-----SEGGLQQLVSRMGLSEKKM 118

Query: 171 DTCLNDQNILDDIK---AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
                +  +   I+   AG  R+     ++ TP FF+ G+   G       + ++D ++
Sbjct: 119 QQASMNGMLRKKIEADLAGGIRS----GVNGTPTFFLNGDRCDGPTDFNSLASLMDQVL 173


>gi|84496045|ref|ZP_00994899.1| hypothetical protein JNB_00960 [Janibacter sp. HTCC2649]
 gi|84382813|gb|EAP98694.1| hypothetical protein JNB_00960 [Janibacter sp. HTCC2649]
          Length = 222

 Score = 38.9 bits (89), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 57/142 (40%), Gaps = 5/142 (3%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           V +VE+    C  C   +    + L   Y   GK+ +++R FP+ S +            
Sbjct: 65  VVLVEFLDFECESCLAAY-PVVEELRTTY--AGKVDFVVRYFPIPSHANAMNAAVAVEAA 121

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALL-NMAKFAGFSKNDFDTCLNDQNILDDIKA 185
              G +      +++ Q+ W   ++ + +L    A+  G     +D  +  +   D ++ 
Sbjct: 122 AQQGKFEDMYKRMYDTQETWGEQQDSKASLFRGFAQELGLDMAAYDKAVAAKATTDRVER 181

Query: 186 GKKRASEDFAIDSTPVFFIGGN 207
            +K    D  ++ TP FF+ G 
Sbjct: 182 DRKDGI-DLGVEGTPTFFLNGK 202


>gi|331698135|ref|YP_004334374.1| DSBA oxidoreductase [Pseudonocardia dioxanivorans CB1190]
 gi|326952824|gb|AEA26521.1| DSBA oxidoreductase [Pseudonocardia dioxanivorans CB1190]
          Length = 234

 Score = 38.9 bits (89), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 54/142 (38%), Gaps = 5/142 (3%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT VE+    C  C      T + L   Y    ++ +++R FPL + +            
Sbjct: 72  VTFVEFLDFECEACGALF-PTVEQLRRDY--GDRVTFVVRYFPLPNHTNAERAARAVEAA 128

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLN-MAKFAGFSKNDFDTCLNDQNILDDIKA 185
              G +    +++F +Q +W   +  +D +    A   G     +D        LD ++A
Sbjct: 129 AQQGRFEQMYTVMFERQTEWGEQQEPKDDVFRGYAAELGLDMPAWDRAYAAPTTLDRVRA 188

Query: 186 GKKRASEDFAIDSTPVFFIGGN 207
                +    +  TP FF+ GN
Sbjct: 189 DVADGTT-LGVAGTPSFFLDGN 209


>gi|126725490|ref|ZP_01741332.1| 27kDa outer membrane protein [Rhodobacterales bacterium HTCC2150]
 gi|126704694|gb|EBA03785.1| 27kDa outer membrane protein [Rhodobacterales bacterium HTCC2150]
          Length = 242

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 31/155 (20%), Positives = 61/155 (39%), Gaps = 17/155 (10%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  +  VT+VE+    C +C     K F  +++   +  +LR + RE+P+ S ++V   
Sbjct: 83  LGNPEGDVTLVEFFDYNCGYC----KKAFNVMQELIAEDPELRVVFREWPILSEASVFAT 138

Query: 120 LARCAEKRMDGG---YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
            A  A +  D     +W  ++          N     + ++ +A   G         +  
Sbjct: 139 RASLAAREQDKYEEFHWALMAG---------NGARSENGVMAVAAEVGLDIAQLKEDMQK 189

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            ++   I   ++ A +      TP F +G  L  G
Sbjct: 190 TSVDAHISLSREMA-QSLGFSGTPSFVVGNQLVPG 223


>gi|320353410|ref|YP_004194749.1| DSBA oxidoreductase [Desulfobulbus propionicus DSM 2032]
 gi|320121912|gb|ADW17458.1| DSBA oxidoreductase [Desulfobulbus propionicus DSM 2032]
          Length = 287

 Score = 38.9 bits (89), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 86/231 (37%), Gaps = 37/231 (16%)

Query: 20  ASYFFYTRKGSALNELPIPDGV--VDFRA-----LLA---ASPSTMKDVSIGQK------ 63
           A  + +T  G  L  LP+  GV  +D  A      LA   A   T  DVS  QK      
Sbjct: 64  AKVYIFTPDGKQLGVLPVDQGVSAIDIAARGEMLYLANEKAKTYTAIDVSFNQKIDITGA 123

Query: 64  ------DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD-SVSTV 116
                 DAPVT+V ++   C  C +      + L        KLR + +  PL       
Sbjct: 124 PVRGKEDAPVTLVLFSDFECPWCGKLEPVLAELLAK---NPDKLRIVFKHLPLPMHQQAE 180

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A  LA  A ++  G +W     LF +   W  +      +   A+  G     +   +  
Sbjct: 181 AASLASIAAQKQ-GKFWEMHDALF-QITTWTPT-----VIDETAQRIGLDMVRYKADVAG 233

Query: 177 QNILDDIKAGKKRASEDFA-IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           Q +   ++  K ++    A I +TP  FI G     D S     K++D  +
Sbjct: 234 QEV--QMQLAKDKSDAQLADISATPSLFINGR-PARDRSLPALQKMVDEAV 281


>gi|119962174|ref|YP_947145.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter
           aurescens TC1]
 gi|119949033|gb|ABM07944.1| putative DSBA-like thioredoxin domain protein [Arthrobacter
           aurescens TC1]
          Length = 222

 Score = 38.9 bits (89), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 62/166 (37%), Gaps = 18/166 (10%)

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM 128
           +VE+    C  C        + L+ +Y    ++ ++ R FPL                  
Sbjct: 68  LVEFLDFECESCLA-AEPLVEELKKEY--GDRITFVHRYFPLPGHRNSGAAALAAEAAAQ 124

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDALL-NMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
            G Y    + LF  Q +W   +  + A     A+  G   + +D  + DQ       A K
Sbjct: 125 QGRYQEMAAKLFATQSEWGEKQTSQAAQFRTFAQEIGLEMDQYDAAVADQ-------ASK 177

Query: 188 KRASEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            R S D A      +  TP FF+ G   L   +E  F +++D  ++
Sbjct: 178 DRISRDVADGKALGVTGTPTFFLNGK-KLTLNTEAQFRQLLDDAVR 222


>gi|163868283|ref|YP_001609492.1| outer membrane protein [Bartonella tribocorum CIP 105476]
 gi|161017939|emb|CAK01497.1| outer membrane protein [Bartonella tribocorum CIP 105476]
          Length = 290

 Score = 38.9 bits (89), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 69/169 (40%), Gaps = 11/169 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D  +G  +    +V++    C HC      ++  +ED   +   L+ I+++ P+    ++
Sbjct: 130 DAVLGNPNGKKVLVDFFDYNCQHCKS----SYSDIEDLIREYPDLQVIIKDLPILGPDSM 185

Query: 117 AV-MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           AV  +A    K+    Y  F   L   Q     +K      + +A   G  +      + 
Sbjct: 186 AVHTVAYAFRKQFPEKYPQFHKTLLMHQGRVNEAK-----AIKIAVSLGADEKKLRKAIK 240

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           D N+ +  K   + AS    I  TP + IG  +++G   + +  + ID+
Sbjct: 241 DPNLQNTFKENIQIASR-LHITGTPSYIIGNKVFIGAAGQDILKQAIDN 288


>gi|29840346|ref|NP_829452.1| hypothetical protein CCA00588 [Chlamydophila caviae GPIC]
 gi|29834695|gb|AAP05330.1| conserved hypothetical protein [Chlamydophila caviae GPIC]
          Length = 232

 Score = 38.9 bits (89), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           ++G   AP+ +  +   +C  CAEF  + F  L  KYI TG++ + L
Sbjct: 44  TLGNPYAPINITVFEEPSCAACAEFSTEVFPLLRKKYIDTGEVSFTL 90


>gi|291572113|dbj|BAI94385.1| DSBA oxidoreductase [Arthrospira platensis NIES-39]
          Length = 252

 Score = 38.9 bits (89), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 68/168 (40%), Gaps = 16/168 (9%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           RA++  SP+       G  DA + +VE++   C  C   H  T K   D++    ++  +
Sbjct: 82  RAIIGDSPT------FGAADAEIVLVEFSDFQCPFCRRAHG-TIKEFMDRH--QDQVTLV 132

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
            +  PL  +   A+  A+ A      G +W + + LF  QDD +    Y    +++    
Sbjct: 133 FKHLPLSQIHAQALPAAKAAWAAQQQGKFWEYQNALFEGQDD-LGEALYEAIAISL---- 187

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           G     F+   N    +  I+   + AS    I  TP F + G    G
Sbjct: 188 GLDLEQFNRDRNSDGAIAAIEQDMQLASV-LGISGTPFFVMNGETLSG 234


>gi|284008004|emb|CBA74060.1| protein-disulfide isomerase DsbA family [Arsenophonus nasoniae]
          Length = 257

 Score = 38.9 bits (89), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 69/161 (42%), Gaps = 23/161 (14%)

Query: 56  KDV-SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
           KDV + G KDA  ++V Y    C +C      T + L D     G + +  +  PL    
Sbjct: 84  KDVLTYGSKDARFSLVTYMDFQCTYCQRLA-ATPRSLVDS-ANEGLVNWKWKNSPLPMHE 141

Query: 115 TVAVMLAR---CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            +A   A+   CA K+ +  YW  ++   +K  D  ++       L++AK        ++
Sbjct: 142 PMATEQAKKYICAGKQDEKNYWDIIASWGSKNLDLTDAAITAKYKLDLAK--------YE 193

Query: 172 TCLND-----QNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            CL D     +NI+++ KA     S+   I +TP   I  N
Sbjct: 194 ACLKDASGEIKNIIENDKA----ESQALGISATPTTIIIDN 230


>gi|255971226|ref|ZP_05421812.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|255962244|gb|EET94720.1| conserved hypothetical protein [Enterococcus faecalis T1]
          Length = 172

 Score = 38.5 bits (88), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+++APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGERNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|16800120|ref|NP_470388.1| hypothetical protein lin1051 [Listeria innocua Clip11262]
 gi|16413510|emb|CAC96282.1| lin1051 [Listeria innocua Clip11262]
 gi|313624252|gb|EFR94304.1| thioredoxin family protein [Listeria innocua FSL J1-023]
          Length = 176

 Score = 38.5 bits (88), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 48/93 (51%), Gaps = 8/93 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           + +G+K APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S   
Sbjct: 17  IHVGEKGAPVKVMSFINLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKES--- 72

Query: 118 VMLARCAEKRMD----GGYWGFVSLLFNKQDDW 146
           +     A + +D          ++ +++ QD+W
Sbjct: 73  LQRGNVAHRYLDYSKPEETRETINKIYSTQDEW 105


>gi|227517732|ref|ZP_03947781.1| thioredoxin superfamily protein [Enterococcus faecalis TX0104]
 gi|227074837|gb|EEI12800.1| thioredoxin superfamily protein [Enterococcus faecalis TX0104]
          Length = 174

 Score = 38.5 bits (88), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +AP+ M+E+ ++ C +C ++  ++ + L  +++K+GK+
Sbjct: 5   MDISVIDATKVNTETGLHIGESNAPIKMIEFINVRCPYCRKWFEESEELL-AQFVKSGKV 63

Query: 102 RYILREF 108
             I++ F
Sbjct: 64  ERIIKLF 70


>gi|149276047|ref|ZP_01882192.1| DSBA oxidoreductase [Pedobacter sp. BAL39]
 gi|149233475|gb|EDM38849.1| DSBA oxidoreductase [Pedobacter sp. BAL39]
          Length = 171

 Score = 38.5 bits (88), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 68/167 (40%), Gaps = 18/167 (10%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DS 112
           T  D   G   A +T+VEY    C HC + H    K + D +    ++ ++ R FPL +S
Sbjct: 8   TETDHRQGNGSASLTIVEYGDYQCPHCGKAH-PVIKEILDTF--GDQVLFVFRNFPLQES 64

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS----KN 168
                +         +   YW     +F  Q     S+   + L ++A+         + 
Sbjct: 65  HPYATIAARATEAAALQDKYWEMHDAIFEFQ-----SQLNEEFLFSLAERLELDLDQFRE 119

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           D  +    + + +D ++G +       ++ TP FF+  N + GD ++
Sbjct: 120 DITSAEVKEKVENDFESGVRS-----GVNGTPSFFVNDNKFDGDATD 161


>gi|315174679|gb|EFU18696.1| conserved hypothetical protein [Enterococcus faecalis TX1346]
          Length = 172

 Score = 38.5 bits (88), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+++APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGERNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|284052965|ref|ZP_06383175.1| DSBA oxidoreductase [Arthrospira platensis str. Paraca]
          Length = 252

 Score = 38.5 bits (88), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 68/168 (40%), Gaps = 16/168 (9%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           RA++  SP+       G  DA + +VE++   C  C   H  T K   D++    ++  +
Sbjct: 82  RAIIGDSPT------FGAADAEIVLVEFSDFQCPFCRRAHG-TIKEFMDRH--QDQVTLV 132

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
            +  PL  +   A+  A+ A      G +W + + LF  QDD +    Y    +++    
Sbjct: 133 FKHLPLSQIHAQALPAAKAAWAAQQQGKFWEYQNALFEGQDD-LGEALYEAIAISL---- 187

