BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780477|ref|YP_003064890.1| DSBA oxidoreductase
[Candidatus Liberibacter asiaticus str. psy62]
         (232 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780477|ref|YP_003064890.1| DSBA oxidoreductase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040154|gb|ACT56950.1| DSBA oxidoreductase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 232

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 232/232 (100%), Positives = 232/232 (100%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI
Sbjct: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML
Sbjct: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL
Sbjct: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
Sbjct: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232


>gi|15888143|ref|NP_353824.1| hypothetical protein Atu0800 [Agrobacterium tumefaciens str. C58]
 gi|15155781|gb|AAK86609.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 226

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 87/224 (38%), Positives = 129/224 (57%), Gaps = 3/224 (1%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           ++ +R  +LGG+ L  IA+   +           +P+   D        P  + + ++G 
Sbjct: 6   LTISRRSLLGGVALAAIATALPFAFTPGIAEAQELPESTGDVDMAAVMKPGPLPEAALGD 65

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            +APV +VEY SMTC HCA FHNKTF+ ++ KYI TGK+ ++LREFP D     A     
Sbjct: 66  ANAPVKIVEYMSMTCPHCANFHNKTFEEIKKKYIDTGKVYFVLREFPFD---PRAAAAFM 122

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A    +G Y+ FVS+LF +Q  W  +++ R ALL M+K AGFS+  F+ CL +Q +LDD
Sbjct: 123 LARCAPEGQYFPFVSMLFKQQQSWAVAQDARAALLQMSKMAGFSQESFEACLTNQKLLDD 182

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + A  +R + +F ++STP F I G  Y GDMS    S +ID ++
Sbjct: 183 VNATMQRGATEFGVNSTPTFIINGKKYAGDMSVETMSAVIDKLL 226


>gi|154251156|ref|YP_001411980.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
 gi|154155106|gb|ABS62323.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
          Length = 243

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 76/229 (33%), Positives = 118/229 (51%), Gaps = 5/229 (2%)

Query: 3   MSTTRIGVLGGIVLLFIA-SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           M+  R  ++G   ++ IA +Y  Y   GS+    P   G   F   L  +   + D+++G
Sbjct: 1   MNQNRAIIIGFAAVVLIALAYGAYLFFGSSNGATPGRAGGSAFEQELLVA-GPLGDMTLG 59

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             DAPVT+++YAS+TC HCA F   T   L++KYI+TGK+ YILR+FP D    VA    
Sbjct: 60  DPDAPVTVIDYASLTCSHCAAFEINTLPQLKEKYIETGKVHYILRDFPFD---PVATAGF 116

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
             A       Y+GFV +LF +Q  W  ++   + L  +A+  G S+  FD C+ D+ + +
Sbjct: 117 MLAHCAGPERYFGFVGVLFRQQAQWAFTQTPMEDLKALARQGGISEERFDACMKDEKVFN 176

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            +K    R ++ F + STP FFI G    G +    F  +I+  +    
Sbjct: 177 HVKEVATRGAKTFGVRSTPTFFINGEKIEGALPWREFEPLIEKALAGQR 225


>gi|222147829|ref|YP_002548786.1| hypothetical protein Avi_1093 [Agrobacterium vitis S4]
 gi|221734817|gb|ACM35780.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 227

 Score =  135 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 75/224 (33%), Positives = 109/224 (48%), Gaps = 2/224 (0%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           ++ T+  +L GI                A     +P    D        P  + D+++G+
Sbjct: 6   LTLTKRHLLAGIATAA-TGLAVSGMVSPAFAAAEMPKPDNDVDMAEVMKPGPLPDMALGK 64

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPV +VEY SMTC HCA FH  TF  +++KYI TGK+ ++ REFP D  +T A MLAR
Sbjct: 65  PDAPVKIVEYFSMTCPHCAHFHATTFDTIKEKYIDTGKVYFVFREFPFDPAATAAFMLAR 124

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           CA K     +               N       L  M+K AGF++  F  CL +  +  D
Sbjct: 125 CAPKDQYYPFITMFLKQQRSWAAPDNGDVRGAML-QMSKMAGFTQESFQACLTNTKLAGD 183

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + A +   ++ F +++TP F I G  Y GDMS    S +IDS++
Sbjct: 184 VTAMRDLGAKQFGVNATPTFLINGKSYSGDMSVESMSALIDSLL 227


>gi|126738673|ref|ZP_01754378.1| thiol:disulfide interchange protein, DsbA family [Roseobacter sp.
           SK209-2-6]
 gi|126720472|gb|EBA17178.1| thiol:disulfide interchange protein, DsbA family [Roseobacter sp.
           SK209-2-6]
          Length = 223

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 59/222 (26%), Positives = 95/222 (42%), Gaps = 1/222 (0%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR+       +   A  +  +   S       P              S++ ++ +G +D
Sbjct: 1   MTRLMSGLCAAVALAAGTYALSSFNSQSRLPENPLIGAAHAQEAEVDTSSITEMVLGAED 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT++EYAS TC HCA FHN  FK L++ YI +GK+R+I RE   D     A M+ARC 
Sbjct: 61  APVTLIEYASYTCPHCASFHNTVFKQLKEDYIDSGKVRFIYREVYFDRYGLWASMIARCG 120

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                 G    +    ++      +    D L  + + +G      + CL D      + 
Sbjct: 121 GPEKFFGVSDLIYKGQSEWARAGGATEIVDELRKIGRLSGLENETLEACLQDGAKAQTLV 180

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
              +  +    I STP F + G L  G+ S   F +++D+ +
Sbjct: 181 TWYQEHATKDGIQSTPSFILNGELI-GNQSYESFKELLDAEL 221


>gi|110677699|ref|YP_680706.1| thiol-disulfide oxidoreductase D, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453815|gb|ABG30020.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter
           denitrificans OCh 114]
          Length = 223

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 61/226 (26%), Positives = 103/226 (45%), Gaps = 6/226 (2%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            +R+ ++   V +     +F T  G+       P G  + +       S++ D+++G  D
Sbjct: 1   MSRMMIISAAVAVIGLGAYFVTSPGTNPVTPANPLGAANAQEAADIDTSSIMDMTLGNPD 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT++EYAS TC HCA FH   FK L+  YI TGK+ ++ RE   D             
Sbjct: 61  APVTVIEYASYTCPHCARFHEGPFKQLKADYIDTGKINFVYREVYFDRYGLW--ASMIAR 118

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKNDFDTCLNDQNILD 181
                  ++G   L++ KQ +W  + +     D L  +   AG  ++  + CL +     
Sbjct: 119 CAGTPESFFGMSDLIYQKQSEWSRAGDPAAIVDELRKVGLLAGLDRDTMEACLQNGEKAQ 178

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + A  +  +    I+STP F I G  Y  +MS    +++ID+  +
Sbjct: 179 TLVAWYQENATADGIESTPSFLINGQRYS-NMSYAEMAELIDAAAE 223


>gi|110633124|ref|YP_673332.1| DSBA oxidoreductase [Mesorhizobium sp. BNC1]
 gi|110284108|gb|ABG62167.1| DSBA oxidoreductase [Chelativorans sp. BNC1]
          Length = 229

 Score =  132 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 94/236 (39%), Positives = 132/236 (55%), Gaps = 17/236 (7%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGS----------ALNELPIPDGVVDFRALLAA 50
           M+ +TTR   L  +  +   S                        P P+G VD   LL  
Sbjct: 1   MIETTTRRRFLMSVAAIPAVSLLAACSNNEGEQAQADEITTSATAPEPEGSVDMAKLLE- 59

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P  + + + G  DAPVT+VEYASMTC HCA FH +T+  L++KY+ TGK+R+ILREFP 
Sbjct: 60  -PGALPEQAQGPADAPVTIVEYASMTCPHCAHFHEETYPALKEKYVDTGKVRFILREFPF 118

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D  +    MLARC     +  Y+  + +LF +Q  W   ++ R ALLN+AK AGF++  F
Sbjct: 119 DPRAEAGFMLARC----SESNYFPMIDVLFKQQQSWAAVQDARTALLNIAKLAGFTQESF 174

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + CL +Q +LDD++A + R +E F +DSTP FFI G  Y G +S    S IID ++
Sbjct: 175 EACLTNQKLLDDVRAVRARGAE-FGVDSTPTFFINGKKYPGALSIEQMSAIIDPLL 229


>gi|163733088|ref|ZP_02140532.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter litoralis
           Och 149]
 gi|161393623|gb|EDQ17948.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter litoralis
           Och 149]
          Length = 223

 Score =  132 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 63/226 (27%), Positives = 102/226 (45%), Gaps = 6/226 (2%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            +R+ ++   V +     +F T  G+       P G  + +       ST+ D+S+G  D
Sbjct: 1   MSRMMIISAAVAVIGLGAYFVTSTGTNPVTPANPLGAANAQEAADIDTSTIVDMSLGNPD 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT++EYAS TC HCA FH   FK L+  YI TGK+ ++ RE   D             
Sbjct: 61  APVTVIEYASYTCPHCARFHEGPFKQLKTDYIDTGKINFVYREVYFDRYGLW--ASMIAR 118

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYR---DALLNMAKFAGFSKNDFDTCLNDQNILD 181
                  ++G   L++ KQ +W  +       D L  +   AG  ++  + CL + +   
Sbjct: 119 CAGTPESFFGMSDLIYQKQSEWSRAGEPAAIVDELRKVGLLAGLDRDTMEACLQNGDKAQ 178

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + A  +  +    I+STP F I G  Y  +MS    ++ ID+  +
Sbjct: 179 TLVAWYQENATADGIESTPSFLINGQKYS-NMSYAEMAEAIDAAAE 223


>gi|161529178|ref|YP_001583004.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160340479|gb|ABX13566.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 240

 Score =  132 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 55/228 (24%), Positives = 95/228 (41%), Gaps = 8/228 (3%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           L   ++L IA   ++T   +  N        +D + L     S   D  +G  DAP++++
Sbjct: 14  LIASIVLVIAIALYFTEIQAKNNSDLGETNSLDAKILPETEISKDDDPLLGNPDAPISII 73

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           E++   C  CA F+ +T   LE +YI+ GK+ +I R+FP+ +                  
Sbjct: 74  EFSDYQCPFCARFYTQTLPTLESEYIEKGKVNFIYRDFPIQNHPNARPAALASECADEQE 133

Query: 131 GYWGFVSLLFNKQDDWIN--SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK 188
            +W +  +LF KQD W               A+    ++  FD+CL+ +   D++ +   
Sbjct: 134 QFWEYHDILFKKQDMWKRLDLDTVTSTFKEYAEELNLNQEMFDSCLDSEKYSDEVDSDFA 193

Query: 189 RASEDFAIDSTPVFFIGGN-----LYLGDMSEGVFSKIIDSMIQDSTR 231
                + I  TP FFIG          G  S   F +II+  +    +
Sbjct: 194 DG-RSYKISGTPTFFIGNEETGYSSVFGAKSFYEFQEIIEEKLDKLEK 240


>gi|325292182|ref|YP_004278046.1| disulfide bond formation protein D [Agrobacterium sp. H13-3]
 gi|325060035|gb|ADY63726.1| putative disulfide bond formation protein D [Agrobacterium sp.
           H13-3]
          Length = 226

 Score =  131 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 84/224 (37%), Positives = 127/224 (56%), Gaps = 3/224 (1%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           ++ +R  +LGG+ L  +A+   +           +P+   D        P  + + ++G 
Sbjct: 6   LTISRRSLLGGVALAALATALPFAFTPGVAQAQELPESTGDVDMAAVLKPGPLPEAALGD 65

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            +APV +VEY SMTC HCA FHNKTF  ++ KYI TGK  +++REFP D     A     
Sbjct: 66  ANAPVKIVEYMSMTCPHCANFHNKTFDEIKKKYIDTGKAYFVIREFPFD---PRAAAAFM 122

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A    +G Y+ FVS+LF +Q  W  +++ R ALL ++K AGFS+  F+ CL +Q +LDD
Sbjct: 123 LARCAPEGQYFPFVSMLFKQQQSWATAQDARAALLQLSKMAGFSQESFEACLTNQKLLDD 182

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + A  +R + +F ++STP F I G  Y GDMS    S +ID ++
Sbjct: 183 VNATMQRGATEFGVNSTPTFIINGKKYAGDMSVETMSAVIDKLL 226


>gi|254472064|ref|ZP_05085465.1| thiol:disulfide interchange protein DsbA [Pseudovibrio sp. JE062]
 gi|211959266|gb|EEA94465.1| thiol:disulfide interchange protein DsbA [Pseudovibrio sp. JE062]
          Length = 213

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 82/224 (36%), Positives = 116/224 (51%), Gaps = 11/224 (4%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M+ +R   L     L  AS  F          +P       +          + +  IG 
Sbjct: 1   MTLSRRKFLERTSALTAASLAF--------AAMPTVASAQSYSESDLNQVGPLGEKVIGS 52

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPVT++EYAS+TC HCA FHN T+K L+ KYI TGK+R+I REFPLD+V+    M   
Sbjct: 53  PDAPVTIIEYASLTCGHCANFHNTTYKELKKKYIDTGKVRFIFREFPLDTVAAAGFM--- 109

