PSIBLAST alignment of GI: 254780477 and protein with PDB id: 3bd2

>gi|162330238|pdb|3BD2|A Chain A, Crystal Structure Of Staphylococcus Aureus Dsba E96q Length = 186
 Score = 73.5 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 53/171 (30%), Gaps = 5/171 (2%)

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
            K+    +V Y    C +C E   K    L   YI   K+ Y           ++    A
Sbjct: 8   SKNGKPLVVVYGDYKCPYCKELDEKVMPKLRKNYIDNHKVEYQFVNLAFLGKDSIVGSRA 67

Query: 122 RCAEKRMDGGYW-GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
             A        +  F   LF  Q D       ++ L    K     K   +  + D    
Sbjct: 68  SHAVLMYAPKSFLDFQKQLFAAQQDQNKEWLTKELLDKHIKQLHLDKETENKIIKDYKTK 127

Query: 181 D----DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           D          K+ ++D  I +TP  FI G           + K++   I+
Sbjct: 128 DSKSWKAAEKDKKIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLLKDKIK 178