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           G     F+   N    +  I+   + AS    I  TP F + G    G
Sbjct: 188 GLDLEQFNRDRNSDGAIAAIEQDMQLASV-IGISGTPFFVMNGETLSG 234


>gi|114704665|ref|ZP_01437573.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
 gi|114539450|gb|EAU42570.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
          Length = 256

 Score = 38.5 bits (88), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 72/171 (42%), Gaps = 20/171 (11%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           D +   R  L ++P  M    +G  D  VT+ E+    C +C +  +     LE+     
Sbjct: 71  DAIGKVREQLNSAPEGM---VLGNPDGDVTVTEFFDYNCGYCRQALDDMTALLEED---- 123

Query: 99  GKLRYILREFPLDSVSTV-AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           G +R++L+EFP+  + ++ A  +A          Y  F   L +K+     S   + + L
Sbjct: 124 GNVRFVLKEFPILGMGSLEAARVAMAFRDLAPEKYREFHETLLSKR-----SGADKASAL 178

Query: 158 NMAKFAGFSKNDFDTCL---NDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
           ++A+  G      +  L    +   L DI+      + D  I+ TP + IG
Sbjct: 179 DVAEGLGVDTAKIEEILAASTNMKALQDIQV----LASDLRINGTPSYVIG 225


>gi|319898972|ref|YP_004159065.1| Outer membrane protein [Bartonella clarridgeiae 73]
 gi|319402936|emb|CBI76487.1| Outer membrane protein [Bartonella clarridgeiae 73]
          Length = 264

 Score = 38.5 bits (88), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 32/170 (18%), Positives = 69/170 (40%), Gaps = 15/170 (8%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSV 113
           D  +G  +  + +VE+    C HC   +      +++       LR ++++ P+   DSV
Sbjct: 104 DAILGNPNGKIVLVEFFDYNCKHCKRSYLDLISLMQE----YTDLRIVIKDLPILGPDSV 159

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           +T   ++++   K+    Y  F   L   Q      ++  D  + +A   G ++ +    
Sbjct: 160 AT--HIISQIFRKKFPEKYLQFHKKLLMSQ-----GRSNEDKAIKIAVLLGANEKELRNA 212

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           + D   L  +     R +    I  TP + IG  + +G + + +    I+
Sbjct: 213 IQDSK-LQKLFQENIRIASALNITGTPAYIIGDKVLIGAVEKNILQAAIE 261


>gi|327534357|gb|AEA93191.1| thioredoxin superfamily protein [Enterococcus faecalis OG1RF]
          Length = 172

 Score = 38.5 bits (88), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+++APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGERNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|318057122|ref|ZP_07975845.1| thioredoxin-like protein [Streptomyces sp. SA3_actG]
 gi|318081716|ref|ZP_07989028.1| thioredoxin-like protein [Streptomyces sp. SA3_actF]
          Length = 173

 Score = 38.5 bits (88), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 7/133 (5%)

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +L   LR FPL+             E    G  W FV+ + ++ +D+  +      L+  
Sbjct: 44  RLEIRLRHFPLEKHKHAFAGAQAAEEAFAQGQGWPFVAAVLHRVEDFTAAGE--PFLVET 101

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-EGV- 217
           A   G    +FDT L D   +  + A +        +  TP + IGG L  G  + EG+ 
Sbjct: 102 AGELGLDAEEFDTALIDGRHILTVDADQAEGKA-LGVKGTPTYEIGGTLLDGSKTQEGLR 160

Query: 218 --FSKIIDSMIQD 228
               +I D ++ D
Sbjct: 161 ERIEEIADGLLAD 173


>gi|94967830|ref|YP_589878.1| vitamin K epoxide reductase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549880|gb|ABF39804.1| Vitamin K epoxide reductase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 553

 Score = 38.5 bits (88), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 68/162 (41%), Gaps = 22/162 (13%)

Query: 59  SIGQKDAPVTMVEYASMTCFHC--AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           + G  DAP+T+VE+    C  C  AE  N+  +     Y K  ++R++ R+FPL      
Sbjct: 199 TAGPADAPITIVEFGDFQCPSCIIAEATNRQIRR---NYPK--QVRFVFRQFPLAKFHVF 253

Query: 117 AVMLARCAEKRMDGG-YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           A   A  AE   D G +W     ++    +    +     L   A+  G     F+ CL 
Sbjct: 254 AERAAEAAECADDQGKFWQMHDRMYEADGELAPVQ-----LKYYAQDIGLDSAKFNACLE 308

Query: 176 ----DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
               +  +  D++ GK        + +TP F++    ++G +
Sbjct: 309 SGEKEARVKADMEDGKA-----VGVGATPTFWVNQVKHVGGL 345


>gi|313619521|gb|EFR91201.1| thioredoxin family protein [Listeria innocua FSL S4-378]
          Length = 176

 Score = 38.5 bits (88), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 48/93 (51%), Gaps = 8/93 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           + +G+K APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S   
Sbjct: 17  IHVGEKGAPVKVMTFINLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKES--- 72

Query: 118 VMLARCAEKRMD----GGYWGFVSLLFNKQDDW 146
           +     A + +D          ++ +++ QD+W
Sbjct: 73  LQRGNVAHRYLDYSKPEETRETINKIYSTQDEW 105


>gi|163568289|gb|ABY27041.1| disulfide oxidoreductase [Ehrlichia chaffeensis]
          Length = 125

 Score = 38.5 bits (88), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 94  KYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY 152
           + I+ GK+R I R+FP L   S  AV  A          Y  F     N +  + +    
Sbjct: 9   QIIQDGKVRVIFRDFPILGEASLKAVQAALAVHLINPSKYIEFYHAALNHKQQFND---- 64

Query: 153 RDALLNMAKFAGFSKNDFDTCL-NDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            +++L++ K  G ++ DF   L  + + ++ +    K  +++  I  TP   IG
Sbjct: 65  -ESILSLVKSIGIAEEDFKVSLAKNSDTIEKMIQSTKELAQNINIRGTPAIIIG 117


>gi|229492854|ref|ZP_04386652.1| dsba oxidoreductase [Rhodococcus erythropolis SK121]
 gi|229320294|gb|EEN86117.1| dsba oxidoreductase [Rhodococcus erythropolis SK121]
          Length = 218

 Score = 38.1 bits (87), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 65/152 (42%), Gaps = 25/152 (16%)

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV--STVAVMLA 121
           D  V +VE+    C  C   +  T + +  +Y   G++ + +R FP+ S   ST+A  + 
Sbjct: 57  DGKVNLVEFLDFECEACLALY-PTMERIRAEY--EGRITFGIRYFPIPSHTNSTLAAQVV 113

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL---------LNMAKFAGFSKNDFDT 172
             A ++  G +      ++  Q  W  S   ++AL         L+MA+F    ++D  +
Sbjct: 114 ESASRQ--GKFVEMYKQMYETQSQWGESAESQEALFRSYAQDLGLDMARF----ESDLGS 167

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
               + +  D + G++       +  TP  F+
Sbjct: 168 RGVRERVERDFEEGRR-----LGVQGTPTLFL 194


>gi|226226756|ref|YP_002760862.1| hypothetical protein GAU_1350 [Gemmatimonas aurantiaca T-27]
 gi|226089947|dbj|BAH38392.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 239

 Score = 38.1 bits (87), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 74/172 (43%), Gaps = 23/172 (13%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS--VSTVAV 118
           G  DA    V +  + C  CA FH KT      ++  +  +R++   FPL+S   +  A 
Sbjct: 74  GSVDAVAKFVVFNDLECPFCAAFH-KTLGEARARHRGSVSVRFV--HFPLNSHRFAKPAA 130

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCL-ND 176
           +   CA K   G +   V ++F KQD  +   ++R    ++A  A  S  ++F+ CL   
Sbjct: 131 LAVECAGKV--GRFDSMVDVVFKKQDS-LGLASWR----SLAAEANVSPLDEFERCLAAG 183

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG--DMSEGVFSKIIDSMI 226
                DI+AG  R         TP  ++ G   L   D SE      ID MI
Sbjct: 184 TGQFLDIEAG-VRLGRSLNAPGTPTIYVNGWKLLAPPDSSE------IDDMI 228


>gi|91976908|ref|YP_569567.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisB5]
 gi|91683364|gb|ABE39666.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisB5]
          Length = 255

 Score = 38.1 bits (87), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 70/159 (44%), Gaps = 7/159 (4%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ++ + V+IG K+  VT+VE+    C +C        + L++      KL+ +L+EFP+  
Sbjct: 83  NSPRGVAIGNKNGDVTLVEFFDYNCGYCKRAMTDMLELLKE----DSKLKVVLKEFPVLG 138

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             +V       A +  D G   +  L F+++      +  +   +  AK AGF     + 
Sbjct: 139 PPSVEAAQVAIAVRMQDPGSKKY--LDFHQKLMGGRGQADKARAIAAAKDAGFDMARLEK 196

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            +    +   I+   K A E   ++ TP + IG  + +G
Sbjct: 197 DMASPEVRATIEESFKLA-ESMGMNGTPSYVIGKQVVVG 234


>gi|163759366|ref|ZP_02166452.1| putative outer membrane protein [Hoeflea phototrophica DFL-43]
 gi|162283770|gb|EDQ34055.1| putative outer membrane protein [Hoeflea phototrophica DFL-43]
          Length = 266

 Score = 38.1 bits (87), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 65/172 (37%), Gaps = 9/172 (5%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           +D++IG  +  +T+VE+    C  C        K LE        +R +L+EFP+    +
Sbjct: 98  EDMTIGNPNGDITLVEFFDYNCGFCKRAMEDVVKILE----ADNNVRVVLKEFPILGPDS 153

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           +A      A +++    +G   +     D     +      + +A   G  +      + 
Sbjct: 154 LAAHQVSMAFRKLAPEQYGDYHMALLGAD----VRATEALAIELALEYGVEEEALRAGIA 209

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           D  I D I+     A +   I  TP F IG     G +        I++M Q
Sbjct: 210 DPAIGDSIRKAYTLA-DALGISGTPSFVIGDETVFGAVGSDTLLAKINNMRQ 260


>gi|322370133|ref|ZP_08044695.1| DSBA-like thioredoxin [Haladaptatus paucihalophilus DX253]
 gi|320550469|gb|EFW92121.1| DSBA-like thioredoxin [Haladaptatus paucihalophilus DX253]
          Length = 238

 Score = 38.1 bits (87), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 65/168 (38%), Gaps = 7/168 (4%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           A +  +P   +    G   A  T+  +++  C +CA+F       +  +Y++ G++   L
Sbjct: 51  APIPKNPDEHEYAIAGTGTADTTVRYFSNWKCPYCAQFSTGFLGEIVSEYVEPGEIDIEL 110

Query: 106 REF------PLDSVSTVAVMLARCAEKRMDG-GYWGFVSLLFNKQDDWINSKNYRDALLN 158
           R        P           A  A   +D   +WG+   +F+ Q          D LL+
Sbjct: 111 RTLGYFGDEPFLGPDAPRASEAGLAVWNVDPQSFWGYYEYVFSHQPSEKKQWATTDKLLS 170

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
             + AG  + D      + N  + +      A++   ++STP+  I G
Sbjct: 171 FMEKAGVKRRDEIKTQIESNEYESLLHQSDTAAQRAGVNSTPMLVING 218


>gi|89898221|ref|YP_515331.1| disulfide bond chaperone [Chlamydophila felis Fe/C-56]
 gi|89331593|dbj|BAE81186.1| disulfide bond chaperone [Chlamydophila felis Fe/C-56]
          Length = 212

 Score = 38.1 bits (87), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           ++G   AP+ +  +   +C  CAEF ++ F  L++ YI TG++ + L
Sbjct: 24  TLGNPYAPINITVFEEPSCSACAEFSSEVFPLLKEHYIDTGEVSFTL 70


>gi|313609480|gb|EFR85050.1| thioredoxin family protein [Listeria monocytogenes FSL F2-208]
          Length = 176

 Score = 38.1 bits (87), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 81/175 (46%), Gaps = 29/175 (16%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD------ 111
           + +G + APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +      
Sbjct: 17  IHVGDQSAPVKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKESLQR 75

Query: 112 -SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
            +V+   +  ++  E R        ++ +++KQD+W          L + + A + +++ 
Sbjct: 76  GNVTHRYLDYSKPEETR------ETINKIYSKQDEW--------GSLTLPEVATYMESEL 121

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDS--TPVFFIGGNLYLGDMSEGVFSKIID 223
              L +Q   D+  A +K  +E  A +    P   +G +++   +S      ++D
Sbjct: 122 G--LTEQ---DNKAASEKIVAEANAANVVFVPTVIVGEHIFDEHISPEELRSLLD 171


>gi|88856671|ref|ZP_01131327.1| hypothetical protein A20C1_10830 [marine actinobacterium PHSC20C1]
 gi|88814132|gb|EAR23998.1| hypothetical protein A20C1_10830 [marine actinobacterium PHSC20C1]
          Length = 221

 Score = 38.1 bits (87), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 56/150 (37%), Gaps = 21/150 (14%)

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           D  VT+VE+    C  CA  +    + L  ++  +G++ ++LR FPL             
Sbjct: 61  DGAVTVVEFLDFECEACAAAY-PVVEELRQEF--SGQVTFVLRYFPLPGHFNSTNAAVAV 117