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A    +  Y+  ++L+F +Q +W  + +   ALLNM K  GF+++    CL +Q ILD 
Sbjct: 110 LARCAPEDKYFDIMTLMFEQQRNWAFTNDPYSALLNMGKQIGFTEDAVKACLTNQEILDG 169

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +   +   SE   +DSTP FFI G    G +S   FSK +D  +
Sbjct: 170 VTKVRDYGSEKLGVDSTPTFFINGEKVSGALSIEEFSKYVDKNL 213


>gi|254477202|ref|ZP_05090588.1| thiol:disulfide interchange protein, DsbA family [Ruegeria sp. R11]
 gi|214031445|gb|EEB72280.1| thiol:disulfide interchange protein, DsbA family [Ruegeria sp. R11]
          Length = 223

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 60/222 (27%), Positives = 92/222 (41%), Gaps = 1/222 (0%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR+       L   A  + Y     +      P              ST+ ++  G +D
Sbjct: 1   MTRLMSGIFASLAVAAGVYGYASFQGSSALPSNPLIGAAHAQEAEVDTSTIIEMVQGAED 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT++EYAS TC HCA FH   +K L++ YI TGK+++I RE   D     A M+ARC 
Sbjct: 61  APVTLIEYASYTCPHCANFHQGAYKQLKEDYIDTGKVKFIYREVYFDRYGLWASMIARCG 120

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                 G    +    +       +    DAL  +   AG  +   + CL D      + 
Sbjct: 121 GPEKFFGISDLIYKGQSDWARAGGATEIVDALRKIGLLAGLEEEQLEACLQDGAKAQTLV 180

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
              +  + +  I+STP F + G     + S   F  +ID+ +
Sbjct: 181 NWYQENATEHGIESTPSFILNGKKIS-NQSYADFKALIDAEL 221


>gi|85714258|ref|ZP_01045246.1| Protein-disulfide isomerase [Nitrobacter sp. Nb-311A]
 gi|85698705|gb|EAQ36574.1| Protein-disulfide isomerase [Nitrobacter sp. Nb-311A]
          Length = 220

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 80/226 (35%), Positives = 114/226 (50%), Gaps = 6/226 (2%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR  V   + L  +A++            L       D        P ++ D+++G 
Sbjct: 1   MIITRRVVNTAVSLTGLAAFLGLAPLRLIGEALAQSATAADVA-----KPVSLPDMALGP 55

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           KDA VT+ EYASMTC HCA F    F  ++ +YI T K+RY+ REFPLD  +    MLAR
Sbjct: 56  KDAAVTITEYASMTCPHCARFAEDVFPKIKAEYIDTHKIRYVFREFPLDLKAAAGAMLAR 115

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           C  K     Y+  +  LF  QD W  SK     L  + K  G + ++ ++CL DQ +LD 
Sbjct: 116 CIAKDDGAKYFAVIDTLFRSQDTWTGSKTTES-LKLIGKQTGLTGDEVESCLKDQALLDK 174

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           I A +K A+E   ++STP FFI G +  G+ S     K ID +++ 
Sbjct: 175 IAADQKYANEVLKVNSTPTFFINGEMVKGETSFEELKKKIDPLLKK 220


>gi|159042586|ref|YP_001531380.1| putative thiol-disulfide oxidoreductase D [Dinoroseobacter shibae
           DFL 12]
 gi|157910346|gb|ABV91779.1| putative thiol-disulfide oxidoreductase D [Dinoroseobacter shibae
           DFL 12]
          Length = 223

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 61/224 (27%), Positives = 103/224 (45%), Gaps = 1/224 (0%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R      + +   A+  ++    S +    +    V          S + ++++G  D
Sbjct: 1   MARKLTSLALGVAIAAAGAYWYTSQSGVPTAGVTLNPVGSVEAQEVDTSGIVEMTLGAAD 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           AP+T+VEYAS TC HCA FH   F  L++ YI+TGK+++I RE   D     A M+ARC 
Sbjct: 61  APITVVEYASFTCPHCATFHQNVFPELKENYIETGKVQFIYREVYFDRFGLWAGMVARCG 120

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            +    G    +    ++     +     D L  + + AG S    D CL D      + 
Sbjct: 121 GEERYFGITDMLYEQQSEWTGNGSPAEVADNLRRIGRVAGMSDEQVDACLQDGEKAQALV 180

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           A  ++ +E   I+STP F I G  Y  +M+   F+ ++D ++++
Sbjct: 181 AWYQQNAEADGINSTPSFVINGENYS-NMNFRDFAAVLDGLLEE 223


>gi|163739871|ref|ZP_02147278.1| thiol:disulfide interchange protein, DsbA family [Phaeobacter
           gallaeciensis BS107]
 gi|163743384|ref|ZP_02150764.1| thiol:disulfide interchange protein, DsbA family [Phaeobacter
           gallaeciensis 2.10]
 gi|161383378|gb|EDQ07767.1| thiol:disulfide interchange protein, DsbA family [Phaeobacter
           gallaeciensis 2.10]
 gi|161386905|gb|EDQ11267.1| thiol:disulfide interchange protein, DsbA family [Phaeobacter
           gallaeciensis BS107]
          Length = 223

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/222 (27%), Positives = 95/222 (42%), Gaps = 1/222 (0%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR+       +   A  + Y       +    P     +        ST+ ++  G +D
Sbjct: 1   MTRLMSGIFASVAVAAGVYGYAALQGGTSMPSNPLIGAAYAQETEVDTSTIVEMVQGAED 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT++EYAS TC HCA FH  T+K L+  YI TGK+++I RE   D     A M+ARC 
Sbjct: 61  APVTLIEYASYTCPHCANFHQGTYKQLKQDYIDTGKVKFIYREVYFDRYGLWASMIARCG 120

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                 G    +    +       +    DAL  + + AG  +   + CL D      + 
Sbjct: 121 GPEKFFGISDLIYKGQSDWARAGGATEIVDALRKIGRLAGLEEEQLEACLQDGTKAQTLV 180

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +  +  + +  I+STP F + G     + S   F  +ID+ +
Sbjct: 181 SWYQENATEHGIESTPSFILNGKKIE-NQSYDAFKTLIDAEL 221


>gi|84687977|ref|ZP_01015841.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family protein) [Maritimibacter alkaliphilus HTCC2654]
 gi|84664009|gb|EAQ10509.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family protein) [Rhodobacterales bacterium HTCC2654]
          Length = 222

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/223 (24%), Positives = 96/223 (43%), Gaps = 2/223 (0%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             +I  +     + +    ++    S           +       A      D+ +G++D
Sbjct: 1   MNKILPIALGAAVLVGGGAYFA-TQSGPTPGTSALSPISAAVAQDADVELAPDMVLGEED 59

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           AP+TM+EYAS TC HCA+FH + ++ L+  YI TGK++++ RE   D     A ++ARC 
Sbjct: 60  APITMIEYASFTCPHCADFHERVWEDLKADYIDTGKVKFVNREVYFDKYGLWAGLVARCG 119

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            +    G    +                 + L  + K AG S+     C+ND+ +   + 
Sbjct: 120 GEMRYFGVMDMLFETQKDWIGNGQEAAILENLTTIGKKAGLSEEQVTACVNDKEMAQSMV 179

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           A  ++ +    I  TP F I G  Y  +M+     KI+D + +
Sbjct: 180 AAYQQNAGADEITGTPTFIINGEKYS-NMTYDDLKKILDGLAE 221


>gi|241203461|ref|YP_002974557.1| thiol-disulfide oxidoreductase protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857351|gb|ACS55018.1| putative thiol-disulfide oxidoreductase protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 256

 Score =  127 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 126/211 (59%), Gaps = 5/211 (2%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
                T + +A +   +P+   D        P  + ++++G+ DAPV +VEY SMTC HC
Sbjct: 46  GTNVDTMQTAATSATEMPESDGDVDMAEVLKPGVLPEMALGKADAPVKIVEYMSMTCPHC 105

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM-----DGGYWGF 135
           A FHN TF  ++ KY+ +GK+++I+REFP D  +  A MLARC+            Y+  
Sbjct: 106 AHFHNTTFDTIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPM 165

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           VS+LF +Q  W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF 
Sbjct: 166 VSMLFKQQQIWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFG 225

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +++TP F I G  Y GDM     SK+IDS++
Sbjct: 226 VNATPTFLINGKRYSGDMPVDTLSKLIDSLL 256


>gi|163760360|ref|ZP_02167442.1| hypothetical protein HPDFL43_03616 [Hoeflea phototrophica DFL-43]
 gi|162282311|gb|EDQ32600.1| hypothetical protein HPDFL43_03616 [Hoeflea phototrophica DFL-43]
          Length = 251

 Score =  127 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 116/199 (58%), Gaps = 3/199 (1%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKT 87
            GS    +  P    +       +P  +K++++G ++APVT+VEY SMTC HCA FH   
Sbjct: 56  TGSTTPAVEAPQAAGEVDMAAVLAPGPLKEMALGDENAPVTIVEYMSMTCPHCASFHEDN 115

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI 147
           FK L +KY+ TGK+R+ILREFP D     A      A    +  ++  V ++F +Q  W 
Sbjct: 116 FKPLVEKYVDTGKVRFILREFPFD---PRAAAAIMLARCAPENQFFPLVDVMFKQQRSWA 172

Query: 148 NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            +++ R ALL +A+ AGF++  F+ CL +Q +LDD+ A + +A+ +F + STP F I G 
Sbjct: 173 TAQDGRAALLQIARLAGFTQESFEACLTNQKLLDDVNAVRTKAANEFGVQSTPTFIINGK 232

Query: 208 LYLGDMSEGVFSKIIDSMI 226
            Y G+MS    S IID ++
Sbjct: 233 RYPGNMSVETMSAIIDPLL 251


>gi|149912474|ref|ZP_01901008.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter sp.
           AzwK-3b]
 gi|149812880|gb|EDM72706.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter sp.
           AzwK-3b]
          Length = 221

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 100/222 (45%), Gaps = 3/222 (1%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR+  +  + L  +A   ++   GS     P      + +       ST+ ++SIG  D
Sbjct: 1   MTRLTAIAALCLALVAGAGWWLTSGST--TPPDLTFAANAQEASEIDTSTITEMSIGNPD 58

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT++EYAS TC HCA+FH   FK L+  YI TGK+ +I R+   D     A MLARC 
Sbjct: 59  AAVTVIEYASFTCPHCADFHGGQFKQLKSDYIDTGKINFIYRDVFFDRFGLWASMLARCD 118

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            +    G    +           +     + L  + K AG  ++  + CL DQ+    + 
Sbjct: 119 GQDRFFGLTAMLYEKQKDWVGKGDPVGIANELRRIGKVAGLDEDRIEECLADQDKAKTLV 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A  ++ +E   + STP   I G  Y  +++      IID  +
Sbjct: 179 AWYQKNAEADDVTSTPTLVINGQKYS-NIAYADLKAIIDEKL 219


>gi|115526429|ref|YP_783340.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisA53]
 gi|115520376|gb|ABJ08360.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 223

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 83/225 (36%), Positives = 120/225 (53%), Gaps = 3/225 (1%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR      + L  +A++   +     L +  +        A   A P  + D++IG+
Sbjct: 1   MIITRRAFTTALSLTGLAAFAGLSPL--RLIDPALAQAAGAVSAADVAKPGALPDMAIGK 58

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPVT+VEYAS+TC HCA FH K F  ++  YI T K++Y+ REFPLD  +    ML+R
Sbjct: 59  LDAPVTIVEYASLTCGHCAHFHEKVFSKIKTDYIDTNKIKYVFREFPLDIKAAAGSMLSR 118

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           C      G Y+    LLF +Q+DW+        L  + K AG  +   +TCL DQ +LD 
Sbjct: 119 CIANGDAGKYFAVTDLLFRQQEDWVMKDTT-ATLKRIGKQAGLGEQAVETCLKDQALLDK 177

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           I A +K A+E   ++STP FFI G +  GD S   F K I ++++
Sbjct: 178 IAADQKYANEVLQVNSTPTFFINGEMLKGDNSFDEFDKRIKALLK 222


>gi|307941615|ref|ZP_07656970.1| dsba oxidoreductase [Roseibium sp. TrichSKD4]
 gi|307775223|gb|EFO34429.1| dsba oxidoreductase [Roseibium sp. TrichSKD4]
          Length = 212

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 75/224 (33%), Positives = 113/224 (50%), Gaps = 12/224 (5%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M+ +R   L     +  A+              P              +P  + D  +G 
Sbjct: 1   MTVSRRTFLKTSAAMTAAAGLVG---------APALAFAESVDIDELLTPGPLGDKVLGS 51

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           +DAPVT+VEYASMTC HCA FH +T+  L+ +YI+TGK+++I REFPLD    VA     
Sbjct: 52  EDAPVTIVEYASMTCGHCANFHKRTYPELKKQYIETGKVKFIFREFPLD---PVAAAAFM 108

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A       Y+  +  +F  Q  W  S N   +LLN +K  GF++  F+  L +Q +LD 
Sbjct: 109 LARSAPADKYFDIIDTMFENQSTWAFSDNPYSSLLNFSKQIGFTQESFEEALKNQKLLDA 168

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           I A ++R S +F + STP FF+ G  + G +     S++ID+ +
Sbjct: 169 INAVRERGSNEFKVGSTPTFFVNGEKHAGALPFDQMSELIDAEL 212


