PSIBLAST alignment of GI: 254780477 and protein with PDB id: 3c7m

>gi|194320016|pdb|3C7M|A Chain A, Crystal Structure Of Reduced Dsbl Length = 195
>gi|194320017|pdb|3C7M|B Chain B, Crystal Structure Of Reduced Dsbl Length = 195
 Score = 51.2 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 62/182 (34%), Gaps = 14/182 (7%)

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA- 121
            +A  T+++  S  C  C ++       + +K            E   +     + + A 
Sbjct: 15  PNADKTLIKVFSYACPFCYKYDKAVTGPVSEKVKDIVAFTPFHLETKGEYGKQASEVFAV 74

Query: 122 ------------RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
                         A  +     + + +   +K++ W + K+    +      AG S+ D
Sbjct: 75  LINKDKAAGISLFDANSQFKKAKFAYYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQAD 134

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           F+  L +  + + ++  K    +   I   P + + G   +   S      + D + + +
Sbjct: 135 FEAALKEPAVQETLEKWKAS-YDVAKIQGVPAYVVNGKYLIYTKSIKSIDAMADLIRELA 193

Query: 230 TR 231
           ++
Sbjct: 194 SK 195