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA---GFSKNDFDTCLNDQNIL 180
                 G        +F  Q +W  ++  +  L    KFA   G     +D  + D    
Sbjct: 118 EAAAQQGELEAMYKQMFATQSEWGEAQQSQAPLFR--KFAEDLGLDLAQYDAAVAD---- 171

Query: 181 DDIKAGKKRASEDF------AIDSTPVFFI 204
               A   R   DF       ++STP FF+
Sbjct: 172 ---PATTARVESDFKDGVALGVNSTPTFFV 198


>gi|227548589|ref|ZP_03978638.1| DSBA oxidoreductase [Corynebacterium lipophiloflavum DSM 44291]
 gi|227079312|gb|EEI17275.1| DSBA oxidoreductase [Corynebacterium lipophiloflavum DSM 44291]
          Length = 235

 Score = 38.1 bits (87), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 87/232 (37%), Gaps = 36/232 (15%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           +V +   I V+ GIV       FF  R  SA    P P+ V       + +   ++D S 
Sbjct: 23  IVWALLAIVVIAGIVA------FFLGRSDSA--SAPAPETVA------SDAGQVVRDNSR 68

Query: 61  GQKDAP---VTMVEYASMTCFHCAEFHNKTFKYLEDKYIK-TGKLRYILREFPLDSVSTV 116
               AP     +VE+    C  C       + ++E+   + +  + ++ R FPL      
Sbjct: 69  VLSQAPNEKAVLVEFLDFECEAC----RAAYPFVEELRAEYSDTVTFVNRYFPLPGHRNS 124

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN-DFDTCLN 175
                        G Y      +F  Q +W  S     A  N A F GF+++   D    
Sbjct: 125 MPAAVAVEAAAQQGQYEAMYQRMFETQSEWGES-----AEDNSAVFRGFAEDLGLDMAAF 179

Query: 176 DQNILDDIKAGKKRASEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKI 221
           D  + D   A ++R   D A      +  TP FF+ G L   D  E + +++
Sbjct: 180 DAAVAD--PATEERVRLDVADGTALGVRGTPTFFLDGQLLTPDSLEQLRAEV 229


>gi|290893790|ref|ZP_06556769.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|290556617|gb|EFD90152.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
          Length = 184

 Score = 38.1 bits (87), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 78/172 (45%), Gaps = 23/172 (13%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           + +G + APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S   
Sbjct: 17  IHVGDQTAPVKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKES--- 72

Query: 118 VMLARCAEKRMD----GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           +       + +D          ++ +++KQD+W          L + + A + +++    
Sbjct: 73  LQRGNVTHRYLDYSKPEETRETINKIYSKQDEW--------GSLTLPEVATYMESELG-- 122

Query: 174 LNDQNILDDIKAGKKRASEDFAIDS--TPVFFIGGNLYLGDMSEGVFSKIID 223
           L +Q   D+  A +K  +E  A +    P   +G +++   +S      ++D
Sbjct: 123 LTEQ---DNKAASEKIVAEANAANVVFVPTVIVGEHIFDEHISPEELRSLLD 171


>gi|311743096|ref|ZP_07716904.1| DSBA family thioredoxin domain protein [Aeromicrobium marinum DSM
           15272]
 gi|311313776|gb|EFQ83685.1| DSBA family thioredoxin domain protein [Aeromicrobium marinum DSM
           15272]
          Length = 259

 Score = 38.1 bits (87), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 66/163 (40%), Gaps = 19/163 (11%)

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--------DSVSTVAVMLARCAEK 126
           + C  C +F   + ++L+DK + +G++    R F          +  S  A   A C   
Sbjct: 101 LQCPACQQFEALSGQFLKDK-VASGEITLTYRPFSFLDERGGSPNDYSKRANNAAVCLLD 159

Query: 127 RMD-GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN----ILD 181
             D   +  F S L+  Q     +    + L+ +A+  G S   F++C+        I++
Sbjct: 160 ATDITSFLDFQSFLYANQPTEGRAGPEDEELIELAEPFGASGETFESCVTSGKHIPWIVE 219

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             +AG +R      +  TP  FIGG +      E +   I D+
Sbjct: 220 SKEAGAERG-----VSGTPTVFIGGEVSEARTPEDLQEAIDDA 257


>gi|257389011|ref|YP_003178784.1| thioredoxin [Halomicrobium mukohataei DSM 12286]
 gi|257171318|gb|ACV49077.1| DsbA-like thioredoxin domain-containing protein [Halomicrobium
           mukohataei DSM 12286]
          Length = 234

 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 26/52 (50%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           ++G +     +V +   +C  C  FH  TF  +E + +  G + Y+ R +P+
Sbjct: 64  TLGDRGRQGVIVAFEDPSCPTCRRFHRNTFPQIESELLAPGDVAYVFRGYPV 115


>gi|254853053|ref|ZP_05242401.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|258606401|gb|EEW19009.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
          Length = 184

 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 78/172 (45%), Gaps = 23/172 (13%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           + +G + APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S   
Sbjct: 17  IHVGDQTAPVKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKES--- 72

Query: 118 VMLARCAEKRMD----GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
           +       + +D          ++ +++KQD+W          L + + A + +++    
Sbjct: 73  LQRGNVTHRYLDYSKPEETRETINKIYSKQDEW--------GSLTLPEVATYMESELG-- 122

Query: 174 LNDQNILDDIKAGKKRASEDFAIDS--TPVFFIGGNLYLGDMSEGVFSKIID 223
           L +Q   D+  A +K  +E  A +    P   +G +++   +S      ++D
Sbjct: 123 LTEQ---DNKAASEKIVAEANAANVVFVPTVIVGEHIFDEHISPEELRSLLD 171


>gi|256854366|ref|ZP_05559730.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256709926|gb|EEU24970.1| conserved hypothetical protein [Enterococcus faecalis T8]
          Length = 171

 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ K L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEES-KELLAQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|307276253|ref|ZP_07557381.1| hypothetical protein HMPREF9521_01880 [Enterococcus faecalis
           TX2134]
 gi|307296209|ref|ZP_07576037.1| hypothetical protein HMPREF9509_03130 [Enterococcus faecalis
           TX0411]
 gi|306496083|gb|EFM65665.1| hypothetical protein HMPREF9509_03130 [Enterococcus faecalis
           TX0411]
 gi|306507053|gb|EFM76195.1| hypothetical protein HMPREF9521_01880 [Enterococcus faecalis
           TX2134]
 gi|315029869|gb|EFT41801.1| conserved hypothetical protein [Enterococcus faecalis TX4000]
 gi|315160004|gb|EFU04021.1| conserved hypothetical protein [Enterococcus faecalis TX0312]
 gi|323479963|gb|ADX79402.1| thioredoxin superfamily protein [Enterococcus faecalis 62]
          Length = 172

 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ K L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEES-KELLAQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|229546605|ref|ZP_04435330.1| thioredoxin superfamily protein [Enterococcus faecalis TX1322]
 gi|229308295|gb|EEN74282.1| thioredoxin superfamily protein [Enterococcus faecalis TX1322]
          Length = 149

 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ K L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEES-KELLAQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|81428143|ref|YP_395142.1| hypothetical protein LSA0530 [Lactobacillus sakei subsp. sakei 23K]
 gi|78609784|emb|CAI54830.1| Hypothetical protein LCA_0530 [Lactobacillus sakei subsp. sakei
           23K]
          Length = 174

 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           +T   + IG  +APVT VE+ ++ C +C ++  K+ + L  K ++ G++R I++ +
Sbjct: 12  TTEGGIVIGHPEAPVTFVEFLNLACPYCRKWFLKSEEQLT-KAVEAGQVRRIIKPY 66


>gi|149911666|ref|ZP_01900275.1| dsbA-like thioredoxin domain protein [Moritella sp. PE36]
 gi|149805247|gb|EDM65263.1| dsbA-like thioredoxin domain protein [Moritella sp. PE36]
          Length = 222

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 61/154 (39%), Gaps = 7/154 (4%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
           +  D+  G K A VT+VE+    C  C  F+      L+ KY   GK+  I+R  P+   
Sbjct: 49  SQNDLVFGNKYAKVTIVEFFDPACESCRAFYPLVKSQLK-KY--KGKVNLIVR--PVAFH 103

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW-INSKNYRDALLNMAKFAGFSKNDFDT 172
             V  ++A     +M G +W  +    N Q  W IN     D L    +  G        
Sbjct: 104 RNVGPVVAALEATKMQGKFWESLGTTLNYQSRWAINHVANVDLLYPYLQDVGVDIEKLKV 163

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            +    I + + A     ++   +  TP F++ G
Sbjct: 164 DVKSPVIAERM-AQDALDAKTLKVLKTPTFYVNG 196


>gi|110346947|ref|YP_665765.1| DSBA oxidoreductase [Mesorhizobium sp. BNC1]
 gi|110283058|gb|ABG61118.1| DSBA oxidoreductase [Chelativorans sp. BNC1]
          Length = 218

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 82/202 (40%), Gaps = 35/202 (17%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS--IGQKDAPVTMVEYA 73
           +LF  S  +Y R G +  E             ++ + S ++D S  +G   APVT+VE+ 
Sbjct: 17  ILFAGSVLYYDRVGGSSAEA------------ISDNASLVRDYSPVMGPASAPVTIVEFF 64

Query: 74  SMTCFHCAEFH----NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
             +C  C  F+    N   +Y +D       +R +LR       S  AV +   A K+  
Sbjct: 65  DPSCEACRAFYPIVKNILAQYPQD-------VRLVLRYAAFHDGSDQAVGILEAARKQ-- 115

Query: 130 GGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK 188
             +   +  L   Q +W  +S    D     A  AG    D +    D +   D+ A   
Sbjct: 116 NLFEPVLEALLAAQPEWAPHSGPVIDKAWQAAAAAGL---DLERARQDAS-SPDVTAVLD 171

Query: 189 RASED---FAIDSTPVFFIGGN 207
           + S+D   + ++ TP FF+ G 
Sbjct: 172 QESKDIDTWRVEQTPTFFVNGK 193


>gi|46907291|ref|YP_013680.1| hypothetical protein LMOf2365_1080 [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47092951|ref|ZP_00230732.1| conserved hypothetical protein [Listeria monocytogenes str. 4b
           H7858]
 gi|217964848|ref|YP_002350526.1| thioredoxin family protein [Listeria monocytogenes HCC23]
 gi|226223677|ref|YP_002757784.1| hypothetical protein Lm4b_01079 [Listeria monocytogenes Clip81459]
 gi|254823667|ref|ZP_05228668.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|254933392|ref|ZP_05266751.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|254993595|ref|ZP_05275785.1| hypothetical protein LmonocytoFSL_11808 [Listeria monocytogenes FSL
           J2-064]
 gi|255520828|ref|ZP_05388065.1| hypothetical protein LmonocFSL_06306 [Listeria monocytogenes FSL
           J1-175]
 gi|300765910|ref|ZP_07075883.1| serine/threonine protein kinase [Listeria monocytogenes FSL N1-017]
 gi|46880558|gb|AAT03857.1| conserved hypothetical protein [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47018698|gb|EAL09450.1| conserved hypothetical protein [Listeria monocytogenes str. 4b
           H7858]
 gi|217334118|gb|ACK39912.1| thioredoxin family protein [Listeria monocytogenes HCC23]
 gi|225876139|emb|CAS04845.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|293584954|gb|EFF96986.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293592890|gb|EFG00651.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|300513372|gb|EFK40446.1| serine/threonine protein kinase [Listeria monocytogenes FSL N1-017]
 gi|307570593|emb|CAR83772.1| conserved hypothetical protein [Listeria monocytogenes L99]
 gi|328466832|gb|EGF37946.1| hypothetical protein LM1816_12567 [Listeria monocytogenes 1816]
 gi|332311468|gb|EGJ24563.1| Thioredoxin family protein [Listeria monocytogenes str. Scott A]
          Length = 176

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 81/175 (46%), Gaps = 29/175 (16%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD------ 111
           + +G + APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +      
Sbjct: 17  IHVGDQTAPVKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKESLQR 75

Query: 112 -SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
            +V+   +  ++  E R        ++ +++KQD+W          L + + A + +++ 
Sbjct: 76  GNVTHRYLDYSKPEETR------ETINKIYSKQDEW--------GSLTLPEVATYMESEL 121

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDS--TPVFFIGGNLYLGDMSEGVFSKIID 223
              L +Q   D+  A +K  +E  A +    P   +G +++   +S      ++D
Sbjct: 122 G--LTEQ---DNKAASEKIVAEANAANVVFVPTVIVGEHIFDEHISPEELRSLLD 171


>gi|297566768|ref|YP_003685740.1| DSBA oxidoreductase [Meiothermus silvanus DSM 9946]
 gi|296851217|gb|ADH64232.1| DSBA oxidoreductase [Meiothermus silvanus DSM 9946]
          Length = 298

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 12/91 (13%)

Query: 40  GVVD---FRALLAA------SPSTMKDVSIGQK---DAPVTMVEYASMTCFHCAEFHNKT 87
           GVVD   F   LAA      +P  +KD    +     + V + E++   C +C +F  + 
Sbjct: 108 GVVDGFTFTLTLAADLSFTLAPVEIKDFGPDRHVLGKSGVMIREFSDFQCPYCKQFTLQV 167