>gi|126730849|ref|ZP_01746658.1| thiol:disulfide interchange protein, DsbA family [Sagittula
           stellata E-37]
 gi|126708565|gb|EBA07622.1| thiol:disulfide interchange protein, DsbA family [Sagittula
           stellata E-37]
          Length = 228

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 60/229 (26%), Positives = 94/229 (41%), Gaps = 4/229 (1%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M+    G L  + L    +++           + +P       +      ST+ ++ +G 
Sbjct: 1   MNRILSGALVALGLAAGGAWYITQGAQGTGANIALPGAANAQESTAEVDTSTITEMVMGD 60

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPV ++EYAS TC HCA         L+  Y+ TGK+++I RE   D       M+AR
Sbjct: 61  PDAPVEVIEYASYTCPHCANAAKTLIPELKKNYVDTGKVKFIYREVYFDKYGMWGSMIAR 120

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNY---RDALLNMAKFAGFSKNDFDTCLNDQNI 179
           C       G    +    +         N     D L  + + AG      D CL D + 
Sbjct: 121 CGGPEKFFGITDLIYKGQDTILAPARDGNDAGVADELRKIGRIAGIDNEQLDACLADGDK 180

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           L  +    +  ++   IDSTP F I G  Y  +M+   FSKI+D  + +
Sbjct: 181 LRTLLVWFQENAKRDGIDSTPSFIIDGEKYS-NMNYRDFSKILDEKLGE 228


>gi|254465063|ref|ZP_05078474.1| thiol:disulfide interchange protein, DsbA family [Rhodobacterales
           bacterium Y4I]
 gi|206685971|gb|EDZ46453.1| thiol:disulfide interchange protein, DsbA family [Rhodobacterales
           bacterium Y4I]
          Length = 223

 Score =  125 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 59/205 (28%), Positives = 94/205 (45%), Gaps = 1/205 (0%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
           +  T   +  N    P     +        ST+ ++++G +DAPVT++EYAS TC HCA 
Sbjct: 19  YALTGFNAQSNLPENPLVGAAYAQEAEVDTSTITEMTLGAEDAPVTLIEYASYTCPHCAN 78

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
           FHN  FK L+  YI TGK+++I RE   D     A M+ARC       G    +    ++
Sbjct: 79  FHNTVFKQLKKDYIDTGKVKFIYREVYFDRYGLWASMIARCNGPDKFFGISDLIYKGQSE 138

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
                 +    D L  + + AG      + CL D      + A  +  + +  I+STP F
Sbjct: 139 WARAGGASEIVDELRKIGRLAGLENEQLEACLQDGAKAQTLVAWYQENATEHGIESTPSF 198

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + G     + S   F K++D+ ++
Sbjct: 199 ILNGEKIS-NQSYEEFKKLLDAELE 222


>gi|328544981|ref|YP_004305090.1| Twin-arginine translocation pathway signal protein [polymorphum
           gilvum SL003B-26A1]
 gi|326414723|gb|ADZ71786.1| Twin-arginine translocation pathway signal protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 212

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 73/224 (32%), Positives = 113/224 (50%), Gaps = 12/224 (5%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M+ +R   L       + +             +P+      +          + D  +G 
Sbjct: 1   MTFSRRQFLQAASFTALGAAL---------ATVPLAALAETYGMDKLMEAGPLGDKILGA 51

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPVT+VEYASMTC HCA FH  T+  L+  Y+ TGK+R+I REFPLD    VA     
Sbjct: 52  DDAPVTIVEYASMTCGHCATFHKTTYPVLKKDYVDTGKVRFIFREFPLD---PVATAAFM 108

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A    +  Y+  +  LF  Q  W  S +  ++LLN AK  GF++  F+ CL +Q++LD 
Sbjct: 109 LARCAPEEKYFDIIDALFEDQRSWAYSNDPYNSLLNFAKQVGFTQEAFEACLTNQDVLDG 168

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + A + RA+ +F ++STP FF+ G    G ++    +++ID  +
Sbjct: 169 VNAVRDRAASEFKVNSTPTFFVNGEKKSGALTVEQMAELIDKHL 212


>gi|92118695|ref|YP_578424.1| twin-arginine translocation pathway signal [Nitrobacter
           hamburgensis X14]
 gi|91801589|gb|ABE63964.1| Twin-arginine translocation pathway signal [Nitrobacter
           hamburgensis X14]
          Length = 220

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 83/225 (36%), Positives = 117/225 (52%), Gaps = 6/225 (2%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR      + L  +A++        +   L          A   A P ++ D+++G 
Sbjct: 1   MIITRRAFNAALSLSGLAAFATL-----SPWRLIGEAMAQSATAAEVAKPVSLPDMALGP 55

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           KDA VT+ EYASMTC HCA F    F  ++  YI T K+RY+ REFPLD  +    MLAR
Sbjct: 56  KDAAVTITEYASMTCPHCARFAEDVFPKIKAAYIDTNKIRYVFREFPLDLKAAAGSMLAR 115

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           C  K   G Y+  ++ LF  QD+W   K     L  + K AG S  + +TCL DQ +LD 
Sbjct: 116 CIAKDDAGKYFAIINALFKSQDEWAGPKTTES-LKLIGKQAGLSGPEVETCLKDQALLDK 174

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           I A +K A+E   ++STP FFI G +  G++S     K ID +++
Sbjct: 175 IAADQKYANEVLKVNSTPTFFINGEMVKGEVSFEDLKKKIDPLLK 219


>gi|288930968|ref|YP_003435028.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
 gi|288893216|gb|ADC64753.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
          Length = 316

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 81/229 (35%), Gaps = 12/229 (5%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALN---ELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           + GV+    +  + +         +                 A  A + S   D   G +
Sbjct: 92  KSGVIATQQMFMVGNGSMLLSSSPSCAVNISELSARAQQTPSAQAAVNVSADDDPWRGNE 151

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            A V ++E++   C +CAEF N     + D Y    K+ +       +     A      
Sbjct: 152 SASVVIIEFSDYACPYCAEFANDVEPKILDNYGDRVKIVFRDFPVHGEISYLAAEAADCA 211

Query: 124 AEK-----RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
            E+     +    YW +  LLF  Q +W         L + AK  G +   F  CL+   
Sbjct: 212 GEQGVKEGQGWSKYWEYHDLLFANQQEW---IENTTKLYDYAKQIGLNTTAFKACLDSGK 268

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              +++   +    ++ +  TP FFI G    G     VF++ I+  ++
Sbjct: 269 YRSEVEKDLQDG-RNYGVTGTPTFFINGQKVEGLTPYEVFARFIEQELK 316


>gi|327191938|gb|EGE58920.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           CNPAF512]
          Length = 256

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 83/208 (39%), Positives = 125/208 (60%), Gaps = 5/208 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
             T + +A +   +P    D        P  + ++++G+ DAPV +VEY SMTC HCA F
Sbjct: 49  VDTMQTAATSSTDMPQSDGDVDMAEVLKPGALPEMALGKADAPVKIVEYMSMTCPHCAHF 108

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM-----DGGYWGFVSL 138
           HN TF  ++ KY+ +GK+++I+REFP D  +  A MLARC+            Y+  VS+
Sbjct: 109 HNTTFDAIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSM 168

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           LF +Q  W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++
Sbjct: 169 LFKQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNA 228

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           TP F I G  Y GDM     SK+IDS+I
Sbjct: 229 TPTFLINGKRYSGDMPVDTMSKLIDSLI 256


>gi|148253813|ref|YP_001238398.1| twin-arginine translocation signal domain-containing protein
           [Bradyrhizobium sp. BTAi1]
 gi|146405986|gb|ABQ34492.1| putative exported protein of unknown function with twin-arginine
           translocation signal domain [Bradyrhizobium sp. BTAi1]
          Length = 218

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 83/225 (36%), Positives = 114/225 (50%), Gaps = 8/225 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR      + L  +A+   +T        L      V         P ++ D+++G 
Sbjct: 1   MIITRRAFTAALSLTGLAALAGFTPLRLISEALAQSAADVA-------KPQSLPDMALGP 53

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DA VT+ EYASMTC HCA F+   F  L+ +YI TGK+RYI REFPLD  +    ML R
Sbjct: 54  ADAAVTITEYASMTCPHCAAFNATVFPKLKAEYIDTGKVRYIFREFPLDIKAAAGSMLTR 113

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           C        Y+    +LF  Q+DW   KN  + L  + K AG S+   + CL DQ +LD 
Sbjct: 114 CIANGDAQKYFAVTDMLFRSQNDW-VVKNTTETLTRIGKQAGLSQQQVEACLKDQALLDK 172

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           I A +K AS+   +DSTP FFI G    G+ S   F K I+ +++
Sbjct: 173 IAADQKYASDILKVDSTPTFFINGEKIKGESSIEEFQKRINPLLK 217


>gi|209548261|ref|YP_002280178.1| DSBA oxidoreductase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534017|gb|ACI53952.1| DSBA oxidoreductase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 256

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 123/208 (59%), Gaps = 5/208 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
             T + +A +   +P    D        P  + ++++G+ DAPV +VEY SMTC HCA F
Sbjct: 49  VDTMQTAATSPTEMPQSDGDVDMAEVLKPGALPEMALGKADAPVKIVEYMSMTCPHCAHF 108

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM-----DGGYWGFVSL 138
           HN TF  ++ KY+  GK+++I+REFP D  +  A MLARC+            Y+  VS+
Sbjct: 109 HNTTFDAIKQKYVDAGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSM 168

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           LF +Q  W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++
Sbjct: 169 LFKQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNA 228

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           TP F I G  Y GDM     S +IDS+I
Sbjct: 229 TPTFLINGKRYSGDMPVETLSALIDSLI 256


>gi|150395769|ref|YP_001326236.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419]
 gi|150027284|gb|ABR59401.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419]
          Length = 269

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 88/207 (42%), Positives = 129/207 (62%), Gaps = 5/207 (2%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
           A+        +A  ELP P+G VD   LL   P  + ++++G+  APVT+VEY SMTC H
Sbjct: 68  AAEVAQASTPAAKVELPTPEGTVDAAKLLE--PGALPEMALGEASAPVTIVEYMSMTCPH 125

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           CA FHN TF  ++ KY+ +GK+R+I+REFP D     A      A    +G Y+  +S+L
Sbjct: 126 CANFHNDTFDAIKTKYVDSGKVRFIVREFPFD---PRAAAAFMLARCAPEGQYFPMISML 182

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F +Q+ W  ++N RDALL ++K AGF++  F+ CL +Q +LDD+ A  +R +++F + ST
Sbjct: 183 FKQQEQWAAAQNGRDALLQLSKLAGFTQESFEACLTNQKLLDDVNAVMQRGAKEFGVKST 242

Query: 200 PVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           P FF+ G  Y GDMS  V S +IDS +
Sbjct: 243 PTFFVNGEHYSGDMSVDVMSALIDSKL 269


>gi|284042976|ref|YP_003393316.1| Na+/H+ antiporter NhaA [Conexibacter woesei DSM 14684]
 gi|283947197|gb|ADB49941.1| Na+/H+ antiporter NhaA [Conexibacter woesei DSM 14684]
          Length = 624

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 76/227 (33%), Gaps = 17/227 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            RIGVL   VL   A +  +      L  L   +        L+      +D   G  DA
Sbjct: 415 ARIGVLLAAVLAVGAGWLAF-----KLAALLRGEVSAGLPRELSPPVDAARDHVRGPLDA 469

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+T+VEYA   C  C        +           +   L    +       +      E
Sbjct: 470 PLTLVEYADFECPFCGRATGMVRELRRRFGDDLRYVLRHLPLIDVHPH--AELAAQAMEE 527

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
             + G +W     LF+ QD+        + LL  A   G    +    L D   L  ++ 
Sbjct: 528 AAVQGRFWELHDKLFDHQDELEF-----EDLLGYAGKIGIDVEELARALQDGRHLARVRK 582

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
               A E      TP FF+GG  ++G       +      +++S RR
Sbjct: 583 DVASA-EASGARGTPTFFVGGQRHVGPYDAETLA----RELEESRRR 624


>gi|300024387|ref|YP_003756998.1| DSBA oxidoreductase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526208|gb|ADJ24677.1| DSBA oxidoreductase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 233

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 79/225 (35%), Positives = 116/225 (51%), Gaps = 6/225 (2%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S +R     G+      S F     G +  +       V    L+   PS + D+++G  
Sbjct: 12  SVSRRAAWLGMAATVAVSGFSIAASGPSYAQRKQGPSEVSVDELM--KPSDLADLTLGPA 69

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           DA VT+VEYASMTC HCA F    F+  + KYI TGK+R++ REFPLD+++    MLAR 
Sbjct: 70  DAKVTVVEYASMTCPHCAHFETDVFENFKKKYIDTGKVRFVYREFPLDNLAAAVSMLAR- 128

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWIN-SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                    +  +   + KQ +W     N    L ++AK AGF++  FD CL DQ +LD 
Sbjct: 129 --CAGGDKTFPLIQTFYAKQAEWAFTQGNPVPKLFDIAKQAGFTQESFDKCLTDQKLLDQ 186

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           I A + RAS+ F +++TP FFI G       +   F K+I+ ++ 
Sbjct: 187 ITAQRTRASDTFGVNATPTFFINGKKLPETPTLEAFDKVIEPLLA 231


