PSIBLAST alignment of GI: 254780477 and protein with PDB id: 1acv

>gi|2624857|pdb|1ACV|A Chain A, Dsba Mutant H32s Length = 189
>gi|2624858|pdb|1ACV|B Chain B, Dsba Mutant H32s Length = 189
 Score = 50.0 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 50/167 (29%), Gaps = 6/167 (3%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
             +T++    G       ++E+ S  C  C +F          K      ++        
Sbjct: 8   QYTTLEKPVAGAP----QVLEFFSFFCPSCYQFEEVLHISDNVKKKLPEGVKMTKYHVNF 63

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
                   +        M  G    V++   +      +      + ++   AG    ++
Sbjct: 64  MGGDLGKDLTQ-AWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEY 122

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
           D   N   ++  + A +++A+ D  +   P  F+ G   L       
Sbjct: 123 DAAWNSF-VVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDT 168