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
              LE +YI  G  R+  R FPL  +   A+
Sbjct: 168 KPELEKRYINPGLARFSFRHFPLTQIHPQAM 198


>gi|15618152|ref|NP_224437.1| disulfide bond chaperone [Chlamydophila pneumoniae CWL029]
 gi|15835763|ref|NP_300287.1| disulfide bond chaperone [Chlamydophila pneumoniae J138]
 gi|16752811|ref|NP_445080.1| hypothetical protein CP0536 [Chlamydophila pneumoniae AR39]
 gi|33241569|ref|NP_876510.1| putative disulfide bond chaperone [Chlamydophila pneumoniae TW-183]
 gi|4376501|gb|AAD18381.1| Disulfide Bond Chaperone [Chlamydophila pneumoniae CWL029]
 gi|7189450|gb|AAF38359.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
 gi|8978601|dbj|BAA98438.1| disulfide bond chaperone [Chlamydophila pneumoniae J138]
 gi|33236077|gb|AAP98167.1| putative disulfide bond chaperone [Chlamydophila pneumoniae TW-183]
          Length = 233

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           +IG   AP+ +  +   +C  CAEF  + F  L+  YI TG++ + L
Sbjct: 44  TIGNPYAPINITVFEEPSCSACAEFTTEVFPLLKKHYIDTGEISFTL 90


>gi|269303105|gb|ACZ33205.1| thioredoxin family protein [Chlamydophila pneumoniae LPCoLN]
          Length = 233

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           +IG   AP+ +  +   +C  CAEF  + F  L+  YI TG++ + L
Sbjct: 44  TIGNPYAPINITVFEEPSCSACAEFTTEVFPLLKKHYIDTGEISFTL 90


>gi|307947214|ref|ZP_07662549.1| dsba oxidoreductase [Roseibium sp. TrichSKD4]
 gi|307770878|gb|EFO30104.1| dsba oxidoreductase [Roseibium sp. TrichSKD4]
          Length = 257

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 63/160 (39%), Gaps = 11/160 (6%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LD 111
           ++ + V +G     VTMVE+    C +C   H    K +++       LR +L+EFP L 
Sbjct: 86  NSTRQVVLGNPQGDVTMVEFFDYNCGYCKRAHGDIVKLIDE----MPNLRVVLKEFPVLG 141

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             S  A  +A          Y  F   L  ++      +  + + +  A   G S++  +
Sbjct: 142 QASVEAAQVAIAVNTVAPDKYSEFHEALLLQR-----GRANKASSMQAAIGVGISEDAVN 196

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             +N       I+     A+    +  TP + IG  + +G
Sbjct: 197 NAINSDIAGQTIEEVYTLANR-LGLTGTPSYVIGDEVIMG 235


>gi|333028310|ref|ZP_08456374.1| putative DSBA oxidoreductase [Streptomyces sp. Tu6071]
 gi|332748162|gb|EGJ78603.1| putative DSBA oxidoreductase [Streptomyces sp. Tu6071]
          Length = 173

 Score = 37.7 bits (86), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 53/133 (39%), Gaps = 7/133 (5%)

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +L   LR FPL+             E    G  W FV+ +  + +D+  +      L+  
Sbjct: 44  RLEIRLRHFPLEKHKHAFAGAQAAEEAFAQGQGWPFVAAVLRRVEDFAAAGE--PFLVET 101

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-EGV- 217
           A   G    +FDT L D   +  + A +        +  TP + IGG L  G  + EG+ 
Sbjct: 102 AGGLGLDAEEFDTALIDGRHILTVDADQAEGKA-LGVKGTPTYEIGGTLLDGSKTQEGLR 160

Query: 218 --FSKIIDSMIQD 228
               +I D ++ D
Sbjct: 161 ERIEEIADGLLAD 173


>gi|260426483|ref|ZP_05780462.1| dsba oxidoreductase [Citreicella sp. SE45]
 gi|260420975|gb|EEX14226.1| dsba oxidoreductase [Citreicella sp. SE45]
          Length = 256

 Score = 37.7 bits (86), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 62/154 (40%), Gaps = 14/154 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL---DSVSTVA 117
           G  D  VT++E++   C +C     + F  +E+     G +R+I++EFP+    SV++  
Sbjct: 96  GNPDGDVTIIEFSDYRCGYC----RRAFPEVEELIESDGNIRFIMKEFPILGEASVTSSR 151

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             +A   E   D  Y      L       +  +     L  +A   G   +     ++D 
Sbjct: 152 FAIATQLEA-GDDAYKSVHDALMT-----LEGEPSEPVLRRLADTLGLDADAILARMSDP 205

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            I   I+  ++ A+    I+ TP F     +  G
Sbjct: 206 EITRRIQETRELATR-LQINGTPSFVFESEMLRG 238


>gi|312198725|ref|YP_004018786.1| DSBA oxidoreductase [Frankia sp. EuI1c]
 gi|311230061|gb|ADP82916.1| DSBA oxidoreductase [Frankia sp. EuI1c]
          Length = 357

 Score = 37.7 bits (86), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 50  ASPSTMKD-VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           A+P  + D  S G+  APV +VEY    C +CA+      + +E      G +R++ R F
Sbjct: 85  AAPVRLDDRPSRGELTAPVVLVEYGDFECPYCAQAAPVLHELVE---TCGGLVRHVFRHF 141

Query: 109 PLDSVSTVAV 118
           PL  V   A+
Sbjct: 142 PLFEVHPYAL 151


>gi|29375363|ref|NP_814517.1| hypothetical protein EF0770 [Enterococcus faecalis V583]
 gi|29342823|gb|AAO80587.1| conserved hypothetical protein [Enterococcus faecalis V583]
          Length = 172

 Score = 37.7 bits (86), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|227554885|ref|ZP_03984932.1| thioredoxin superfamily protein [Enterococcus faecalis HH22]
 gi|227175998|gb|EEI56970.1| thioredoxin superfamily protein [Enterococcus faecalis HH22]
          Length = 164

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 5   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 63

Query: 102 RYILREF 108
             I++ F
Sbjct: 64  ERIIKLF 70


>gi|256761536|ref|ZP_05502116.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256957364|ref|ZP_05561535.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256964396|ref|ZP_05568567.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|257077640|ref|ZP_05572001.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|257086126|ref|ZP_05580487.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|257421025|ref|ZP_05598015.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|294781582|ref|ZP_06746919.1| conserved hypothetical protein [Enterococcus faecalis PC1.1]
 gi|307269822|ref|ZP_07551152.1| hypothetical protein HMPREF9498_01949 [Enterococcus faecalis
           TX4248]
 gi|307272581|ref|ZP_07553834.1| hypothetical protein HMPREF9514_01345 [Enterococcus faecalis
           TX0855]
 gi|312951862|ref|ZP_07770751.1| conserved hypothetical protein [Enterococcus faecalis TX0102]
 gi|256682787|gb|EEU22482.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256947860|gb|EEU64492.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256954892|gb|EEU71524.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|256985670|gb|EEU72972.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|256994156|gb|EEU81458.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|257162849|gb|EEU92809.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|294451360|gb|EFG19825.1| conserved hypothetical protein [Enterococcus faecalis PC1.1]
 gi|306510866|gb|EFM79883.1| hypothetical protein HMPREF9514_01345 [Enterococcus faecalis
           TX0855]
 gi|306513932|gb|EFM82534.1| hypothetical protein HMPREF9498_01949 [Enterococcus faecalis
           TX4248]
 gi|310630160|gb|EFQ13443.1| conserved hypothetical protein [Enterococcus faecalis TX0102]
 gi|315025733|gb|EFT37665.1| conserved hypothetical protein [Enterococcus faecalis TX2137]
 gi|315036147|gb|EFT48079.1| conserved hypothetical protein [Enterococcus faecalis TX0027]
 gi|315148133|gb|EFT92149.1| conserved hypothetical protein [Enterococcus faecalis TX4244]
 gi|315153192|gb|EFT97208.1| conserved hypothetical protein [Enterococcus faecalis TX0031]
 gi|315154910|gb|EFT98926.1| conserved hypothetical protein [Enterococcus faecalis TX0043]
 gi|315170666|gb|EFU14683.1| conserved hypothetical protein [Enterococcus faecalis TX1342]
 gi|329577617|gb|EGG59049.1| hypothetical protein HMPREF9520_00567 [Enterococcus faecalis
           TX1467]
          Length = 172

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|255973849|ref|ZP_05424435.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|307284468|ref|ZP_07564630.1| hypothetical protein HMPREF9515_02403 [Enterococcus faecalis
           TX0860]
 gi|312900364|ref|ZP_07759675.1| conserved hypothetical protein [Enterococcus faecalis TX0470]
 gi|255966721|gb|EET97343.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|306503145|gb|EFM72399.1| hypothetical protein HMPREF9515_02403 [Enterococcus faecalis
           TX0860]
 gi|311292552|gb|EFQ71108.1| conserved hypothetical protein [Enterococcus faecalis TX0470]
          Length = 172

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|330444566|ref|YP_004377552.1| disulfide bond chaperone [Chlamydophila pecorum E58]
 gi|328807676|gb|AEB41849.1| disulfide bond chaperone [Chlamydophila pecorum E58]
          Length = 237

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 52  PSTMKDV-SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           P+  K+  +IG   AP+ +  +   +C  CAEF  + F  ++  YI TG++ + L
Sbjct: 41  PTNAKNFPTIGNPYAPINITVFEEPSCSACAEFSTEVFPLIKKHYIDTGEVSFTL 95


>gi|315151532|gb|EFT95548.1| conserved hypothetical protein [Enterococcus faecalis TX0012]
          Length = 172

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|297560677|ref|YP_003679651.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296845125|gb|ADH67145.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 226

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/147 (20%), Positives = 61/147 (41%), Gaps = 7/147 (4%)

Query: 63  KDAPVTMVEYASMTCFHC-AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
           ++APVT+VE+    C  C A+F     + + + Y   G++  ++R FP+   +      A
Sbjct: 64  EEAPVTVVEFLDFECEACRAQF--PVMERIREDY--DGRINTVIRYFPMPGHTNAEPAAA 119

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNIL 180
                   G        ++  Q +W  S++ + +  +  A+  G    +F   + D   L
Sbjct: 120 AVEAAAQQGALEQMYVRMYETQAEWGESQDSKAEVFVGFAEDLGLDTEEFVRAVEDPATL 179

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGN 207
           + +++   R      +  TP  F+ G 
Sbjct: 180 ERVRS-DFRDGVALGVRGTPTIFVNGR 205


>gi|302518011|ref|ZP_07270353.1| DSBA oxidoreductase [Streptomyces sp. SPB78]
 gi|302426906|gb|EFK98721.1| DSBA oxidoreductase [Streptomyces sp. SPB78]
          Length = 219

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 53/133 (39%), Gaps = 7/133 (5%)

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +L   LR FPL+             E    G  W FV+ +  + +D+  +      L+  
Sbjct: 90  RLEIRLRHFPLEKHKHAFAGAQAAEEAFAQGQGWPFVAAVLRRVEDFAAAGE--PFLVET 147

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-EGV- 217
           A   G    +FDT L D   +  + A +        +  TP + IGG L  G  + EG+ 
Sbjct: 148 AGELGLDAEEFDTALIDGRHILTVDADQAEGKA-LGVKGTPTYEIGGRLLDGSKTQEGLR 206

Query: 218 --FSKIIDSMIQD 228
               +I D ++ D
Sbjct: 207 ERIEEIADGLLAD 219


>gi|229548712|ref|ZP_04437437.1| thioredoxin superfamily protein [Enterococcus faecalis ATCC 29200]
 gi|229306178|gb|EEN72174.1| thioredoxin superfamily protein [Enterococcus faecalis ATCC 29200]
          Length = 150

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|86357498|ref|YP_469390.1| outer membrane protein [Rhizobium etli CFN 42]
 gi|86281600|gb|ABC90663.1| probable outer membrane protein [Rhizobium etli CFN 42]
          Length = 204

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 66/157 (42%), Gaps = 13/157 (8%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           DV++G     VT+VE+    C +C          ++    K   +R++L+EFP+    +V
Sbjct: 37  DVTLGNPKGDVTVVEFFDYNCTYC----RHALPDMQAMLKKDTNVRFVLKEFPILGPDSV 92

Query: 117 AVMLARCAEKRMDGGYWG--FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
           A      A +R+    +    V+LL ++       +   D+ + +A   G S++     +
Sbjct: 93  AAHKVADAFRRLAPAKYADFHVALLSSE------GRASEDSAIAVAASLGVSEDKVRAEM 146

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             ++  D I     + +    I  TP + IG  L  G
Sbjct: 147 A-KSPNDGIVQATYQLASSLGISGTPSYVIGNELVPG 182


>gi|28493312|ref|NP_787473.1| hypothetical protein TWT345 [Tropheryma whipplei str. Twist]
 gi|28572577|ref|NP_789357.1| secreted protein [Tropheryma whipplei TW08/27]
 gi|28410709|emb|CAD67095.1| putative secreted protein [Tropheryma whipplei TW08/27]
 gi|28476353|gb|AAO44442.1| unknown [Tropheryma whipplei str. Twist]
          Length = 293

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 56/153 (36%), Gaps = 14/153 (9%)

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-----LDSVSTVAVMLARCAEK 126
           YA  +C +C +F   T  YL    +  G     +         L+  S  A     C   
Sbjct: 109 YADYSCHYCKQFEETTSAYL-SSLLDGGNATLSIHPIAIFGSGLNRYSVRATNAVACVAN 167