>gi|90425844|ref|YP_534214.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB18]
 gi|90107858|gb|ABD89895.1| Twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB18]
          Length = 233

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 82/223 (36%), Positives = 119/223 (53%), Gaps = 5/223 (2%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR      + L  +A+   +    S L  +          A   A P  + D+++G  +
Sbjct: 15  ITRRAFTAALSLTGLAALAGF----SPLRLIGEAFAQDAPSAADVAKPGALPDMALGAPN 70

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT++EYASMTC HCA F+   F  L+ +YI T K++Y+ REFPLD  +    MLARC 
Sbjct: 71  APVTIIEYASMTCSHCANFNETVFPKLKAEYIDTSKVKYVFREFPLDIKAAAGSMLARCI 130

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            K   G Y+    +LF +Q DW   KN  + L  + K AG S +  + CL DQ +LD I 
Sbjct: 131 AKDDAGKYFAVNDMLFKQQTDW-VLKNTTETLKRIGKQAGLSGDAVEACLKDQALLDKIA 189

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           A +K A+E   ++STP FFI G +  G+ S   F K I ++++
Sbjct: 190 ADQKFANEVLKVNSTPTFFINGEMLRGEASFEEFGKKIKALLK 232


>gi|39937547|ref|NP_949823.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris CGA009]
 gi|192293339|ref|YP_001993944.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
 gi|39651406|emb|CAE29928.1| DSBA oxidoreductase:Tat pathway signal [Rhodopseudomonas palustris
           CGA009]
 gi|192287088|gb|ACF03469.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
          Length = 224

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 75/226 (33%), Positives = 114/226 (50%), Gaps = 3/226 (1%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR      + L     +         L +           A   A P ++ D+++G KD
Sbjct: 2   ITRRTFTAALSL--TGVFAVAGVSPFRLIDSAFAQSKEAAAAADVAKPMSLPDMALGPKD 59

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT+ EYAS+TC HCA F+ + +  ++  YI TGK+RY+ REFPLD  +    ML+RC 
Sbjct: 60  ATVTITEYASLTCSHCAAFNEQVYPQIKKAYIDTGKIRYVFREFPLDIKAAAGSMLSRCI 119

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            K     Y+    +LF  Q +W+        L  + K AG S  + + CL DQ +LD I 
Sbjct: 120 AKDDSAKYFAVTDVLFRSQTEWVLKDTTEQ-LKRIGKQAGLSGEEVEACLKDQKLLDKIA 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           A +K A+E   +++TP FFI G +  G+ S   F+K ID+++   +
Sbjct: 179 ADQKYANEVLKVNATPTFFINGEMLRGENSFDEFAKRIDALLAKKS 224


>gi|227821137|ref|YP_002825107.1| putative disulfide bond formation protein D [Sinorhizobium fredii
           NGR234]
 gi|227340136|gb|ACP24354.1| putative disulfide bond formation protein D [Sinorhizobium fredii
           NGR234]
          Length = 268

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 90/207 (43%), Positives = 129/207 (62%), Gaps = 5/207 (2%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
           A          A  ELP  +G VD + L+   P  + ++++G+ +APVT+VEY SMTC H
Sbjct: 67  AGTEVAQAAAPAKAELPQSEGSVDVQKLME--PGALPEMALGEANAPVTIVEYMSMTCPH 124

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           CA FHNKTF  ++ KYI +GK+R+I+REFP D     A      A    +G Y+  VS+L
Sbjct: 125 CANFHNKTFDAIKAKYIDSGKVRFIVREFPFD---PRAAAAFMLARCAPEGQYFPMVSML 181

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F +Q+ W  ++N RDALL M+K AGF++  F+ CL +Q +LDD+ A  +R +++F + ST
Sbjct: 182 FKQQEQWAAAENGRDALLQMSKLAGFTQESFEACLTNQKLLDDVNAVMQRGAKEFGVKST 241

Query: 200 PVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           P FF+ G  Y GDMS  V S +IDS +
Sbjct: 242 PTFFVNGEHYSGDMSVDVLSALIDSKL 268


>gi|218660625|ref|ZP_03516555.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           IE4771]
          Length = 258

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 125/208 (60%), Gaps = 5/208 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
             T + +A +   +P    D        P  + ++++G+ DAPV +VEY SMTC HCA F
Sbjct: 51  VDTIETAATSSADMPQSDGDVDMAEVLKPGALPEMALGKADAPVKIVEYMSMTCPHCAHF 110

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR-----MDGGYWGFVSL 138
           HN TF  ++ KYI TGK+++I+REFP D  +  A MLARC             Y+  VS+
Sbjct: 111 HNTTFDTIKQKYIDTGKVQFIIREFPFDPRAAAAFMLARCNASNPGQLSAPEQYFPMVSM 170

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           LF +Q  W  +++ R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +D+
Sbjct: 171 LFKQQQVWAAAEDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVDA 230

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           TP F I G  Y GDM     SK+IDS+I
Sbjct: 231 TPTFLINGKRYSGDMPVDTMSKLIDSLI 258


>gi|190890714|ref|YP_001977256.1| thiol-disulfide oxidoreductase [Rhizobium etli CIAT 652]
 gi|190695993|gb|ACE90078.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           CIAT 652]
          Length = 258

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 83/208 (39%), Positives = 125/208 (60%), Gaps = 5/208 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
             T + +A +   +P    D        P  + ++++G+ DAPV +VEY SMTC HCA F
Sbjct: 51  VDTIQTAATSSTDMPQSDGDVDMAEVLKPGALPEMALGKADAPVKIVEYMSMTCPHCAHF 110

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM-----DGGYWGFVSL 138
           HN TF  ++ KY+ +GK+++I+REFP D  +  A MLARC+            Y+  VS+
Sbjct: 111 HNTTFDAIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSM 170

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           LF +Q  W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++
Sbjct: 171 LFKQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNA 230

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           TP F I G  Y GDM     SK+IDS+I
Sbjct: 231 TPTFLINGKRYSGDMPVDTMSKLIDSLI 258


>gi|146276120|ref|YP_001166279.1| DSBA oxidoreductase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554361|gb|ABP68974.1| DSBA oxidoreductase [Rhodobacter sphaeroides ATCC 17025]
          Length = 223

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 61/220 (27%), Positives = 101/220 (45%), Gaps = 6/220 (2%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           L  + L  +A +  +         L  P       A  + +   ++D+ +G +DAPVT+V
Sbjct: 7   LAALALTTVAGFALWNGGREPAQTLLPPMAASAQEAGSSETAPVIEDMVMGAEDAPVTIV 66

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           EY+S TC HCA F  +    L+  YI TGK+R++ RE   D     A M    A    + 
Sbjct: 67  EYSSFTCPHCATFEKEVLTPLKRDYIDTGKVRFVYREVYFDRYGLWAAM---VARCGGEM 123

Query: 131 GYWGFVSLLFNKQDDW--INSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK 188
            Y+G   L+F++Q +W   +     + L  + K AG      D C+NDQ   + + A  +
Sbjct: 124 RYFGIADLIFDQQQEWVTNDPAQVAENLRRIGKTAGLDDAALDACMNDQAKAEAMVAAFQ 183

Query: 189 RASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + ++   I +TP   I G  +  +M      KII++ +  
Sbjct: 184 KNTQADDITATPSLIINGTKHS-NMGYDELRKIIEAELAK 222


>gi|118590782|ref|ZP_01548183.1| hypothetical protein SIAM614_06428 [Stappia aggregata IAM 12614]
 gi|118436758|gb|EAV43398.1| hypothetical protein SIAM614_06428 [Stappia aggregata IAM 12614]
          Length = 211

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 79/224 (35%), Positives = 113/224 (50%), Gaps = 13/224 (5%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M+ TR   L    L   A     +    A                    P  + D  +G 
Sbjct: 1   MTQTRRQFLKTTALATAAFCLAGSSLALAQT----------VDQDELVKPGPLGDKILGD 50

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           ++APVT+VEYASMTC HCA FH +T+  L+  YI TGK+R+I REFPLD    VA     
Sbjct: 51  ENAPVTIVEYASMTCGHCANFHKRTYPELKADYIDTGKVRFIFREFPLD---PVAAGAFM 107

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A       Y+  V ++F +Q  W  + N   ++L+ +K  GF+K  F+ CL +Q +LD 
Sbjct: 108 LARCAPADKYFEIVDIMFEQQRTWAFTDNPYQSMLDFSKQIGFTKESFEECLGNQGLLDA 167

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           I A K R + +F ++STP FFI G  + G +S     K+ID+ +
Sbjct: 168 IDAVKNRGASEFGVNSTPTFFINGEKHSGALSIEEMGKLIDANL 211


>gi|86356645|ref|YP_468537.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli CFN
           42]
 gi|86280747|gb|ABC89810.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli CFN
           42]
          Length = 259

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 121/204 (59%), Gaps = 5/204 (2%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKT 87
             +      +P    D        P  + ++++G+ DAPV +VEY SMTC HCA FHN T
Sbjct: 56  TAATSATTDMPQSDGDVDMAEVLKPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNTT 115

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM-----DGGYWGFVSLLFNK 142
           F  ++ KY+ TGK+++I+REFP D  +  A MLARC+            Y+  VS+LF +
Sbjct: 116 FDAIKQKYVDTGKVQFIIREFPFDPRAAAAFMLARCSAANPGQLSTPEQYFPMVSMLFKQ 175

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           Q  W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++TP F
Sbjct: 176 QQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTF 235

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMI 226
            I G  Y GDM     SK+IDS+I
Sbjct: 236 LINGKRYSGDMPVDTMSKLIDSLI 259


>gi|254502668|ref|ZP_05114819.1| hypothetical protein SADFL11_2707 [Labrenzia alexandrii DFL-11]
 gi|222438739|gb|EEE45418.1| hypothetical protein SADFL11_2707 [Labrenzia alexandrii DFL-11]
          Length = 198

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 76/193 (39%), Positives = 114/193 (59%), Gaps = 3/193 (1%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
               P             P  + D  +G ++APVT+VEYASMTC HCA FH +T+  L+ 
Sbjct: 9   ASAAPAWAQSVDEDELLKPGPLGDKILGDENAPVTIVEYASMTCGHCANFHERTWPDLKK 68

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
            YI+TGK+R+I REFPLD V++ A MLARCA +     Y+  V ++F +Q  W  + N  
Sbjct: 69  DYIETGKVRFIFREFPLDPVASAAFMLARCAPQE---KYFDIVDIMFEEQRAWAFTDNPY 125

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
            +LL+ +K  GF++  F+ CL +Q +LD + A ++R + +F ++STP FFI G  + G +
Sbjct: 126 QSLLDFSKQIGFTQESFEECLTNQGLLDAVNAVRERGANEFGVNSTPTFFINGEKHSGAL 185

Query: 214 SEGVFSKIIDSMI 226
           S     KII+  +
Sbjct: 186 SIDEMGKIIEENL 198


>gi|240139211|ref|YP_002963686.1| hypothetical protein MexAM1_META1p2639 [Methylobacterium extorquens
           AM1]
 gi|240009183|gb|ACS40409.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 208

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 79/207 (38%), Positives = 111/207 (53%), Gaps = 5/207 (2%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
            +        ++    P     V  R L  A P  + DV +G  DA VT+VEYAS+TC H
Sbjct: 5   GALRLLLIASASATVKPALAQNVSARELAEAGP--LGDVVLGSPDARVTIVEYASLTCGH 62

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           CA FH +T+  L+ +YI TGK+R+ILREFPLD    +A      A  +    Y+    LL
Sbjct: 63  CAAFHRETYPELKRRYIDTGKVRFILREFPLD---PLATAGFMLARCKGHASYYPVTDLL 119

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F+ Q DW  +    D L  + + AGF +  F++CL DQ +   + A ++RA+E F + ST
Sbjct: 120 FDHQKDWAFTAKPLDDLQAILRQAGFQQEKFESCLKDQKLYASVSAVRRRATETFKVSST 179

Query: 200 PVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           P FFI G  Y G++S     KII  M+
Sbjct: 180 PTFFINGQRYAGNLSMEDIEKIIAPML 206


>gi|116250855|ref|YP_766693.1| disulfide bond formation protein D [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255503|emb|CAK06580.1| putative disulfide bond formation protein D [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 214

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 124/208 (59%), Gaps = 5/208 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
             T + +A     +P+   D        P  + ++++G+ DAPV +VEY SMTC HCA F
Sbjct: 7   VDTMQTAATAATEMPESDGDVDMAEVLKPGVLPEMALGKADAPVKIVEYMSMTCPHCAHF 66

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM-----DGGYWGFVSL 138
           HN TF  ++ KY+ +GK+++I+REFP D  +  A MLARC             Y+  VS+
Sbjct: 67  HNTTFDTIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCNSSNPEQLSTPEQYFPMVSM 126

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           LF +Q  W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +++
Sbjct: 127 LFKQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNA 186

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           TP F I G  Y GDM     SK+IDS++
Sbjct: 187 TPTFLINGKRYSGDMPVDTLSKLIDSLL 214


>gi|218672535|ref|ZP_03522204.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli
           GR56]
          Length = 258

 Score =  123 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 86/211 (40%), Positives = 126/211 (59%), Gaps = 5/211 (2%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
                T + +A +   +P    D        P  + ++++G+ DAPV +VEY SMTC HC
Sbjct: 48  GANVDTMQTAATSSTDMPQSDGDVDMAEVLKPGALPEMALGKADAPVKIVEYMSMTCPHC 107

