PSIBLAST alignment of GI: 254780477 and protein with PDB id: 3f4t

>gi|225734106|pdb|3F4T|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1 C97aC146A Length = 226
 Score = 80.4 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 82/187 (43%), Gaps = 14/187 (7%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD   
Sbjct: 29  PNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRG 88

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTC 173
                            Y+ F   +FN  D W          L  +A  +   ++ F+  
Sbjct: 89  L--KAAMLSHAYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQA 146

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFI-----------GGNLYLGDMSEGVFSKII 222
           +ND+ I+D I   K  A     I +TP+FFI               + G      F+ +I
Sbjct: 147 INDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVI 206

Query: 223 DSMIQDS 229
           D +   +
Sbjct: 207 DKLYGKA 213