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
                +    + LF  Q+  + ++    D L  +A  +G S    + C+  +   D   A
Sbjct: 168 YSPKYFLSVNAALFQHQESALQNRGLGNDELWTIASASGASDPKVEECIKHEMFSDWAVA 227

Query: 186 GKKRA-------SEDFAIDSTPVFFIGGNLYLG 211
             +RA       S++ ++  TP   + G LY G
Sbjct: 228 ATERATRYILPNSDNVSLRGTPTVLVNGALYTG 260


>gi|257418376|ref|ZP_05595370.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|257160204|gb|EEU90164.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|315166939|gb|EFU10956.1| conserved hypothetical protein [Enterococcus faecalis TX1341]
 gi|315573466|gb|EFU85657.1| conserved hypothetical protein [Enterococcus faecalis TX0309B]
 gi|315581427|gb|EFU93618.1| conserved hypothetical protein [Enterococcus faecalis TX0309A]
          Length = 176

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +T   + IG+ +APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 5   MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 63

Query: 102 RYILREF 108
             I++ F
Sbjct: 64  ERIIKLF 70


>gi|70725645|ref|YP_252559.1| hypothetical protein SH0644 [Staphylococcus haemolyticus JCSC1435]
 gi|68446369|dbj|BAE03953.1| dsbG [Staphylococcus haemolyticus JCSC1435]
          Length = 198

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 63/150 (42%), Gaps = 7/150 (4%)

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY-ILREFPLDSVSTVAVMLA 121
           K+  + +VEY    C +C +        ++  YI T K+ Y  +    L   S V     
Sbjct: 34  KNGKILIVEYGDFKCPYCKKVEKNVMPTIKKDYIDTNKVEYQFINAGFLGKDSIVGSRAG 93

Query: 122 RCAEKRMDGGYWGFV-SLLFNKQDD---WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
              +K     Y  F  ++L N++D+   W+ ++ + D  ++        K+D       +
Sbjct: 94  NAVQKVAPNEYLTFQRNVLSNQKDEDKKWL-TEQFLDNEIDKLDITTQQKSDIKKQYKTK 152

Query: 178 NILDDIKAG-KKRASEDFAIDSTPVFFIGG 206
           N     KA  +K+ +ED  ID+ P  FI G
Sbjct: 153 NSDAWKKAEEQKKMTEDNNIDTVPTVFING 182


>gi|307945890|ref|ZP_07661226.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307771763|gb|EFO30988.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 191

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 11/93 (11%)

Query: 132 YWGFVSLLFNKQDDWIN----SKNYRDALLNM-----AKFAGFSKNDFDTCLNDQNILDD 182
           ++GF S L+ +Q D+ N     K ++D LLN+       FAGF+K++    +    +  D
Sbjct: 86  FFGFASYLYARQSDYYNGPFLHKTHQD-LLNLIADFAHDFAGFNKDEMLKLIGTNEVYTD 144

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
            +   + AS    + +TP FF+  +  +G  SE
Sbjct: 145 ARTPIRFASTK-GVWATPTFFLNSSDLVGKFSE 176


>gi|240139210|ref|YP_002963685.1| hypothetical protein MexAM1_META1p2638 [Methylobacterium extorquens
           AM1]
 gi|240009182|gb|ACS40408.1| Conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 253

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 70/174 (40%), Gaps = 16/174 (9%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT-GKLRYILREFP-L 110
           ++  D  IG     VT+VE+    C +C +  +       D  +K+  KLR +L+EFP L
Sbjct: 81  NSANDYVIGNPAGDVTLVEFFDYNCPYCRKARSDV-----DALVKSDPKLRVVLKEFPVL 135

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSKN 168
            + ST A  +A  A++ +  G       L    D  + ++   D    L +AK  G    
Sbjct: 136 GAASTDASRVAIAAKRGLPAGK------LREFHDKLMETRGRADGERALAVAKDFGLDPG 189

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
                + D+ +   ++     A +   I  TP F +   +  G +      + I
Sbjct: 190 KLRKDMQDEAVATVLRENAALADQ-LGITGTPAFVLNDGIIAGAVGVEALQRAI 242


>gi|328475307|gb|EGF46083.1| hypothetical protein LM220_06017 [Listeria monocytogenes 220]
          Length = 169

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 77/165 (46%), Gaps = 29/165 (17%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD------ 111
           + +G + APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +      
Sbjct: 17  IHVGDQTAPVKVMSFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKESLQR 75

Query: 112 -SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
            +V+   +  ++  E R        ++ +++KQD+W          L + + A + +++ 
Sbjct: 76  GNVTHRYLDYSKPEETR------ETINKIYSKQDEW--------GSLTLPEVATYMESEL 121

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDS--TPVFFIGGNLYLGDM 213
              L +Q   D+  A +K  +E  A +    P   +G ++ +  +
Sbjct: 122 G--LTEQ---DNKAASEKIVAEANAANVVFVPTVIVGEHILMSTL 161


>gi|325292692|ref|YP_004278556.1| DSBA oxidoreductase [Agrobacterium sp. H13-3]
 gi|325060545|gb|ADY64236.1| DSBA oxidoreductase [Agrobacterium sp. H13-3]
          Length = 255

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 67/175 (38%), Gaps = 21/175 (12%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT-GKLRYILREFPLDSVST 115
           D+++G  D  VT+VE+    C +C            D  +KT  K+R +L+EFP+    +
Sbjct: 87  DLALGNPDGDVTLVEFFDYNCGYCKRAMGDM-----DNILKTDKKVRVVLKEFPILGPES 141

Query: 116 VAVMLARCAEKRM-DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
           VA      A K +    Y  F   L   +      +   D+ + +A   G  + D    +
Sbjct: 142 VAAHRVSNAVKLLAPAKYPEFQRALLGGR-----GRANEDSAMEVATSLGLKEADIRKSM 196

Query: 175 ----NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
               ND  + +  K      +    I  TP + +G     G +      + I +M
Sbjct: 197 AENPNDAQVQETYK-----LANSLGITGTPSYIVGNEAVFGAVGADPLKEKIANM 246


>gi|315281794|ref|ZP_07870348.1| thioredoxin family protein [Listeria marthii FSL S4-120]
 gi|313614559|gb|EFR88149.1| thioredoxin family protein [Listeria marthii FSL S4-120]
          Length = 176

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 80/175 (45%), Gaps = 29/175 (16%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD------ 111
           + +G+  APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +      
Sbjct: 17  IHVGEASAPVKVMSFVNLRCPFCREWNEKSQDVLTE-YIQAGKIELIIKPFDKEKESLQR 75

Query: 112 -SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
            +V+   +  +R  E R        ++ +++ QD+W          L++++ A + +   
Sbjct: 76  GNVTHRYLDYSRPVETR------ETINKIYSTQDEW--------GSLSLSEVATYMETKL 121

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDS--TPVFFIGGNLYLGDMSEGVFSKIID 223
              L +Q   D+  A +K  +E  A +    P   +G +++   +S      ++D
Sbjct: 122 G--LTEQ---DNKAASEKIVAEANAANVVFVPTVIVGEHIFDEHISPEELRALLD 171


>gi|237786003|ref|YP_002906708.1| hypothetical protein ckrop_1427 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|237758915|gb|ACR18165.1| conserved hypothetical protein [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 257

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 73/184 (39%), Gaps = 26/184 (14%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR------------ 106
           S  + D P T+  Y  +TC HCA+  + T + L D  +  GKL   +R            
Sbjct: 71  SDAKSDVP-TVDLYDDLTCPHCADLESSTGQSLLD-AVNQGKLNLNIRTMNFLDKGQNGK 128

Query: 107 ---EFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
              + P     T    +A+  + ++   YW + + LF  Q+    S  Y D   ++AK  
Sbjct: 129 LDEQGPATKALTALYAVAKSGDGKL---YWNYRASLFENQEKVYGSWGY-DNFADLAKDM 184

Query: 164 GFSK---NDFDTCLNDQNILDDIKAGKKRASE--DFAIDSTPVFFIGGNLYLGDMSEGVF 218
           G SK    D       ++ L   +  +K+ +E  D  + S  VF  G  L L    +  F
Sbjct: 185 GASKGVVKDIKDAKYHKDALKMAEDNEKKLTEEGDGQVSSPRVFVNGKELKLQSSDQHAF 244

Query: 219 SKII 222
              +
Sbjct: 245 EDWV 248


>gi|158336381|ref|YP_001517555.1| DSBA thioredoxin domain-containing protein [Acaryochloris marina
           MBIC11017]
 gi|158306622|gb|ABW28239.1| DsbA oxidoreductase domain protein, putative [Acaryochloris marina
           MBIC11017]
          Length = 239

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 66/164 (40%), Gaps = 16/164 (9%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
           AL+ +SP+T      G +++P  +VE++   C  CA+  +    +L+       +  +  
Sbjct: 75  ALVGSSPTT------GAQNSPNLLVEFSDFQCPFCAQAASDVQAFLQQ---NPNQFTFTY 125

Query: 106 REFPLDSVS-TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
           +  PL S+              +  G +W +   LF +QD+ +  K Y D    +A+   
Sbjct: 126 KHLPLQSIHDQALSAAKAAWAAQQQGQFWSYHDALFTRQDE-LGDKLYTD----IAQQLK 180

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
                FD   N    L  I +    A +   I  TP F + G +
Sbjct: 181 LDLAQFDRDRNSDAALKAINSDLDLA-QSIGITGTPFFALNGQV 223


>gi|255024152|ref|ZP_05296138.1| hypothetical protein LmonocyFSL_13228 [Listeria monocytogenes FSL
           J1-208]
          Length = 177

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 80/173 (46%), Gaps = 28/173 (16%)

Query: 60  IGQK-DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS---- 114
           +G+K  APV ++ + ++ C  C E++ K+   L + YI+ GK+  I++ F  +  S    
Sbjct: 19  VGEKGRAPVKVISFVNLRCPFCREWNEKSKDVLTE-YIQAGKIELIIKPFDKEKESLQRG 77

Query: 115 --TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             T   +     EK  +      ++ +++KQD+W          L++ + A + K++   
Sbjct: 78  NVTHRYLDYSTPEKTRET-----INKIYSKQDEW--------GSLSLDEVAAYMKSELG- 123

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDS--TPVFFIGGNLYLGDMSEGVFSKIID 223
            L +Q   D+  A +K  +E  A +    P   +G +++   +S      ++D
Sbjct: 124 -LTEQ---DNKAASEKIVAEANAANVVFVPTVIVGEHIFDEHISPEELRSLLD 172


>gi|126739125|ref|ZP_01754819.1| 27 kDa outer membrane protein, putative [Roseobacter sp. SK209-2-6]
 gi|126719742|gb|EBA16450.1| 27 kDa outer membrane protein, putative [Roseobacter sp. SK209-2-6]
          Length = 256

 Score = 37.0 bits (84), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 70/173 (40%), Gaps = 14/173 (8%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  D  +T+VE+    C +C     +    +E      G +R++++EFP+   ++V    
Sbjct: 95  GNPDGDITLVEFMDYRCGYC----RRAAPEVEKLLAADGNIRFVIKEFPILGEASVLASR 150

Query: 121 ARCAEKRMDG--GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
              A K++ G   Y      L       + S+     L  + +            ++   
Sbjct: 151 FAVATKQLAGDDAYKQVHDALI-----ALGSEPNEVTLRRLGEGLSLDAGAIIAHMDSNE 205

Query: 179 ILDDIKAGKKRA-SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           + ++++  + RA ++  AI  TP F +G  L  G +       I++   +D++
Sbjct: 206 VTEELR--RTRALAQAMAISGTPSFVLGNELLRGYLPADQLQLIVEEQRRDNS 256


>gi|54027690|ref|YP_121931.1| hypothetical protein pnf1420 [Nocardia farcinica IFM 10152]
 gi|54019198|dbj|BAD60567.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 225

 Score = 37.0 bits (84), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 55/153 (35%), Gaps = 15/153 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED-KYIKTGKLRYILREFPLDSVSTVAVM 119
           G  DA VT+VE+    C  C       F  +E  +   + ++ +++R FP+ S       
Sbjct: 63  GPTDARVTLVEFLDFECEAC----RAMFPIMEQLRADYSDRVAFVVRYFPIPSHFNSGRA 118

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN-MAKFAGFSKNDFDTCLNDQN 178
                     G +      LF  Q DW   +   D +   +A   G     +D   ND  
Sbjct: 119 ARAAQAAADQGRFEQMYQRLFETQADWGEQRAPADEVFRGLAAELGLDLGAYDLAYNDP- 177

Query: 179 ILDDIKAGKKRASED----FAIDSTPVFFIGGN 207
                 A + RA  D      +  TP FF+ G 
Sbjct: 178 ----ATAARVRADFDEGLALGVVGTPSFFLNGE 206


>gi|256617655|ref|ZP_05474501.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256597182|gb|EEU16358.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
          Length = 150

 Score = 37.0 bits (84), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           IG+++APV M+E+ ++ C +C ++  ++ + L  + +K+GK+  I++ F
Sbjct: 19  IGERNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKVERIIKLF 66


>gi|322435347|ref|YP_004217559.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
 gi|321163074|gb|ADW68779.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
          Length = 352