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA-----EKRMDGGYWGF 135
           A FHN TF  ++ KYI TGK+++I+REFP D  +  A MLARC+     +      Y+  
Sbjct: 108 AHFHNTTFDTIKQKYIDTGKVQFIIREFPFDPRAAAAFMLARCSAANPGQMSTPEQYFPM 167

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           VS+LF +Q  W  + + R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF 
Sbjct: 168 VSMLFKQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFG 227

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +D+TP F I G  Y GDM     SK+IDS+I
Sbjct: 228 VDATPTFLINGKRYSGDMPVDTMSKLIDSLI 258


>gi|158422082|ref|YP_001523374.1| putative twin-arginine translocation pathway signal protein
           [Azorhizobium caulinodans ORS 571]
 gi|158328971|dbj|BAF86456.1| putative twin-arginine translocation pathway signal protein
           [Azorhizobium caulinodans ORS 571]
          Length = 243

 Score =  123 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 75/229 (32%), Positives = 109/229 (47%), Gaps = 5/229 (2%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS- 59
           M++   R     G++ L         R      +L  P            +P+       
Sbjct: 16  MLLHRRRFLEGVGLLALAGGVGLPLARLLGVSVDLISPAAAQTVEDAKLTAPAASPLPVK 75

Query: 60  -IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
            +G   APVT++EYASMTC HCA F  +TF  L+ KY+ TGK+ YILREFP D    V+ 
Sbjct: 76  ALGNPKAPVTIIEYASMTCSHCAAFATQTFPTLKTKYVDTGKVYYILREFPFD---PVST 132

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                A    D  Y+  V  LF  Q  W    N    LL +AK AG S+ DF+ CL D++
Sbjct: 133 AAFMLARCVPDDKYFPMVETLFETQRSWAFGNNPAAGLLTVAKQAGMSEADFEKCLTDKD 192

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           + + ++A  +  +++  +DSTP FFI G    G +S     K +  ++Q
Sbjct: 193 LAEKVQASAQYGNKELGVDSTPTFFINGKKIAGAISIADLDKELAPLLQ 241


>gi|15964683|ref|NP_385036.1| hypothetical protein SMc00023 [Sinorhizobium meliloti 1021]
 gi|307304261|ref|ZP_07584013.1| DSBA oxidoreductase [Sinorhizobium meliloti BL225C]
 gi|307320566|ref|ZP_07599981.1| DSBA oxidoreductase [Sinorhizobium meliloti AK83]
 gi|15073861|emb|CAC45502.1| Hypothetical protein SMc00023 [Sinorhizobium meliloti 1021]
 gi|306893842|gb|EFN24613.1| DSBA oxidoreductase [Sinorhizobium meliloti AK83]
 gi|306902729|gb|EFN33322.1| DSBA oxidoreductase [Sinorhizobium meliloti BL225C]
          Length = 269

 Score =  123 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 89/215 (41%), Positives = 130/215 (60%), Gaps = 5/215 (2%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
               +   A+        +A  ELP  +G VD   LL   P  + ++++G+ +APVT+VE
Sbjct: 60  AAASVAKPATEVAQASTPAAKVELPKSEGSVDMAKLLE--PGALPEMALGEANAPVTIVE 117

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           Y SMTC HCA FHN TF  ++ KYI +GK+R+I+REFP D     A      A    +G 
Sbjct: 118 YMSMTCPHCANFHNDTFDAIKAKYIDSGKVRFIVREFPFD---PRAAAAFMLARCAPEGQ 174

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           Y+  VS+LF +Q+ W  ++N RDALL ++K AGF++  F+ CL +Q +LDD+ A  +R +
Sbjct: 175 YFPMVSMLFKQQEQWAAAQNGRDALLQLSKLAGFTQESFEACLTNQKLLDDVNAVMQRGA 234

Query: 192 EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           ++F + STP FF+ G  Y GDMS  V S +IDS +
Sbjct: 235 KEFGVKSTPTFFVNGEHYSGDMSVDVMSALIDSKL 269


>gi|27377608|ref|NP_769137.1| hypothetical protein bll2497 [Bradyrhizobium japonicum USDA 110]
 gi|27350753|dbj|BAC47762.1| bll2497 [Bradyrhizobium japonicum USDA 110]
          Length = 232

 Score =  123 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 76/223 (34%), Positives = 118/223 (52%), Gaps = 8/223 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR      + L  +A+   ++      + +    G V         P ++ D+++G KD
Sbjct: 17  ITRRAFTTMLSLTGLAAVAGFSPLRFISDAMAQAAGDVA-------KPVSLPDMALGPKD 69

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT+ E+ASMTC HCA F+ + F  ++ +YI TGK+RY+ REFPLD  +    ML+RC 
Sbjct: 70  AAVTITEFASMTCPHCAAFNEQVFPKIKAEYIDTGKIRYVFREFPLDIKAAAGSMLSRCI 129

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                  Y+    +LF +Q+DW+        L  + K AG ++   + CL DQ +LD I 
Sbjct: 130 ANGDAPKYFAVTDMLFRQQNDWVMKNTTET-LTRIGKQAGLTQQQVEACLKDQALLDKIA 188

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           A +K AS+   +DSTP FFI G    G+ S   F+K I+ +++
Sbjct: 189 ADQKYASDVLKVDSTPTFFINGEKIKGEASFEEFAKKINPLLK 231


>gi|316935987|ref|YP_004110969.1| DSBA oxidoreductase [Rhodopseudomonas palustris DX-1]
 gi|315603701|gb|ADU46236.1| DSBA oxidoreductase [Rhodopseudomonas palustris DX-1]
          Length = 224

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 76/230 (33%), Positives = 117/230 (50%), Gaps = 6/230 (2%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           M+   T    +    L+ +A    +    +A  +        D        P ++ D+++
Sbjct: 1   MITRRTFTAAMSLTGLVAVAGVSPFRLIDAAFAQSKEAATAADVA-----KPMSLPDMAL 55

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G KDA VT+ EYAS+TC HCA F  + F  L+  YI TGK+R++ REFPLD  +    ML
Sbjct: 56  GPKDAAVTVTEYASLTCSHCATFDQQVFPQLKKAYIDTGKVRWVFREFPLDIKAAAGSML 115

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           +RC  K     Y+    +LF  Q +W+        L  + K AG S  + + CL DQ +L
Sbjct: 116 SRCIAKDDSAKYFAVTDVLFKSQTEWVLKDTTEQ-LKRIGKQAGLSGEEVEACLKDQALL 174

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           D I A +K A+E   +++TP FFI G +  G+ S   F+K ID+++   +
Sbjct: 175 DKIAADQKYANEVLKVNATPTFFINGEMLRGENSFEEFAKRIDALLAKKS 224


>gi|332559930|ref|ZP_08414252.1| periplasmic thiol-disulfide interchange protein [Rhodobacter
           sphaeroides WS8N]
 gi|332277642|gb|EGJ22957.1| periplasmic thiol-disulfide interchange protein [Rhodobacter
           sphaeroides WS8N]
          Length = 223

 Score =  122 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 62/218 (28%), Positives = 95/218 (43%), Gaps = 2/218 (0%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           L  + L  +A    +     A      P          A + + ++D+S+G +DAPVT+V
Sbjct: 7   LAALALTTVAGVALWNGSRDAGQTQLPPMAASAQETGAAQTTAAVEDMSMGAEDAPVTIV 66

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           EYAS TC HCA F  +    L+  YI TGK+R+  RE   D     A M+ARC  +    
Sbjct: 67  EYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREVYFDRYGLWAAMVARCGGEMRYF 126

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
           G    +     +     +       L  + K AG      D C+NDQ   + + A  ++ 
Sbjct: 127 GIADLIFEQQKE-WVTNDPAQVATNLRKIGKTAGLDDAALDACMNDQAKAEAMVAAFQKN 185

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           S+   I +TP   + G  +  +MS     KIID+ +  
Sbjct: 186 SQADDITATPSLIVNGTKHS-NMSYEELKKIIDAELAK 222


>gi|161528689|ref|YP_001582515.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339990|gb|ABX13077.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 265

 Score =  122 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 91/241 (37%), Gaps = 22/241 (9%)

Query: 8   IGVLGGI-VLLFIASYFFYTRKGSALNELPIPDGV------------VDFRALLAASPST 54
           IG++  + V  F A  +F       +++  + D +               +       S 
Sbjct: 25  IGLIVAVGVAAFFAGMYFSNANSDQISQEDLDDAIAKLELKMLQNRLPTNQPSEPVKISA 84

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSV 113
             D  IG  DAP+T++E++   C  CA FH +T   L ++YI  GK++ + R+FP     
Sbjct: 85  DDDPIIGNPDAPITIIEFSDFQCPFCARFHVQTLPLLLEEYIDQGKVKLVFRDFPIQSIH 144

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD--ALLNMAKFAGFSKNDFD 171
                           G +     +LF+ Q  W N +           A      +  FD
Sbjct: 145 PNALPASVAAECANEQGQFKAMHDMLFDNQGQWSNQETVDALSMFSQYATQIQLDQETFD 204

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI-GGNL----YLGDMSEGVFSKIIDSMI 226
           +CL     +++I+         + +  TP FF+    +      G      F K+ID+ +
Sbjct: 205 SCLTSGKYIEEIRKDLDDG-RSYDVTGTPGFFVGNDEIGYVELKGAQPFESFKKVIDAQL 263

Query: 227 Q 227
           +
Sbjct: 264 E 264


>gi|315122067|ref|YP_004062556.1| DSBA oxidoreductase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495469|gb|ADR52068.1| DSBA oxidoreductase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 228

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 152/226 (67%), Positives = 184/226 (81%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M T +IG L   V+  + S FFYT+  ++ N LP+P  ++D   LLAASP  M+++SIG+
Sbjct: 1   MKTAKIGALCIAVVFVVGSVFFYTKSRNSSNALPLPYSMIDVDILLAASPHAMEEISIGR 60

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           +DAP+T+VEYASMTCFHCAEFHNKTFK +EDKYIKTGK+R+I REFPLDSVST A MLAR
Sbjct: 61  QDAPLTIVEYASMTCFHCAEFHNKTFKKIEDKYIKTGKVRFIFREFPLDSVSTAASMLAR 120

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           CAE R+ GGY+GFVS+LF KQ+DWI SKNYR+++ NMAK AGFS+NDFD+CL +Q+ILDD
Sbjct: 121 CAENRVKGGYFGFVSMLFKKQNDWIESKNYRESMFNMAKIAGFSRNDFDSCLGNQSILDD 180

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           IK G K A E   I+STP FFIGGNLYLGDMSE VFSKIIDSMI+ 
Sbjct: 181 IKTGNKIAVEKLLINSTPSFFIGGNLYLGDMSEEVFSKIIDSMIEK 226


>gi|329765534|ref|ZP_08257110.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137972|gb|EGG42232.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 269

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 93/246 (37%), Gaps = 22/246 (8%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRA-------------LL 48
           V +   I V+   ++    +  +   K   +    + D +    +             + 
Sbjct: 23  VFNVLIISVIAASLVAAFFAGSYVNLKTDQVTRTELNDAIEKIESKILKDQQAPEQLNVQ 82

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
             + S   D  IG ++AP+T++E++   C  CA F  +T   + ++Y+ TGK++++ R+F
Sbjct: 83  PTNISIDDDPVIGDQNAPITIIEFSDFQCPFCARFQTQTLPLILEQYVNTGKVKFVFRDF 142

Query: 109 P-LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR--DALLNMAKFAGF 165
           P   S                   YW F   LF  Q  W         D     A     
Sbjct: 143 PIQSSHPNAMPAAVAAECANEQDMYWQFHDELFENQGVWNKMSIVDATDVFKGYAAKLEL 202

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN-----LYLGDMSEGVFSK 220
           ++  F++CL+    + +I +      + + I  TP FFIG          G     VF  
Sbjct: 203 NQEQFNSCLDSGKYIGEINSDLNDGRK-YGITGTPGFFIGNEKTGFVKVNGAQPFEVFKS 261

Query: 221 IIDSMI 226
           +IDS +
Sbjct: 262 VIDSQL 267


>gi|222085162|ref|YP_002543692.1| thiol-disulfide oxidoreductase protein [Agrobacterium radiobacter
           K84]
 gi|221722610|gb|ACM25766.1| thiol-disulfide oxidoreductase protein [Agrobacterium radiobacter
           K84]
          Length = 245

 Score =  121 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 84/242 (34%), Positives = 127/242 (52%), Gaps = 20/242 (8%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFY------------------TRKGSALNELPIPDGVVDF 44
           M  T+  +LGG  +  ++  F                    T   ++  E  IP      
Sbjct: 6   MLLTKRHLLGGSAVAALSVAFAAFADTASAANATTAGGAQETTSTASTPEDEIPTADGSV 65

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
                  P ++ ++++G++DAPV +VEY S+TC HCA F   TF  ++ KYI TGK+R+I
Sbjct: 66  DMNEVLKPGSLPEIALGKEDAPVKIVEYMSLTCPHCAHFAVTTFDAIKQKYIDTGKVRFI 125

