PSIBLAST alignment of GI: 254780477 and protein with PDB id: 1ti1

>gi|66360168|pdb|1TI1|A Chain A, Crystal Structure Of A Mutant Dsba Length = 189
>gi|66360211|pdb|1U3A|A Chain A, Mutant Dsba Length = 189
>gi|66360212|pdb|1U3A|B Chain B, Mutant Dsba Length = 189
>gi|66360213|pdb|1U3A|D Chain D, Mutant Dsba Length = 189
>gi|66360214|pdb|1U3A|E Chain E, Mutant Dsba Length = 189
>gi|119389880|pdb|2HI7|A Chain A, Crystal Structure Of Dsba-Dsbb-Ubiquinone Complex Length = 189
>gi|215261263|pdb|3E9J|B Chain B, Structure Of The Charge-Transfer Intermediate Of The Transmembrane Redox Catalyst Dsbb Length = 189
 Score = 50.4 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 50/167 (29%), Gaps = 6/167 (3%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
             +T++    G       ++E+ S  C H  +F          K      ++        
Sbjct: 8   QYTTLEKPVAGAP----QVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNF 63

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
                   +        M  G    V++   +      +      + ++   AG    ++
Sbjct: 64  MGGDLGKDLTQ-AWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEY 122

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
           D   N   ++  + A +++A+ D  +   P  F+ G   L       
Sbjct: 123 DAAWNSF-VVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDT 168