 Score = 37.0 bits (84), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 62/151 (41%), Gaps = 11/151 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G KD  + +VE+A + C HC +      K L D + K      + + FPL  +   A   
Sbjct: 172 GAKD--LELVEFADLQCPHCKDAQ-AVMKRLVDDFPKA---HIVYQNFPLTEIHPFAFKA 225

Query: 121 AR---CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
           A    CA K+ +  ++ +   +++ Q   + +      L + A  AG        C    
Sbjct: 226 AAFGVCAAKKSNDVFFTYAQAVYDTQ-GALTADTGDQTLKDAAAKAGLDPAATAACAATD 284

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
               ++++  K A ED  +  TP+  I G L
Sbjct: 285 ATKGEVESSIKLA-EDVGVTETPMIAINGRL 314


>gi|110634065|ref|YP_674273.1| DSBA oxidoreductase [Mesorhizobium sp. BNC1]
 gi|110285049|gb|ABG63108.1| DSBA oxidoreductase [Chelativorans sp. BNC1]
          Length = 252

 Score = 37.0 bits (84), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 66/169 (39%), Gaps = 11/169 (6%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAV 118
           +G  D  VT+VE+    C +C     +    +E    K   LR++L+EFP L   S  A 
Sbjct: 94  VGNPDGDVTIVEFFDYNCGYC----KRALSDMEALVAKDKNLRFVLKEFPILGPDSHAAH 149

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
           ++++  +K     Y  F   L   Q      +   +  + +A   G  +      + D  
Sbjct: 150 VVSKAFQKLEPEKYGEFHRRLLGGQ-----GRANEETAIRIALELGADEAALREAMKDPA 204

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           I        + AS+   I  TP + +G  +  G +     ++ I +  Q
Sbjct: 205 IEASFSETYQLASQ-LQISGTPSYVLGNEVVYGALGADHLTEKIAAARQ 252


>gi|222085642|ref|YP_002544172.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221723090|gb|ACM26246.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 255

 Score = 37.0 bits (84), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 69/169 (40%), Gaps = 12/169 (7%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           DVSIG     +T+VE+    C +C          ++    +   +R++L+EFP+    +V
Sbjct: 88  DVSIGNPKGDITVVEFFDYNCTYC----RHALGDMDTLLKQDTNVRFVLKEFPILGPDSV 143

Query: 117 AVMLARCAEKRM-DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           A      A +++    Y  F   L        + +   D+ + +A   G ++      + 
Sbjct: 144 AASRVSDAFRKLAPEKYAAFHRALLGS-----DGRASEDSAIEVAGSLGVNEAAIRAEMA 198

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-EGVFSKIID 223
                D +KA  + A+ D  +  TP + IG     G +  E +  KI +
Sbjct: 199 KSPNTDSVKATYQLAT-DLNVTGTPAYVIGNETISGAIGLEAIQQKIAN 246


>gi|119384556|ref|YP_915612.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
 gi|119374323|gb|ABL69916.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
          Length = 250

 Score = 37.0 bits (84), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 61/161 (37%), Gaps = 16/161 (9%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVM 119
           G     VT+VE+    C  C        K +       G +R+IL+EFP L   S +A  
Sbjct: 88  GNPQGDVTLVEFIDYRCGVCKRVSPDVEKLIS----ADGNIRWILKEFPILTQESDMAAR 143

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
            A   ++             + K  D +        L ++ K AG    +    +N  N 
Sbjct: 144 FAVAVQQEAGPDA-------YKKAHDALMESRGPVNLESLTKLAGELGVEAQAVINRMNT 196

Query: 180 LDDIKA---GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +D+ A      + +E   I  TP F I G +  G  +EG+
Sbjct: 197 -EDVSAVLRKNHQLAEQMRIMGTPTFIIEGEMLRGMPAEGL 236


>gi|159184716|ref|NP_354339.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|159140004|gb|AAK87124.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 255

 Score = 37.0 bits (84), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 67/170 (39%), Gaps = 11/170 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D+++G  D  VT+VE+    C +C     +    +++      K+R +L+EFP+    +V
Sbjct: 87  DLALGNPDGDVTLVEFFDYNCGYC----KRAMGDMDNILKGDKKVRVVLKEFPILGPESV 142

Query: 117 AVMLARCAEKRM-DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           A      A K +    Y  F   L   +      +   D+ + +A   G  + D    + 
Sbjct: 143 AAHRVSNAVKLLAPAKYAEFQRTLLGGR-----GRANEDSAMEVATSLGLKEADIRKSMA 197

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           D      ++   K A+    I  TP + +G     G +      + I +M
Sbjct: 198 DNPNDAQVQETYKLAT-SLGITGTPSYIVGDEAVFGAVGADPLKEKIANM 246


>gi|257089197|ref|ZP_05583558.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|312904209|ref|ZP_07763371.1| conserved hypothetical protein [Enterococcus faecalis TX0635]
 gi|256998009|gb|EEU84529.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|310632305|gb|EFQ15588.1| conserved hypothetical protein [Enterococcus faecalis TX0635]
 gi|315578036|gb|EFU90227.1| conserved hypothetical protein [Enterococcus faecalis TX0630]
          Length = 172

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +    + IG+++APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNAETGLHIGERNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|313633892|gb|EFS00609.1| thioredoxin family protein [Listeria seeligeri FSL N1-067]
 gi|313638454|gb|EFS03637.1| thioredoxin family protein [Listeria seeligeri FSL S4-171]
          Length = 176

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           + +G K APV ++ + ++ C  C E++ K+ + L + +I+ GK+  I++ F  +  S   
Sbjct: 17  IHVGDKAAPVKVMSFINLRCPFCREWNEKSQEVLTE-FIQAGKIELIIKPFDKEKES--- 72

Query: 118 VMLARCAEKRMD----GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           +     A + +D          ++ +++ QD+W  S +  +    M    G ++ D
Sbjct: 73  LQRGNVAHRYLDYSTPEETRETINKIYSTQDEW-GSLSLEEVATYMESKLGLTEQD 127


>gi|289434320|ref|YP_003464192.1| hypothetical protein lse_0953 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170564|emb|CBH27104.1| conserved hypothetical protein [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 175

 Score = 36.6 bits (83), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           + +G K APV ++ + ++ C  C E++ K+ + L + +I+ GK+  I++ F  +  S   
Sbjct: 17  IHVGDKAAPVKVMSFINLRCPFCREWNEKSQEVLTE-FIQAGKIELIIKPFDKEKES--- 72

Query: 118 VMLARCAEKRMD----GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           +     A + +D          ++ +++ QD+W  S +  +    M    G ++ D
Sbjct: 73  LQRGNVAHRYLDYSTPEETRETINKIYSTQDEW-GSLSLEEVATYMESKLGLTEQD 127


>gi|90424359|ref|YP_532729.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisB18]
 gi|90106373|gb|ABD88410.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisB18]
          Length = 255

 Score = 36.6 bits (83), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 19/165 (11%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ++ + V++G KD  V+ VE+    C +C        + ++D      KL+ +L+EFP+  
Sbjct: 83  NSPRGVTLGNKDGDVSFVEFFDYNCGYCKRAMIDMLELMKD----DPKLKVVLKEFPVLG 138

Query: 113 VSTVAVMLARCAEKRMDG---GYWGFVSLLFN---KQDDWINSKNYRDALLNMAKFAGFS 166
             +V       A +  D     Y  F   L N   + D   +    +DA L+MA+     
Sbjct: 139 PGSVEAAQVAVAVRMQDPTGKKYLDFHQKLLNGRGQADKARSMAAAKDAGLDMARL---- 194

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           + D  +      I ++ K      +E   ++ TP + IG  + +G
Sbjct: 195 EKDIASPEVRATIEENFK-----LAEAMGMNGTPSYVIGKQVVVG 234


>gi|282166300|gb|ADA80317.1| Protein-disulfide isomerase, related to DsbA [Staphylococcus
           epidermidis]
          Length = 192

 Score = 36.6 bits (83), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
           S   ++  VT+VEY    C +C +F  K    LE +YI  GK+ Y
Sbjct: 18  SNNHQNKKVTIVEYGDYKCPYCKDFDTKVMPKLEKEYIDKGKVDY 62


>gi|39935508|ref|NP_947784.1| DSBA oxidoreductase [Rhodopseudomonas palustris CGA009]
 gi|192291099|ref|YP_001991704.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
 gi|39649360|emb|CAE27883.1| putative outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|192284848|gb|ACF01229.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
          Length = 255

 Score = 36.6 bits (83), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 67/162 (41%), Gaps = 13/162 (8%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-- 110
           ++ + V++G K+  VTMVE+    C +C        + ++D       L+ +L+EFP+  
Sbjct: 83  NSPRGVTVGNKNGDVTMVEFFDYNCGYCKRAMTDMMELMKD----DPNLKVVLKEFPVLG 138

Query: 111 -DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
             SV    V +A   +      Y  F   L   +      +  +   L  AK AG     
Sbjct: 139 PPSVEAAQVAIAVRMQDPTGKKYLDFHQKLLGGR-----GQADKARALAAAKDAGLDPAK 193

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            +  +N   +   I+   K A E   ++ TP + IG  + +G
Sbjct: 194 IEKDMNSPEVRATIEESFKLA-ESMGMNGTPSYVIGKQVVVG 234


>gi|170783054|ref|YP_001711388.1| hypothetical protein CMS_2750 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169157624|emb|CAQ02822.1| putative exported protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 305

 Score = 36.6 bits (83), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 69/182 (37%), Gaps = 19/182 (10%)

Query: 48  LAASPSTMKD-----VSIGQKDAPVTMVE-YASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           LAASP+   D     V    + A V  +  Y    C  C EF +     +E  ++++G  
Sbjct: 87  LAASPTQALDPEQDPVPTESQAAGVAHIRVYVDYLCTACKEFQDTNGAQME-GWLQSGAA 145

Query: 102 RYILREFPLDSVSTVAVML-----ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
              +    + +  + A  L     A C        +W F S LF +Q    ++    D +
Sbjct: 146 TVEIHPVAILTSKSQAYSLRAANAAACVADTAPDDFWAFNSALFAEQPAEQSTGLSDDRI 205

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS-------TPVFFIGGNLY 209
           + +A  AG   +D   C++DQ     + A   R  +    DS        P+  +G   Y
Sbjct: 206 VELAGQAGAGSSDVAKCISDQRFQSWVNAATDRVLDGDIPDSNVDKVVGAPIIVVGDRQY 265

Query: 210 LG 211
            G
Sbjct: 266 TG 267


>gi|254497558|ref|ZP_05110347.1| 27 kDa outer membrane protein [Legionella drancourtii LLAP12]
 gi|254353216|gb|EET11962.1| 27 kDa outer membrane protein [Legionella drancourtii LLAP12]
          Length = 261

 Score = 36.6 bits (83), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 11/145 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G     VT+VE+    C HC +      + ++    K   LR + +EFP+   S+     
Sbjct: 93  GNPKGNVTIVEFFDYQCIHCKKMSPVINRLIK----KDSDLRVVYKEFPIFGKSSELASK 148

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A  A   M G Y    S L    D  +N K     +++ AK  G     F   ++ +++ 
Sbjct: 149 AALAA-GMQGKYKEMHSALIG-VDKRLNDK----IIMDSAKSIGLDMKKFKVDMDSKDVA 202

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIG 205
           + ++A +  A E   +  TP F + 
Sbjct: 203 EVLEANRALA-EKLHLMGTPAFIVA 226


>gi|163747588|ref|ZP_02154936.1| DSBA oxidoreductase [Oceanibulbus indolifex HEL-45]
 gi|161379113|gb|EDQ03534.1| DSBA oxidoreductase [Oceanibulbus indolifex HEL-45]
          Length = 220

 Score = 36.6 bits (83), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 64/151 (42%), Gaps = 10/151 (6%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV-STVAV 118
           +G++DAPVT+VE+    C  C  FH    K +  +Y     +R ++R  P     S +A+
Sbjct: 53  LGREDAPVTIVEFFDPACEACRAFH-PIVKQILTQY--PDDVRVVMRYTPFHGEGSELAI 109

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            +   A  R+   +   +  L   Q  W  +     + ++ +A  AG         +   
Sbjct: 110 KVLEAA--RLQDVFVPVLEALLENQPAWASHGAPAAERIMEIAGAAGLDTAAAADQIRSP 167

Query: 178 NILDDIKAGKKRAS-EDFAIDSTPVFFIGGN 207
           +I+  +   + RA  E   I  TP FF+ G 
Sbjct: 168 SIVGVLN--QDRADVEAVGIQGTPTFFVNGK 196


>gi|154247427|ref|YP_001418385.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
 gi|154161512|gb|ABS68728.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
          Length = 266

 Score = 36.2 bits (82), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 40  GVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG 99
            V D R LL  SP   + +  G     VT+VE+    C +C     K    L+D   +  
Sbjct: 85  AVGDVRELLVNSP---RGIVAGNPKGDVTLVEFFDYNCGYC----KKALSDLQDLIKQDP 137

Query: 100 KLRYILREFPL 110
            LR +L+EFP+
Sbjct: 138 NLRVVLKEFPV 148


>gi|324997934|ref|ZP_08119046.1| DSBA oxidoreductase [Pseudonocardia sp. P1]
          Length = 235