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
           +REFP D  +  A MLARCA +         +                R ALL M+K AG
Sbjct: 126 IREFPFDPRAAAAFMLARCAPQEQYMPMVEMLFKQQIAWASPDVDG--RAALLQMSKLAG 183

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           F+++ F  CL +Q +LDD+ + ++RA++DF +++TP F I G  Y GDMS G  SK+IDS
Sbjct: 184 FTEDSFTKCLTNQKLLDDVNSVRERAAKDFGVNATPTFLINGKRYAGDMSVGAMSKLIDS 243

Query: 225 MI 226
           ++
Sbjct: 244 LL 245


>gi|146339048|ref|YP_001204096.1| hypothetical protein BRADO2001 [Bradyrhizobium sp. ORS278]
 gi|146191854|emb|CAL75859.1| conserved hypothetical protein; putative signal peptide;
           twin-arginine translocation signal domain protein
           [Bradyrhizobium sp. ORS278]
          Length = 226

 Score =  121 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 82/223 (36%), Positives = 113/223 (50%), Gaps = 8/223 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR      + L  +A+   ++               V         P ++ D++IG  D
Sbjct: 11  ITRRAFTAALSLTGLAALAGFSPLRLISEAFAQSAADVA-------KPQSLPDMAIGPTD 63

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT+ EYASMTC HCA F+   F  L+ +YI TGK+RYI REFPLD  +    ML RC 
Sbjct: 64  AAVTITEYASMTCPHCAAFNATVFPKLKAEYIDTGKVRYIFREFPLDIKAAAGSMLTRCI 123

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            K     Y+    +LF  Q+DW   KN  + L  + K AG S+   + CL DQ +LD I 
Sbjct: 124 AKDDAQKYFAVTDMLFRSQNDW-VVKNTTETLTRIGKQAGLSQQQVEACLKDQALLDKIA 182

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           A +K AS+   +DSTP FFI G    G+ S   F K I+ +++
Sbjct: 183 ADQKYASDVLKVDSTPTFFINGEKIKGESSIEEFQKRINPLLK 225


>gi|56698269|ref|YP_168642.1| DsbA family thiol:disulfide interchange protein [Ruegeria pomeroyi
           DSS-3]
 gi|56680006|gb|AAV96672.1| thiol:disulfide interchange protein, DsbA family [Ruegeria pomeroyi
           DSS-3]
          Length = 222

 Score =  121 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 57/222 (25%), Positives = 91/222 (40%), Gaps = 2/222 (0%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R+G L    +   A  ++ T           P              S++ ++  G +D
Sbjct: 1   MNRLGTLVFAGVAIAAGAYWLTLPSQGNLPAN-PLVGSAEAQQAEIDTSSIVEMVQGAED 59

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APV ++EYAS TC HCA FH   +K L+  +I TGK+R+I RE   D     A M+ARCA
Sbjct: 60  APVEVIEYASYTCPHCAAFHEGPYKKLKADFIDTGKVRFIYREVYFDRYGLWASMVARCA 119

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                 G    +     +           + L  + + AG   +  + CL D      + 
Sbjct: 120 GPEKFFGISDLIYKGQAEWSRAGGPAEIAEELRKIGRLAGIENDKLEACLGDATKAQTLV 179

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A  +  +    I+STP F I G     + +   F  +I++ +
Sbjct: 180 AWYQEHATRDDINSTPSFMINGKKVE-NQAYDGFKALIEAEL 220


>gi|89070022|ref|ZP_01157353.1| thiol:disulfide interchange protein, DsbA family protein
           [Oceanicola granulosus HTCC2516]
 gi|89044359|gb|EAR50497.1| thiol:disulfide interchange protein, DsbA family protein
           [Oceanicola granulosus HTCC2516]
          Length = 264

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 60/225 (26%), Positives = 99/225 (44%), Gaps = 2/225 (0%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             +   +  + L F     +   + +   +  +P G    +       ST++++ IG +D
Sbjct: 1   MKKTLSIALLSLAFAGGGTWLLTQPAGPGDQLLP-GAAQAQDAGEIDTSTIEEMVIGAED 59

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+ EYAS TC HCA FH   +  L+  YI TGK++ + RE   D     A M+ARC 
Sbjct: 60  APVTLTEYASFTCPHCANFHVNHYPELKRDYIDTGKVQMVYREVYFDRFGLWASMIARCG 119

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            +    G    +           +     + L  +A+ AG   +  D CL+D      + 
Sbjct: 120 GEERFFGLTSLIYEEQQDWTSGGDPAGIAENLRRLARTAGLDNDQLDACLSDATTAQTLV 179

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
              +  +E   I STP F I G  + G+ S  +F   +D+ ++ S
Sbjct: 180 QWFEENAEADDITSTPTFLIDGEKFEGNWSSELF-PALDAAVEAS 223


>gi|260432301|ref|ZP_05786272.1| thiol:disulfide interchange protein, DsbA family [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416129|gb|EEX09388.1| thiol:disulfide interchange protein, DsbA family [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 221

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 56/202 (27%), Positives = 87/202 (43%), Gaps = 1/202 (0%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
           Y    S+      P              ST+ ++  G +DAPV ++EYAS TC HCA FH
Sbjct: 19  YWLTQSSGTTPSNPLVGAAEAQQADIDTSTIVEMVQGAEDAPVEIIEYASYTCPHCANFH 78

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
              +K L+ +YI TGK+R+I RE   D     A M+ARC       G    +    ++  
Sbjct: 79  QGPYKQLKKEYIDTGKVRFIYREVYFDRYGIWASMVARCGGPEKFFGITDLIYKGQSEWT 138

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                    + L  + + AG S +  + CL D      + A  ++ +E   I +TP F +
Sbjct: 139 RAGGPAEIVEELRKIGRLAGLSNDQLEACLQDGTKAQTLVAWYQKNAEKDGIQATPSFIV 198

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G     + S   F  +I+  +
Sbjct: 199 NGKKVD-NQSYDEFKALIEKEL 219


>gi|218462075|ref|ZP_03502166.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli Kim
           5]
          Length = 214

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 87/205 (42%), Positives = 127/205 (61%), Gaps = 7/205 (3%)

Query: 27  RKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNK 86
              ++  ++   DG VD   +L   P  + ++++G+ DAPV +VEY SMTC HCA FHN 
Sbjct: 12  TAATSSADMLQSDGDVDMAEVL--KPGALPEMALGKADAPVKIVEYMSMTCPHCAHFHNT 69

Query: 87  TFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR-----MDGGYWGFVSLLFN 141
           TF  ++ KYI TGK+++I+REFP D  +  A MLARC             Y+  VS+LF 
Sbjct: 70  TFDTIKQKYIDTGKVQFIIREFPFDPRAAAAFMLARCNASNPGQLSAPEQYFPMVSMLFK 129

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
           +Q  W  +++ R ALL M+K AGF+++ F  CL +Q +LD++ A ++R S+DF +D+TP 
Sbjct: 130 QQQVWAAAEDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVDATPT 189

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMI 226
           F I G  Y GDM     SK+IDS+I
Sbjct: 190 FLINGKRYSGDMPVDTMSKLIDSLI 214


>gi|284990329|ref|YP_003408883.1| cyclic nucleotide-binding protein [Geodermatophilus obscurus DSM
           43160]
 gi|284063574|gb|ADB74512.1| cyclic nucleotide-binding protein [Geodermatophilus obscurus DSM
           43160]
          Length = 876

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/212 (20%), Positives = 66/212 (31%), Gaps = 13/212 (6%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            R+GVL   VL  +  +  +      L +   P G      LL       +D   G  DA
Sbjct: 409 ARVGVLVASVLAALLGWALF-----RLADRRRPPGAGARPVLLDPPVDVDRDHVRGPADA 463

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+T+VEY    C  C        +  E    +   +   +    +       +       
Sbjct: 464 PLTLVEYGDFECPFCGRATGTVEELRERFGDRLRYVFRHVPLVGVHPH--ARLAAEAAEA 521

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
               G +W     LF  QD           LL  A  AG   + F   L        ++ 
Sbjct: 522 ADAQGRFWEMHDRLFAGQDR-----LMPTDLLEHAAAAGLDVSRFARDLGSSRFARRVEE 576

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
             + A E   +  TP FF+ G  + G      
Sbjct: 577 DVESA-EASGVTGTPTFFVNGRRHTGPFDADS 607


>gi|260460275|ref|ZP_05808527.1| DSBA oxidoreductase [Mesorhizobium opportunistum WSM2075]
 gi|259033920|gb|EEW35179.1| DSBA oxidoreductase [Mesorhizobium opportunistum WSM2075]
          Length = 247

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 92/243 (37%), Positives = 126/243 (51%), Gaps = 24/243 (9%)

Query: 4   STTRIGVLGGIVLL-FIASYFFYTRKGSALNELPIPDGVVDFRALLAAS----------- 51
           S +R  VL  +  +  +A     +  G       +        A  A             
Sbjct: 9   SLSRRNVLSSLAAIPAVALLAACSDSGEQAKAADVKPADPATPAKPATPAAVQVPEAQGT 68

Query: 52  --------PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
                   P  + D  +G+ DA VT+VEYASMTC HCA F   TF  L+ KYI TGK RY
Sbjct: 69  VDMAELLKPGALPDKQLGKDDAKVTIVEYASMTCPHCAHFAETTFPELKTKYIDTGKARY 128

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           ILREFP D  +    MLARC        Y+  V +LF +Q +W+  +N +DALL ++K A
Sbjct: 129 ILREFPFDPSAEAGFMLARC----AKDNYFPMVDVLFRQQANWVGVQNTKDALLQISKLA 184

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           GF++  F+ CL DQ +LDD+++ +KR + +F +DSTP FFI G  Y G MS    S IID
Sbjct: 185 GFTQESFEACLTDQKLLDDVRSVQKRGANEFKVDSTPTFFINGKTYKGAMSIEEISAIID 244

Query: 224 SMI 226
            ++
Sbjct: 245 PLL 247


>gi|255261725|ref|ZP_05341067.1| thiol:disulfide interchange protein, DsbA family [Thalassiobium sp.
           R2A62]
 gi|255104060|gb|EET46734.1| thiol:disulfide interchange protein, DsbA family [Thalassiobium sp.
           R2A62]
          Length = 218

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/221 (24%), Positives = 94/221 (42%), Gaps = 5/221 (2%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R  +L  + +  +    ++  K     +   P              S +K+++IG ++AP
Sbjct: 3   RRTLLASLGVAIVGGGAYFLTKPQTSGD---PLLGAANAQTTDVDTSGIKEMAIGDENAP 59

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           +T+VEYAS TC HCA FH   +  L+  YI+TGK+R+I RE   D     A M+ARC   
Sbjct: 60  ITIVEYASFTCPHCASFHANQYPQLKANYIETGKVRFIYREVYFDRPGLWASMMARCGGD 119

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
                    +     +     +       L  +    G   ++ D C+ D  +  ++   
Sbjct: 120 SRFFAIADMLYARQREWTQ-GDGGAVASNLRKIGLSVGIDADEIDACMADGEMAQNLVGW 178

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            +  ++   + STP   I G  +  +MS G  S ++D  + 
Sbjct: 179 YRENADADQVQSTPTLIIDGEKFS-NMSYGDLSALLDEKLA 218


>gi|91975677|ref|YP_568336.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB5]
 gi|91682133|gb|ABE38435.1| Twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris BisB5]
          Length = 222

 Score =  120 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 81/223 (36%), Positives = 114/223 (51%), Gaps = 3/223 (1%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR      + L  +A++         L +     G     A     P ++ D++IG KD
Sbjct: 2   ITRRTFTAALSLTGLAAFA--GMSPFRLIDDAFAQGGQAATAADVTKPMSLPDMAIGPKD 59

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT+ EYAS+TC HCA F+ + F  L+  YI  GK+RY+ REFPLD  +    ML RC 
Sbjct: 60  AAVTITEYASLTCSHCATFNEQVFPKLKAAYIDPGKVRYVFREFPLDIKAAAGSMLTRCI 119

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            K     Y+    LLF  Q DW+        L  + K AG S  + + CL DQ +LD I 
Sbjct: 120 AKDDAQKYFAVTDLLFKSQVDWVLKDTTEQ-LKRIGKQAGLSGAEVEACLKDQALLDKIA 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           A +K A+E   ++STP FFI G +  G+ S   F+K ID +++
Sbjct: 179 ADQKYANEVLKVNSTPSFFINGEMLKGETSLEEFAKRIDPLLK 221


>gi|13476252|ref|NP_107822.1| hypothetical protein mlr7525 [Mesorhizobium loti MAFF303099]
 gi|14027013|dbj|BAB53967.1| mlr7525 [Mesorhizobium loti MAFF303099]
          Length = 250

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 123/243 (50%), Gaps = 24/243 (9%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELP--------------------IPDGVVD 43
           S +R  VL  +  +   +            +                      +P+    
Sbjct: 12  SLSRRNVLSSLAAIPAVALLAACSDSGEQAKAADVKPADPAAPAKPATPAAAKVPESQGT 71

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
                   P  + D  +G+ DA VT+VEYASMTC HCA F   TF  L+ KYI TGK RY
Sbjct: 72  VDMAELLKPGALPDKQLGKDDAKVTIVEYASMTCPHCAHFAETTFPDLKTKYIDTGKARY 131

