PSIBLAST alignment of GI: 254780477 and protein with PDB id: 3dks

>gi|237640481|pdb|3DKS|A Chain A, Dsba Substrate Complex Length = 189
>gi|237640482|pdb|3DKS|B Chain B, Dsba Substrate Complex Length = 189
>gi|237640483|pdb|3DKS|C Chain C, Dsba Substrate Complex Length = 189
>gi|237640484|pdb|3DKS|D Chain D, Dsba Substrate Complex Length = 189
 Score = 52.3 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/167 (13%), Positives = 51/167 (30%), Gaps = 6/167 (3%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
             +T++    G       ++E+ S  C HC +F          K      ++        
Sbjct: 8   QYTTLEKPVAGAP----QVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNF 63

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
                   +        M  G    V++   +      +      + ++   AG    ++
Sbjct: 64  MGGDLGKDLTQ-AWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEY 122

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
           D   N   ++  + A +++A+ D  +   P  F+ G   L       
Sbjct: 123 DAAWNSF-VVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDT 168