 Score = 36.2 bits (82), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/144 (20%), Positives = 53/144 (36%), Gaps = 7/144 (4%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-KLRYILREFPLDSVSTVAVMLARCAE 125
           V +VE+    C  C       +  +E    + G ++  +LR FP+ S +           
Sbjct: 78  VDLVEFLDFECEAC----RAAYPAVEQLRAEYGDRVDVVLRYFPVPSHANAERAARAAEA 133

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSK-NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
               G +    +L+F  Q +W   +    D     A+  G     +D    D    + ++
Sbjct: 134 AARQGRHEAMYALMFETQTEWGEQQVPMDDRFRGYAERIGLDMGRYDADYTDPATAERVE 193

Query: 185 AGKKRASEDFAIDSTPVFFIGGNL 208
           A  +R      +  TP FF+ G +
Sbjct: 194 A-DRRDGLALGVRGTPTFFVNGRI 216


>gi|27379405|ref|NP_770934.1| outer membrane protein [Bradyrhizobium japonicum USDA 110]
 gi|27352556|dbj|BAC49559.1| outer membrane protein [Bradyrhizobium japonicum USDA 110]
          Length = 255

 Score = 36.2 bits (82), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 69/167 (41%), Gaps = 8/167 (4%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
           + V +G K+  VT VE+    C +C     +    + D      KL+ +L+EFP+ S  +
Sbjct: 86  RQVVLGNKEGDVTFVEFFDYNCGYC----KRAMGDMLDLMKSDPKLKVVLKEFPVLSQGS 141

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           V       A +  D    G   L F+++         +   L  AK AG      +  L 
Sbjct: 142 VEAAQVAVAVRMQD--PTGKKYLDFHQKLLGGRGAADKARALQAAKEAGLDTAKIEKDLA 199

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-EGVFSKI 221
              +   I+   K A E   ++ TP + IG  + +G +  EG+  KI
Sbjct: 200 SPEVRATIEENFKLA-EAMGMNGTPSYVIGKQIVIGAIGLEGLKEKI 245


>gi|222148335|ref|YP_002549292.1| outer membrane protein [Agrobacterium vitis S4]
 gi|221735323|gb|ACM36286.1| outer membrane protein [Agrobacterium vitis S4]
          Length = 274

 Score = 36.2 bits (82), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 64/157 (40%), Gaps = 13/157 (8%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK-LRYILREFPLDSVST 115
           D+ +G     VT+VE+    C +C            D  +KT K +R++L+EFP+    +
Sbjct: 107 DIVLGNPKGDVTIVEFFDYNCGYCRHALADM-----DTILKTDKNVRFVLKEFPILGPDS 161

Query: 116 VAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
           VA   +A    K     Y  F   L   +      +  +++ ++     G S+      +
Sbjct: 162 VAAHRVADAFRKLAPEKYSDFHHALLGSE-----GRATQESAIDAGVMLGVSEAALRKEM 216

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            D      +K   + A +D  I+ TP + IG  L  G
Sbjct: 217 TDSPNDTSVKKVYQLA-QDLGINGTPAYVIGNELVSG 252


>gi|300779964|ref|ZP_07089820.1| DSBA oxidoreductase [Corynebacterium genitalium ATCC 33030]
 gi|300534074|gb|EFK55133.1| DSBA oxidoreductase [Corynebacterium genitalium ATCC 33030]
          Length = 308

 Score = 36.2 bits (82), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 67/173 (38%), Gaps = 39/173 (22%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +S G  DAPV + E+    C +C     +T + L D+Y+  G +R    + P    ++VA
Sbjct: 133 MSQGALDAPVVIAEFTDWECPYCIRHAAETEQELIDEYVDAGLVRIEWNDMPTQGPNSVA 192

Query: 118 VML----------------ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
                              A  AE    GG+ GF        DD++        + ++AK
Sbjct: 193 AAKAGRAAAEQGMFTEYKKAYMAEAAERGGHPGF------SIDDYVRFAGTA-GVPDLAK 245

Query: 162 FAGFSKND-FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF-----FIGGNL 208
           F   +++D +D  L                +++  I  TP F     FIGG L
Sbjct: 246 FREDAESDKYDEALEK----------SLEYAQELGITGTPGFVVNTEFIGGAL 288


>gi|260433395|ref|ZP_05787366.1| dsba oxidoreductase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417223|gb|EEX10482.1| dsba oxidoreductase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 252

 Score = 35.8 bits (81), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 66/167 (39%), Gaps = 12/167 (7%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  D  +T+VE+    C +C     +    ++    + G +R++++EFP+   ++V    
Sbjct: 91  GNPDGDITLVEFMDYRCGYC----RRAAPEVDALLAQDGNIRFVIKEFPILGDASVLSSR 146

Query: 121 ARCAEKRMDG--GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
              A K + G   Y      L     D         AL  +A   G   +     ++   
Sbjct: 147 FAIATKHVAGDDAYKQVHDALMEFGGDVTEV-----ALRRIADGLGLDSDAIVAAMDSDA 201

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + D+I A  +  ++   I  TP F +G  +  G +      +I D++
Sbjct: 202 VTDEI-AQTRELAQRLKISGTPSFVLGTEMLRGYLKVDQMQQIADAV 247


>gi|316934400|ref|YP_004109382.1| DSBA oxidoreductase [Rhodopseudomonas palustris DX-1]
 gi|315602114|gb|ADU44649.1| DSBA oxidoreductase [Rhodopseudomonas palustris DX-1]
          Length = 255

 Score = 35.8 bits (81), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 68/162 (41%), Gaps = 13/162 (8%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-- 110
           S+ + V++G K+  VTMVE+    C +C        + ++D       L+ +L+EFP+  
Sbjct: 83  SSPRGVTLGNKNGDVTMVEFFDYNCGYCKRAMVDMLELMKD----DPNLKVVLKEFPVLG 138

Query: 111 -DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
             SV    V +A   +      Y  F   L + +      +  +   L  AK AG     
Sbjct: 139 PPSVEAAQVGIAVRMQDPSGKKYLDFHQKLLSGR-----GQADKARALAAAKEAGLDPAK 193

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            +  +N   +   I+   K A E   ++ TP + IG  + +G
Sbjct: 194 LEKDMNSPEVRATIEESFKLA-ESMGMNGTPSYVIGKQVVVG 234


>gi|259506161|ref|ZP_05749063.1| thioredoxin domain protein (DSBA) [Corynebacterium efficiens
           YS-314]
 gi|259166238|gb|EEW50792.1| thioredoxin domain protein (DSBA) [Corynebacterium efficiens
           YS-314]
          Length = 253

 Score = 35.8 bits (81), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 87/238 (36%), Gaps = 35/238 (14%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           +V +   I V+ GIV   I       R  S     P P+ VV      + +   ++D S 
Sbjct: 41  IVWALLAIVVITGIVAFLIG------RADS--TSAPAPETVV------SDAGQVVRDNSR 86

Query: 61  GQKDAP---VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
               AP     +VE+    C  C   +    + L ++Y  T  + ++ R FPL       
Sbjct: 87  VLSQAPNEKAVLVEFLDFECEACRAAY-PFVEELREEYSDT--VTFVNRYFPLQGHRNSM 143

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN-DFDTCLND 176
                       G Y      +F  Q +W  S   + A+     F GF+++   D    D
Sbjct: 144 PAAVAVEAAAQQGQYEAMYHRMFETQSEWGESAEDKSAV-----FRGFAEDLGLDMAAYD 198

Query: 177 QNILDDIKAGKKRASEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             + D   A ++R   D A      +  TP FF+ G L   D  E  F   +D+   D
Sbjct: 199 AAVAD--PATEERVRLDVADGTALGVGGTPTFFLDGQLLTPDSLEQ-FRAEVDAAAAD 253


>gi|148255586|ref|YP_001240171.1| hypothetical protein BBta_4209 [Bradyrhizobium sp. BTAi1]
 gi|146407759|gb|ABQ36265.1| putative outer membrane protein of unknown function with DSBA
           oxidoreductase domain [Bradyrhizobium sp. BTAi1]
          Length = 254

 Score = 35.8 bits (81), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 72/171 (42%), Gaps = 18/171 (10%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVS 114
           + V +G KD  VT VE+    C +C    N   + ++       KL+ +L+EFP L   S
Sbjct: 87  RGVVLGNKDGDVTFVEFFDYNCGYCKRAMNDMMELMKS----DPKLKVVLKEFPVLSQGS 142

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFN--KQDDWINSKNYRDAL-LNMAKFAGFSKNDFD 171
             A  +A     +    Y  F   L     Q D  ++      L L+MA+     + D  
Sbjct: 143 VEAAQVAVAVRMQAPQKYLDFHQKLLGGRGQADKAHALAVAKELGLDMARV----EKDMA 198

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS-EGVFSKI 221
           +      I ++ K      +E+  ++ TP + IG  + +G +  EG+  KI
Sbjct: 199 SPEAKATIEENFK-----LAEEMGMNGTPSYVIGKQVVIGAVGVEGLREKI 244


>gi|294628384|ref|ZP_06706944.1| conserved hypothetical protein [Streptomyces sp. e14]
 gi|292831717|gb|EFF90066.1| conserved hypothetical protein [Streptomyces sp. e14]
          Length = 196

 Score = 35.8 bits (81), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 65/162 (40%), Gaps = 9/162 (5%)

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           PV  V +  + C  C    +   + L  +Y    +LR  LR FPL+             E
Sbjct: 23  PVLDV-WCELQCPDCRSALDD-LRALRARYGDRLELR--LRHFPLEKHKHAFAAAQAAEE 78

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND-QNILDDIK 184
               G  W +V  +  + ++    +     L+  A+  G    +FDT L D ++IL  I 
Sbjct: 79  AAEQGRLWPYVEAVLGRVEEL--DRRGESFLVETARELGLDAEEFDTALIDGRHIL--IV 134

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
              +   +   +  TP + +GG    G  S+    + +++++
Sbjct: 135 DADQAEGKAIGVTGTPTYVVGGERLDGGKSQEGLRERVEAIV 176


>gi|23578007|ref|NP_702954.1| hypothetical protein CE3P021 [Corynebacterium efficiens YS-314]
 gi|23494833|dbj|BAC19796.1| putative membrane protein [Corynebacterium efficiens YS-314]
          Length = 235

 Score = 35.8 bits (81), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 87/238 (36%), Gaps = 35/238 (14%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           +V +   I V+ GIV   I       R  S     P P+ VV      + +   ++D S 
Sbjct: 23  IVWALLAIVVITGIVAFLIG------RADS--TSAPAPETVV------SDAGQVVRDNSR 68

Query: 61  GQKDAP---VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
               AP     +VE+    C  C   +    + L ++Y  T  + ++ R FPL       
Sbjct: 69  VLSQAPNEKAVLVEFLDFECEACRAAY-PFVEELREEYSDT--VTFVNRYFPLQGHRNSM 125

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN-DFDTCLND 176
                       G Y      +F  Q +W  S   + A+     F GF+++   D    D
Sbjct: 126 PAAVAVEAAAQQGQYEAMYHRMFETQSEWGESAEDKSAV-----FRGFAEDLGLDMAAYD 180

Query: 177 QNILDDIKAGKKRASEDFA------IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             + D   A ++R   D A      +  TP FF+ G L   D  E  F   +D+   D
Sbjct: 181 AAVAD--PATEERVRLDVADGTALGVGGTPTFFLDGQLLTPDSLEQ-FRAEVDAAAAD 235


>gi|260575215|ref|ZP_05843215.1| DSBA oxidoreductase [Rhodobacter sp. SW2]
 gi|259022475|gb|EEW25771.1| DSBA oxidoreductase [Rhodobacter sp. SW2]
          Length = 246

 Score = 35.8 bits (81), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           G  D  +T+VE+    C +C     K +  +E+     G +R++++EFP+
Sbjct: 87  GNPDGNITIVEFTDYRCGYC----RKAYDEVEELVKSDGNIRFVVKEFPI 132


>gi|300861967|ref|ZP_07108047.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|300848492|gb|EFK76249.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|315145271|gb|EFT89287.1| conserved hypothetical protein [Enterococcus faecalis TX2141]
 gi|315161969|gb|EFU05986.1| conserved hypothetical protein [Enterococcus faecalis TX0645]
          Length = 172

 Score = 35.4 bits (80), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +D   + A   +    + IG+ +APV M+E+ ++ C +C ++  ++ + L  + +K+GK+
Sbjct: 1   MDISVIDATKVNAETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELL-AQSVKSGKV 59

Query: 102 RYILREF 108
             I++ F
Sbjct: 60  ERIIKLF 66


>gi|262195056|ref|YP_003266265.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
 gi|262078403|gb|ACY14372.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
          Length = 306

 Score = 35.4 bits (80), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 66/173 (38%), Gaps = 9/173 (5%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +A VT+V+     C  C E    T   + ++Y K   +R + + + +          
Sbjct: 119 GPDNAKVTVVKAFEFACPFC-ERSRATMDQIREEYGKD--VRIVYKHYIVHHGQATIPAQ 175

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNI 179
           A CA   + G +     L++ K   +   +N  +D +L  AK AG     F   +N    
Sbjct: 176 AACAAG-LQGKWRTMEQLIWEK--GFKAGRNLSQDNMLKQAKRAGLRMKKFRADMN--GA 230

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             +I    ++      +  TP FFI G    G      F  +ID  +  +  R
Sbjct: 231 CKEIVQNDQQQMAKVGVVGTPGFFINGRFLAGAQPFPAFKALIDEELAKANER 283