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           ILREFP D  +    MLARC        Y+  V +LF +Q +W+   N +DALL ++K A
Sbjct: 132 ILREFPFDPSAEAGFMLARC----AKDNYFPMVDVLFRQQPNWVGVSNTKDALLQISKLA 187

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           GF++  F+ CL DQ +LDD+++ +KR + +F +DSTP FFI G  Y G MS    S IID
Sbjct: 188 GFTQESFEACLTDQKLLDDVRSVQKRGANEFKVDSTPTFFINGKTYKGAMSIEEMSAIID 247

Query: 224 SMI 226
            ++
Sbjct: 248 PLL 250


>gi|108762810|ref|YP_633122.1| putative lipoprotein [Myxococcus xanthus DK 1622]
 gi|108466690|gb|ABF91875.1| putative lipoprotein [Myxococcus xanthus DK 1622]
          Length = 361

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 67/201 (33%), Gaps = 9/201 (4%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
               + +         ++    +       G + APVT+VE++   C  C+  +    + 
Sbjct: 170 KSANVKLTLPEPPRPPVVRKQVAATGAAKGGPEGAPVTIVEFSDFQCPFCSRANPALAQV 229

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
            ++      K+R + R FPLD                  G +W    LLF  Q       
Sbjct: 230 QQEYGD---KVRIVFRHFPLDFHKEAPKASEASLCAGDQGKFWEMHDLLFANQQALGV-- 284

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
              D+L   A         F+ CL+       ++       +   +  TP FFI G L  
Sbjct: 285 ---DSLKKYAADLQLDTAKFNACLDSGEKGAIVQKDLAEG-KQAGVSGTPAFFINGILLS 340

Query: 211 GDMSEGVFSKIIDSMIQDSTR 231
           G      F  IID+ +    +
Sbjct: 341 GAQPFEEFKSIIDAELNAPKK 361


>gi|126460893|ref|YP_001042007.1| periplasmic thiol-disulphide interchange protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126102557|gb|ABN75235.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Rhodobacter sphaeroides ATCC 17029]
          Length = 223

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 64/218 (29%), Positives = 96/218 (44%), Gaps = 2/218 (0%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           L  + L  +A    +     A      P       A  A + + ++D+S+G +DAPVT+V
Sbjct: 7   LAALALTTVAGVALWNGSRDAGQTQLPPMAASAQEAGAAQTTAAVEDMSMGAEDAPVTIV 66

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           EYAS TC HCA F  +    L+  YI TGK+R+  RE   D     A M+ARC  +    
Sbjct: 67  EYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREVYFDRYGLWAAMVARCGGEMRYF 126

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
           G    +     +     +       L  + K AG      D C+NDQ   + + A  ++ 
Sbjct: 127 GIADLIFEQQKE-WVTNDPAQVATNLRKIGKTAGLDDAALDACMNDQAKAEAMVAAFQKN 185

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           S+   I +TP   I G  +  +MS     KIID+ +  
Sbjct: 186 SQADDITATPSLIINGTKHS-NMSYEELKKIIDAELAK 222


>gi|75676791|ref|YP_319212.1| protein-disulfide isomerase [Nitrobacter winogradskyi Nb-255]
 gi|74421661|gb|ABA05860.1| Protein-disulfide isomerase [Nitrobacter winogradskyi Nb-255]
          Length = 220

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 80/226 (35%), Positives = 117/226 (51%), Gaps = 6/226 (2%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR      + L  +A+       G +           +  A   A P ++ D+++G 
Sbjct: 1   MIITRRAFNAALSLTGLAAVA-----GLSPWRFLGVAQAQNATAADVAKPVSLPDMALGP 55

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           KDA VT+ EYASMTC HCA F    F  ++ +YI T K+RY+ REFPLD  +    MLAR
Sbjct: 56  KDAAVTITEYASMTCPHCARFAEDVFPKIKTEYIDTNKIRYVFREFPLDIKAAAGAMLAR 115

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           C  K   G Y+  +  LF  QD W  SK     L  + K  G ++ + + CL DQ +LD 
Sbjct: 116 CIAKDDAGKYFAVIDTLFKSQDTWTGSKTTES-LKLIGKQTGLTEGEVENCLKDQALLDK 174

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           I A +K A+E   ++STP FFI G++  G+++   F   ID +++ 
Sbjct: 175 IAADQKYANEVLKVNSTPSFFINGDMVKGEIAFEDFKNKIDPLLKK 220


>gi|77462003|ref|YP_351507.1| periplasmic thiol-disulphide interchange protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|77386421|gb|ABA77606.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Rhodobacter sphaeroides 2.4.1]
          Length = 228

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 64/218 (29%), Positives = 96/218 (44%), Gaps = 2/218 (0%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           L  + L  +A    +     A      P       A  A + + ++D+S+G +DAPVT+V
Sbjct: 12  LAALALTTVAGVALWNGSRDAGQTQLPPMAASAQEAGAAQTTAAVEDMSMGAEDAPVTIV 71

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           EYAS TC HCA F  +    L+  YI TGK+R+  RE   D     A M+ARC  +    
Sbjct: 72  EYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREVYFDRYGLWAAMVARCGGEMRYF 131

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
           G    +     +     +       L  + K AG      D C+NDQ   + + A  ++ 
Sbjct: 132 GIADLIFEQQKE-WVTNDPAQVATNLRKIGKTAGLDDAALDACMNDQAKAEAMVAAFQKN 190

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           S+   I +TP   I G  +  +MS     KIID+ +  
Sbjct: 191 SQADDITATPSLIINGTKHS-NMSYEELKKIIDAELAK 227


>gi|86748193|ref|YP_484689.1| twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris HaA2]
 gi|86571221|gb|ABD05778.1| Twin-arginine translocation pathway signal [Rhodopseudomonas
           palustris HaA2]
          Length = 224

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 82/226 (36%), Positives = 116/226 (51%), Gaps = 3/226 (1%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR      + L  +A+    +      +            A   A P ++ D+++G KD
Sbjct: 2   ITRRTFTAALSLTGLAAVAGVSPFRLIGDAFAQ--SSAAATAADVAKPMSLPDMALGPKD 59

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT+ EYASMTC HCA F+ + F  L+  YI TGK+RY+ REFPLD  +    ML+RC 
Sbjct: 60  AAVTITEYASMTCSHCATFNEEVFPKLKAAYIDTGKVRYVFREFPLDIKAAAGSMLSRCI 119

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            K     Y+    LLF  Q DW+        L  + K AG S  D + CL DQ +LD I 
Sbjct: 120 AKDDSAKYFAVTDLLFKTQADWVMKDTTEQ-LKRIGKQAGLSAADVEACLKDQALLDKIA 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           A +K A+E   ++STP FF+ G +  G+ S   F+K ID ++Q  +
Sbjct: 179 ADQKYANEVLKVNSTPSFFVNGEMLRGETSLEEFAKRIDPLLQKKS 224


>gi|153007957|ref|YP_001369172.1| DSBA oxidoreductase [Ochrobactrum anthropi ATCC 49188]
 gi|151559845|gb|ABS13343.1| DSBA oxidoreductase [Ochrobactrum anthropi ATCC 49188]
          Length = 220

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 78/188 (41%), Positives = 108/188 (57%), Gaps = 3/188 (1%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           D      A   A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  +++KYI T
Sbjct: 36  DPEGTVDAAKIAEPGKLKDMVYGKADAPVTIVEYASLTCPHCADFTINTFPKIKEKYIDT 95

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
           GK R I REFP D     A      A    +  Y+  V + F +Q  W  +++   ALL 
Sbjct: 96  GKARLIFREFPFD---PRATAAFMLARCAPEDRYFPMVDVFFKQQQQWATAEDGEAALLQ 152

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
           +AK AGF++  F  CL +Q +LDD++A  +R S+DF + +TP FFI G  Y G +S    
Sbjct: 153 IAKLAGFTQESFKACLTNQQVLDDVRATMERGSKDFGVSATPTFFINGQKYAGALSVDEM 212

Query: 219 SKIIDSMI 226
           S IID ++
Sbjct: 213 SAIIDKLL 220


>gi|221640954|ref|YP_002527216.1| periplasmic thiol-disulfide interchange protein [Rhodobacter
           sphaeroides KD131]
 gi|221161735|gb|ACM02715.1| periplasmic thiol-disulphide interchange protein [Rhodobacter
           sphaeroides KD131]
          Length = 223

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 96/218 (44%), Gaps = 2/218 (0%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           L  + L  +A    +     A      P       A  A + + ++D+S+G +DAPVT+V
Sbjct: 7   LAALALTTVAGVALWNGSRDAGQTQLPPMAASAQEAGAAQTTAAVEDMSMGAEDAPVTIV 66

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           EYAS TC HCA F  +    L+  YI TGK+R+  RE   D     A M+ARC  +    
Sbjct: 67  EYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREVYFDRYGLWAAMVARCGGEMRYF 126

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
           G    +     +     +       L  + K AG      D C+NDQ   + + A  ++ 
Sbjct: 127 GIADLIFEQQKE-WVTNDPAQVATNLRKIGKTAGLDDAALDACMNDQAKAEAMVAAFQKN 185

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           S+   I +TP   + G  +  +MS     KIID+ +  
Sbjct: 186 SQADDITATPSLIVNGTKHS-NMSYEELKKIIDAELAK 222


>gi|310822965|ref|YP_003955323.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396037|gb|ADO73496.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 361

 Score =  118 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 67/194 (34%), Gaps = 9/194 (4%)

Query: 37  IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
                V        +       S G  DAP+T+VE++   C  C++      + ++    
Sbjct: 177 KEKADVQINLPEKRAEVAAIGPSKGPADAPITIVEFSDFQCPFCSKAIQNVDEVMKTYEG 236

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
              K++ + R FPL             A  +    +W F   LF  Q +        D L
Sbjct: 237 ---KVKLVFRHFPLSFHGDAPKAAEAAACAQDQNKFWEFHDKLFASQQNLKV-----DDL 288

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
              A   G     F+ CL+     + +K       E   +  TP FFI G    G +   
Sbjct: 289 KKYATELGLDSARFNECLDSNKKAELVKKDMADG-EKVGVTGTPAFFINGVALSGAVPAS 347

Query: 217 VFSKIIDSMIQDST 230
            F  IID+ ++   
Sbjct: 348 EFKTIIDAELKKKK 361


>gi|108757235|ref|YP_631407.1| DSBA-like thioredoxin domain-containing protein [Myxococcus xanthus
           DK 1622]
 gi|108461115|gb|ABF86300.1| DSBA-like thioredoxin domain protein [Myxococcus xanthus DK 1622]
          Length = 551

 Score =  118 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 45/219 (20%), Positives = 73/219 (33%), Gaps = 10/219 (4%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD-VSIGQKDAPVTMVEY 72
           +V   + +   Y +     +E   P       A          D  S G  +A VT+VE+
Sbjct: 124 LVKGGVPASQVYAKIIEKGSERAAPKAQPQQPAATVRKVEIPSDSPSFGPANAKVTIVEW 183

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGY 132
           +   C  C+       K    K      +R + R  PL       +           G +
Sbjct: 184 SDFECPFCSRVGPTLSKI---KESYAKDVRVVFRHQPLPFHPNAKLAAEASHAAHEQGKF 240

Query: 133 WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASE 192
           W +   LF  Q         R +L   A+  G +   F   L+       ++A    A  
Sbjct: 241 WEYHDKLFANQKAMD-----RASLEKYAQELGLNVAKFKAALDSGKFKAKVEADMA-AGN 294

Query: 193 DFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
               + TP FFI G  ++G      F ++ID  I  + +
Sbjct: 295 AVGANGTPTFFINGREFVGAQPFEAFKRVIDEEIGKADK 333



 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 64/177 (36%), Gaps = 9/177 (5%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
                    G K+APVT+V ++   C  C+       +  +       K++   +  PL 
Sbjct: 375 VDVGNAPVKGDKNAPVTIVAFSDFECPFCSRVVPTLKQLEDQYGG---KIKVAFKNQPLP 431

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             +   +  A        G +W +   LF  Q         R +L   A+  G + + F 
Sbjct: 432 FHANAKLAAAAALAANEQGKFWEYHDKLFANQRALD-----RASLEKYAQELGLNVDKFK 486

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             L+       I+A   +AS       TP FFI G   +G      F ++ID  ++ 
Sbjct: 487 AALDQGKFNAQIEADMAQASS-VGASGTPTFFINGRTLVGAQPVDAFKRVIDEELKK 542



 Score = 69.3 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 42/127 (33%), Gaps = 6/127 (4%)

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
            ++++ PL                   G YW + + LF  Q           +L   AK 
Sbjct: 1   MVMKQNPLSFHPRAKPAAIAAMAAGEQGKYWEYHAKLFANQKKLD-----DVSLEQYAKE 55

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G + + +   L +    D I   +  A +      TP FFI G    G      F  +I
Sbjct: 56  LGLNLDKWKAELGNPKFQDIITRDQALAGQ-LGASGTPAFFINGRFLSGAQPIANFQALI 114

Query: 223 DSMIQDS 229
           D  +  +
Sbjct: 115 DEELVKA 121


>gi|239831368|ref|ZP_04679697.1| DSBA oxidoreductase [Ochrobactrum intermedium LMG 3301]
 gi|239823635|gb|EEQ95203.1| DSBA oxidoreductase [Ochrobactrum intermedium LMG 3301]
          Length = 225