>gi|149202649|ref|ZP_01879621.1| 27 kDa outer membrane protein, putative [Roseovarius sp. TM1035]
 gi|149143931|gb|EDM31965.1| 27 kDa outer membrane protein, putative [Roseovarius sp. TM1035]
          Length = 254

 Score = 35.4 bits (80), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 66/180 (36%), Gaps = 38/180 (21%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  D  +T+VE+    C +C   H      L       G +R+I++EFP+  +   +VM 
Sbjct: 95  GNLDGDLTLVEFMDYRCSYCRRAHEDVKGLL----AADGNIRFIIKEFPI--LGEESVMA 148

Query: 121 ARCA-EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           +R A   R   G   + S+               DAL  MA     S+  F T L D   
Sbjct: 149 SRFAIATRQVAGDEAYASV--------------HDAL--MAYSGSMSETGF-TRLADSLG 191

Query: 180 LD--------------DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           LD               + A      +   I  TP F +G  +  G + +    +I D +
Sbjct: 192 LDAPAIIAEMNSDAVTQVIAANHALGQRMQISGTPSFVMGDQMLRGYLPQDAMQRIADEI 251


>gi|312116107|ref|YP_004013703.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
 gi|311221236|gb|ADP72604.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
          Length = 275

 Score = 35.0 bits (79), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 82/195 (42%), Gaps = 26/195 (13%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLE-DKYIKTGKL 101
           +F   L+   S +  ++IGQ D  VT+VE+    C +C     +  K L+ DK     K+
Sbjct: 84  EFYKSLSGLKSELAPLTIGQGD--VTLVEFFDYNCGYCRHALPEVVKLLDADK-----KV 136

Query: 102 RYILREFP-LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
           + +  E+P L   S  A  +A  A K+  G Y+ F   +F         +  +++ L +A
Sbjct: 137 KVVFMEYPILSQGSADASKVALAAAKQ--GKYFEFHKAMFA------AGRANKESALKVA 188

Query: 161 KFAGFS----KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
           +  G      K D  +   +  +    + GK+       +D TP F +G  +  G     
Sbjct: 189 EQIGLDMEKVKADSASPETEALVAKIGEIGKR-----MFVDGTPTFVVGDKVTPGAADYD 243

Query: 217 VFSKIIDSMIQDSTR 231
              K+++   +D  +
Sbjct: 244 ALKKVVEDTRKDGCK 258


>gi|320107733|ref|YP_004183323.1| DSBA oxidoreductase [Terriglobus saanensis SP1PR4]
 gi|319926254|gb|ADV83329.1| DSBA oxidoreductase [Terriglobus saanensis SP1PR4]
          Length = 315

 Score = 35.0 bits (79), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 60/153 (39%), Gaps = 23/153 (15%)

Query: 23  FFYTRKGSALNELPIPDGVVDF--------RALLAASPSTMKDVSIGQKDAPVTMVEYAS 74
           FF T  G       I D V DF        RA+L A        + G++   + +VE+A 
Sbjct: 105 FFVTPDGKHA----ISDAVFDFGEKPFAATRAMLTARADGPARGAAGKE---LLLVEFAD 157

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA---RCAEKRMDGG 131
           M C HC +        ++D      K R + + FPL  +   A   A    C   +    
Sbjct: 158 MQCPHCKDAQAT----MDDLVRDFPKARVVYQNFPLTEIHPFAAQAASYGNCIADKSPSA 213

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
           ++ ++  +F+ Q + +N +     L N    AG
Sbjct: 214 FYVYLKDVFDHQ-EALNPEAGEATLKNAVTKAG 245


>gi|331696546|ref|YP_004332785.1| DSBA oxidoreductase [Pseudonocardia dioxanivorans CB1190]
 gi|326951235|gb|AEA24932.1| DSBA oxidoreductase [Pseudonocardia dioxanivorans CB1190]
          Length = 185

 Score = 35.0 bits (79), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 69/178 (38%), Gaps = 26/178 (14%)

Query: 50  ASPSTMK-DVSIGQKD-------APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG-K 100
           A+ ST + D  IG  D       AP ++VEY    C +C       +  +E+   + G +
Sbjct: 4   ATISTFRLDPPIGSYDHLRGVLSAPYSLVEYGDFECPYC----RAAYPVVEEVIHRLGDQ 59

Query: 101 LRYILREFPLDSVSTVAV-MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           L +  R FPL  +   ++          + G +W   + L+   +  +   + R      
Sbjct: 60  LVFAFRHFPLYELHPFSLAAATAAEGAAVKGQFWAMHAKLYAGDEPHLTQPDLR----RY 115

Query: 160 AKFAGFSKNDF---DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           A+  G         +T   +  +  D  +G +       +  TP FF+ G L+ G +S
Sbjct: 116 AEEIGIPPEKVLWPNTRFVEDRVESDFNSGVRS-----GVRGTPSFFVNGVLHDGPVS 168


>gi|153007819|ref|YP_001369034.1| DSBA oxidoreductase [Ochrobactrum anthropi ATCC 49188]
 gi|151559707|gb|ABS13205.1| DSBA oxidoreductase [Ochrobactrum anthropi ATCC 49188]
          Length = 204

 Score = 35.0 bits (79), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 62/165 (37%), Gaps = 27/165 (16%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL-DSVSTVAV 118
           +G  +  VT+VEY    C +C + H +  + +++     G +R +++++ +    S  A 
Sbjct: 45  LGNPNGNVTIVEYFDYQCPYCKKGHGELMRVVKN----DGNVRLVMKDWIIFGDTSAYAA 100

Query: 119 MLARCAEKRMDGGYWGFVSLLF--------NKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
            L   AEK   G Y   +  L          + D  +       A LN A  A       
Sbjct: 101 RLVLAAEK--SGNYVKAMEALMATPGRLTPEQVDTALKKGGLDPAKLNAAYKA------- 151

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
                D   ++ I        E F    TP F IG  LY G M E
Sbjct: 152 -----DSKRINAILERNMDQGEAFNFGGTPSFVIGTKLYGGVMKE 191


>gi|66361337|pdb|1Z6M|A Chain A, Structure Of Conserved Protein Of Unknown Function From
           Enterococcus Faecalis V583
          Length = 175

 Score = 35.0 bits (79), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D   + A   +T   + IG+ +APV  +E+ ++ C +C ++  ++ + L  + +K+GK+ 
Sbjct: 5   DISVIDATKVNTETGLHIGESNAPVKXIEFINVRCPYCRKWFEESEELL-AQSVKSGKVE 63

Query: 103 YILREF 108
            I++ F
Sbjct: 64  RIIKLF 69


>gi|240850672|ref|YP_002972072.1| outer membrane protein [Bartonella grahamii as4aup]
 gi|240267795|gb|ACS51383.1| outer membrane protein [Bartonella grahamii as4aup]
          Length = 290

 Score = 34.7 bits (78), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 67/169 (39%), Gaps = 11/169 (6%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVST 115
           D  +G  +    +V +    C +C      ++ ++ED   +   L+ I+++ P L S S 
Sbjct: 130 DAVLGNPNGKKVLVNFFDYNCGYCKS----SYSHIEDLIKEYPDLKVIIKDLPILSSDSM 185

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
            A  +A    K+    Y  F   L   Q     +K      + +A   G  +      + 
Sbjct: 186 AAHTVAYAFRKQFPEKYPQFHKTLLMYQGRANEAK-----AIKVAVSLGEDETKLRNAIK 240

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           D  + +  K   + AS+   I  TP + IG  +++G   +    + ID+
Sbjct: 241 DPTLQNAFKENIQIASK-LHITGTPSYIIGNKIFIGAARQDTLKQAIDN 288


Searching..................................................done


Results from round 2




>gi|254780477|ref|YP_003064890.1| DSBA oxidoreductase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040154|gb|ACT56950.1| DSBA oxidoreductase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 232

 Score =  335 bits (859), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 232/232 (100%), Positives = 232/232 (100%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI
Sbjct: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML
Sbjct: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL
Sbjct: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
Sbjct: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232


>gi|315122067|ref|YP_004062556.1| DSBA oxidoreductase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495469|gb|ADR52068.1| DSBA oxidoreductase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 228

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 152/226 (67%), Positives = 184/226 (81%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M T +IG L   V+  + S FFYT+  ++ N LP+P  ++D   LLAASP  M+++SIG+
Sbjct: 1   MKTAKIGALCIAVVFVVGSVFFYTKSRNSSNALPLPYSMIDVDILLAASPHAMEEISIGR 60

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           +DAP+T+VEYASMTCFHCAEFHNKTFK +EDKYIKTGK+R+I REFPLDSVST A MLAR
Sbjct: 61  QDAPLTIVEYASMTCFHCAEFHNKTFKKIEDKYIKTGKVRFIFREFPLDSVSTAASMLAR 120

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           CAE R+ GGY+GFVS+LF KQ+DWI SKNYR+++ NMAK AGFS+NDFD+CL +Q+ILDD
Sbjct: 121 CAENRVKGGYFGFVSMLFKKQNDWIESKNYRESMFNMAKIAGFSRNDFDSCLGNQSILDD 180

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           IK G K A E   I+STP FFIGGNLYLGDMSE VFSKIIDSMI+ 
Sbjct: 181 IKTGNKIAVEKLLINSTPSFFIGGNLYLGDMSEEVFSKIIDSMIEK 226


>gi|15888143|ref|NP_353824.1| hypothetical protein Atu0800 [Agrobacterium tumefaciens str. C58]
 gi|15155781|gb|AAK86609.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 226

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 99/226 (43%), Positives = 143/226 (63%), Gaps = 7/226 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASY--FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           ++ +R  +LGG+ L  IA+   F +T   +   ELP   G VD  A++   P  + + ++
Sbjct: 6   LTISRRSLLGGVALAAIATALPFAFTPGIAEAQELPESTGDVDMAAVM--KPGPLPEAAL 63

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APV +VEY SMTC HCA FHNKTF+ ++ KYI TGK+ ++LREFP D  +  A ML
Sbjct: 64  GDANAPVKIVEYMSMTCPHCANFHNKTFEEIKKKYIDTGKVYFVLREFPFDPRAAAAFML 123

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCA +   G Y+ FVS+LF +Q  W  +++ R ALL M+K AGFS+  F+ CL +Q +L
Sbjct: 124 ARCAPE---GQYFPFVSMLFKQQQSWAVAQDARAALLQMSKMAGFSQESFEACLTNQKLL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           DD+ A  +R + +F ++STP F I G  Y GDMS    S +ID ++
Sbjct: 181 DDVNATMQRGATEFGVNSTPTFIINGKKYAGDMSVETMSAVIDKLL 226


>gi|227821137|ref|YP_002825107.1| putative disulfide bond formation protein D [Sinorhizobium fredii
           NGR234]
 gi|227340136|gb|ACP24354.1| putative disulfide bond formation protein D [Sinorhizobium fredii
           NGR234]
          Length = 268

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 95/207 (45%), Positives = 135/207 (65%), Gaps = 5/207 (2%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
           A          A  ELP  +G VD + L+   P  + ++++G+ +APVT+VEY SMTC H
Sbjct: 67  AGTEVAQAAAPAKAELPQSEGSVDVQKLM--EPGALPEMALGEANAPVTIVEYMSMTCPH 124

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           CA FHNKTF  ++ KYI +GK+R+I+REFP D  +  A MLARCA +   G Y+  VS+L
Sbjct: 125 CANFHNKTFDAIKAKYIDSGKVRFIVREFPFDPRAAAAFMLARCAPE---GQYFPMVSML 181

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F +Q+ W  ++N RDALL M+K AGF++  F+ CL +Q +LDD+ A  +R +++F + ST
Sbjct: 182 FKQQEQWAAAENGRDALLQMSKLAGFTQESFEACLTNQKLLDDVNAVMQRGAKEFGVKST 241

Query: 200 PVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           P FF+ G  Y GDMS  V S +IDS +
Sbjct: 242 PTFFVNGEHYSGDMSVDVLSALIDSKL 268


>gi|325292182|ref|YP_004278046.1| disulfide bond formation protein D [Agrobacterium sp. H13-3]
 gi|325060035|gb|ADY63726.1| putative disulfide bond formation protein D [Agrobacterium sp.
           H13-3]
          Length = 226

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 97/226 (42%), Positives = 141/226 (62%), Gaps = 7/226 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASY--FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           ++ +R  +LGG+ L  +A+   F +T   +   ELP   G VD  A+L   P  + + ++
Sbjct: 6   LTISRRSLLGGVALAALATALPFAFTPGVAQAQELPESTGDVDMAAVL--KPGPLPEAAL 63

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  +APV +VEY SMTC HCA FHNKTF  ++ KYI TGK  +++REFP D  +  A ML
Sbjct: 64  GDANAPVKIVEYMSMTCPHCANFHNKTFDEIKKKYIDTGKAYFVIREFPFDPRAAAAFML 123

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCA +   G Y+ FVS+LF +Q  W  +++ R ALL ++K AGFS+  F+ CL +Q +L
Sbjct: 124 ARCAPE---GQYFPFVSMLFKQQQSWATAQDARAALLQLSKMAGFSQESFEACLTNQKLL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           DD+ A  +R + +F ++STP F I G  Y GDMS    S +ID ++
Sbjct: 181 DDVNATMQRGATEFGVNSTPTFIINGKKYAGDMSVETMSAVIDKLL 226


>gi|150395769|ref|YP_001326236.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419]
 gi|1