 Score =  118 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 79/193 (40%), Positives = 113/193 (58%), Gaps = 5/193 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           +   P+G VD   +    P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  +++
Sbjct: 38  QQRSPEGTVDAAKIAE--PGKLKDMVYGKADAPVTIVEYASLTCPHCADFTINTFPKIKE 95

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           KYI TGK R I REFP D     A      A    +  Y+  V + F +Q  W  +++  
Sbjct: 96  KYIDTGKARLIFREFPFD---PRATAAFMLARCAPEDRYFPMVDVFFKQQQQWATAEDGE 152

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
            ALL +AK AGF++  F  CL +Q +LDD++A  +R S+DF +++TP FFI G  Y G +
Sbjct: 153 AALLQIAKLAGFTQESFKACLTNQQLLDDVRATMERGSKDFGVNATPTFFINGQKYAGAL 212

Query: 214 SEGVFSKIIDSMI 226
           S    S IID ++
Sbjct: 213 SVDEMSAIIDKLL 225


>gi|86160366|ref|YP_467151.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776877|gb|ABC83714.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 349

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 64/188 (34%), Gaps = 9/188 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
              +           S G  DAP+T+VE++   C  C          +        K+R 
Sbjct: 170 PAYMPPKVEVAATGPSKGPADAPITIVEFSDYQCPFCVRAEPTMKDVMAAYPG---KVRV 226

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           + R+FPL S                 G YW     LF       N K   D L   A+  
Sbjct: 227 VYRDFPLPSHDLAPKAAEAAHCAGDQGKYWEMHDRLFAA-----NGKLAVDDLKGYAREV 281

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G     FD CL        ++   K A E   +  TP FFI G L  G      F  +ID
Sbjct: 282 GVDGAKFDRCLESGEKAPVVQEHHK-AGEAAGVSGTPAFFINGRLISGAQPLEAFKAVID 340

Query: 224 SMIQDSTR 231
             ++ + +
Sbjct: 341 QELKAAGK 348


>gi|220919173|ref|YP_002494477.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957027|gb|ACL67411.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 349

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 65/189 (34%), Gaps = 9/189 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
              +           S G  DAP+T+VE++   C  C          +        K+R 
Sbjct: 170 PAYMPPKVEVAATGPSKGPNDAPITIVEFSDFQCPFCVRAEPTVKDVMAAYPG---KVRV 226

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           + R+FPL S                 G YW     LF       N K   D L   A+  
Sbjct: 227 VYRDFPLPSHDLAPKAAEAAHCAGDQGKYWEMHDRLFAA-----NGKLAVDDLKGYAREV 281

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G     FD CL        ++   K A E   +  TP FFI G L  G      F  +ID
Sbjct: 282 GADGAKFDRCLESGEKAPVVQEHHK-AGEAAGVSGTPAFFINGRLISGAQPLEAFKAVID 340

Query: 224 SMIQDSTRR 232
             ++ + ++
Sbjct: 341 QELKAAGKQ 349


>gi|24214838|ref|NP_712319.1| oxidoreductase [Leptospira interrogans serovar Lai str. 56601]
 gi|45657648|ref|YP_001734.1| hypothetical protein LIC11782 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24195853|gb|AAN49337.1| oxidoreductase [Leptospira interrogans serovar Lai str. 56601]
 gi|45600888|gb|AAS70371.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 348

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 83/202 (41%), Gaps = 9/202 (4%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
              G   N+  I   V +   L   +     + SIG ++A VT++E++   C  C    +
Sbjct: 155 NFFGQLRNQYNISVKVKELPPLRDNTILAGNNPSIGPENAKVTVIEFSDFECPFCKRSQS 214

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
              +    +     ++R++ R++PL                   G YW F  +LF+    
Sbjct: 215 VNSQL---REKYKDQIRWVFRDYPLSFHPNAMFAHIAANCSASQGKYWEFFKVLFDN--- 268

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
             +    +D +L++A+  G     F  C+ND  +  +++A      E + +  TP FFI 
Sbjct: 269 --SGNLPKDRVLDLARGLGLDMKVFSQCVNDSEVRKEVEADMAEG-EKYGVSGTPAFFIN 325

Query: 206 GNLYLGDMSEGVFSKIIDSMIQ 227
           G +  G      F K+ID  ++
Sbjct: 326 GVMIEGAQPIEAFIKVIDQELK 347


>gi|319784675|ref|YP_004144151.1| DSBA oxidoreductase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170563|gb|ADV14101.1| DSBA oxidoreductase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 247

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 124/243 (51%), Gaps = 24/243 (9%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAAS------------ 51
           S +R  VL  +  +   +            +               A+            
Sbjct: 9   SLSRRNVLSSLAAIPAVALLAACSDSGEEAKAANVKPAEPAAPAKPATPAAATAPEAQGT 68

Query: 52  --------PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
                   P  + D  +G+ DA VT+VEYASMTC HCA F   TF  L+ KYI TGK+RY
Sbjct: 69  VDMTELMKPGALPDKQLGKDDAKVTIVEYASMTCPHCAHFAETTFPDLKTKYIDTGKVRY 128

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           ILREFP D  +    MLARC        Y+  V +LF +Q +W+  +N +DALL ++K A
Sbjct: 129 ILREFPFDPSAEAGFMLARC----AKDNYYPMVDVLFRQQANWVGVQNTKDALLQISKLA 184

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           GF++  F+ CL DQ +LDD+++ +KR + +F +DSTP FFI G  Y G MS    S IID
Sbjct: 185 GFTQESFEACLTDQKLLDDVRSVQKRGANEFKVDSTPTFFINGKTYKGAMSIEEMSAIID 244

Query: 224 SMI 226
            ++
Sbjct: 245 PLL 247


>gi|115374181|ref|ZP_01461468.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310820898|ref|YP_003953256.1| DSBA-like thioredoxin domain-containing protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115368848|gb|EAU67796.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309393970|gb|ADO71429.1| DSBA-like thioredoxin domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 656

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/206 (18%), Positives = 63/206 (30%), Gaps = 9/206 (4%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
            Y +        P P                      G  +APVT+V ++   C  C+  
Sbjct: 450 LYAKIMEDAANAPPPSAEPAEAEPAVQKIEVGNAPVKGPANAPVTIVAFSDFECPFCSRV 509

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                +    +    GK+R   +  PL   +      A        G +W +   LF  Q
Sbjct: 510 VPTLKQL---EEGYKGKIRVAFKNQPLPFHANAKPAAAAALAAHEQGKFWEYHDKLFANQ 566

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
                    R +L   A+        F   L+       I A     +     + TP FF
Sbjct: 567 KALD-----RASLERYAEELKLDMGKFKAALDSNKFDAQITADSTEGT-RVGANGTPTFF 620

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDS 229
           I G   +G      F ++ID  ++ +
Sbjct: 621 INGRTLVGAQPADAFKRVIDEELKKA 646



 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 60/179 (33%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
                 + G KDA VT+VE++   C  C        K    K      +R + R  PL  
Sbjct: 270 VPSDSPAFGPKDAKVTIVEWSDFECPFCGRVMPTLAKI---KETYGKDVRVVFRHQPLPF 326

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            S+  +           G +W F   LF+ Q         R +L   A+      N F  
Sbjct: 327 HSSAKLAAEASMAAHEQGKFWEFHDKLFSNQKALD-----RASLEKYAQELKLDVNKFKA 381

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            L+       ++A    A      + TP FFI G   +G      F   ID     + +
Sbjct: 382 ALDSGKFRAKVEAD-STAGSAVGANGTPTFFINGRQLVGAQPFESFKAAIDEERAKADK 439



 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 69/230 (30%), Gaps = 17/230 (7%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAAS--------PSTMKDVS 59
           + ++ G+VL F         K +  +                A+                
Sbjct: 7   VALVVGLVLGFFGGKAASGSKSNEGSAPTAAAPSQPSAPAQPAAPTASPVFKVPLENSPV 66

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
            G  DA VTMVE++   C  C+       K          KLR ++++ PL         
Sbjct: 67  KGSPDALVTMVEFSDYQCPFCSRADATVKKLQ---EEYGNKLRVVMKQNPLSFHPRAKPA 123

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                     G YW +   LF               L   A   G   N +   L+ ++ 
Sbjct: 124 ALGALAAGEQGKYWEYHDKLFANARALE-----DADLEKYASEIGLDVNRWKKDLSKESF 178

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
              I   +  A +    + TP FFI G L  G      F  +ID     +
Sbjct: 179 QQIITRDQTLAGQ-LGANGTPAFFINGRLLSGAQPLERFKALIDEEYGKA 227


>gi|161528651|ref|YP_001582477.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339952|gb|ABX13039.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 221

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/215 (20%), Positives = 78/215 (36%), Gaps = 7/215 (3%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           L+ IA+         +          +D    +    +++    +G  +AP+T++E+   
Sbjct: 8   LIVIAAGVITVGAIFSTTSNDSESINLDMNRKIGTVDTSLGSPILGSPNAPITIIEFGDY 67

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C ++   T   +   YI TGK+  +  +                      G YW +
Sbjct: 68  QCSNCKKWFLDTKPDIMTNYIDTGKVNLVFVDIAF-LGKDSGPASVATYCAEEQGKYWEY 126

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
              L++ Q    N     D+L   A   G +   F +CL+ +     ++      S+   
Sbjct: 127 HGFLYSNQMSIDNGWANSDSLKGYANNLGLNMEMFVSCLDSEKYSKRVQFNTDE-SKRNG 185

Query: 196 IDSTPVFFI---GG--NLYLGDMSEGVFSKIIDSM 225
           +  TP FF+    G      G     VF K I+SM
Sbjct: 186 VTGTPTFFVIGPNGEQEKIAGPQPYTVFEKTIESM 220


>gi|254512414|ref|ZP_05124481.1| thiol:disulfide interchange protein, DsbA family [Rhodobacteraceae
           bacterium KLH11]
 gi|221536125|gb|EEE39113.1| thiol:disulfide interchange protein, DsbA family [Rhodobacteraceae
           bacterium KLH11]
          Length = 221

 Score =  117 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 57/222 (25%), Positives = 94/222 (42%), Gaps = 3/222 (1%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            +RI  +    +   A  ++ T+  + L    +        A L    ST+ ++  G +D
Sbjct: 1   MSRIATVICAAVAVAAGGYWLTQSNNTLPPNLLVGAAEAQEAEL--DTSTIVEMVQGAED 58

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APV ++EYAS TC HCA FH   +K L+  +I TGK+++  RE   D     A M+ARCA
Sbjct: 59  APVEIIEYASYTCPHCANFHQGAYKQLKKDFIDTGKVKFTYREVYFDRYGLWASMVARCA 118

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                 G    +    ++           D L  + + AG   +  + CL D      + 
Sbjct: 119 GPEKFFGITDLIYQGQSEWTRAGGPTEIVDELRKIGRLAGIDNDQLEACLQDGTRAQTLV 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A  +  +E   +  TP F + G     +     F K+I+  +
Sbjct: 179 AWYQENAERDDVQGTPSFVVNGKKVD-NQPYDDFKKLIEDEL 219


>gi|86136905|ref|ZP_01055483.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseobacter sp. MED193]
 gi|85826229|gb|EAQ46426.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseobacter sp. MED193]
          Length = 223

 Score =  117 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 57/202 (28%), Positives = 89/202 (44%), Gaps = 1/202 (0%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
           T   S      +P              ST+ ++ +G +DAPVT++EYAS TC HCA FH 
Sbjct: 22  TGYNSQTRLPDLPLVGAASAQEAEVDTSTITEMVMGAEDAPVTLIEYASYTCPHCANFHT 81

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
              K L+++YI TGK++ I RE   D     A M+ARC       G    +    +    
Sbjct: 82  GVLKQLKEEYIDTGKMKLIYREVYFDRYGLWASMIARCGGPEKFFGISDLIYKGQSDWSR 141

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
              +    DAL  +   AG  K+  + CL D      + A  +  +    +++TP F + 
Sbjct: 142 AGGASEIIDALRKIGGIAGLDKDTVEACLQDGTKAQTLVAWYQENATADGVEATPSFVLN 201

Query: 206 GNLYLGDMSEGVFSKIIDSMIQ 227
           G     + S   F  +ID+ ++
Sbjct: 202 GTRIS-NQSYEDFKALIDAELE 222


>gi|306842221|ref|ZP_07474885.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. BO2]
 gi|306287663|gb|EFM59107.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. BO2]
          Length = 238

 Score =  117 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 80/197 (40%), Positives = 118/197 (59%), Gaps = 5/197 (2%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
            A  +   P+G+VD   +  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF 
Sbjct: 26  GANAQQHAPEGIVDATEI--AKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLVTFP 83

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  +
Sbjct: 84  KIKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDRYFPMIDLFFKQQQQWATA 140

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
           ++ + ALL +AK AGF++  F+ CL +Q +LDD++A  +R S++F +++TP FFI G  Y
Sbjct: 141 EDGKAALLQIAKLAGFTQESFEACLTNQQLLDDVRATVERGSKEFGVNATPTFFINGKKY 200

Query: 210 LGDMSEGVFSKIIDSMI 226
            GD+S    S  IDS +
Sbjct: 201 AGDLSFEEMSGFIDSAL 217


>gi|197124443|ref|YP_002136394.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
 gi|196174292|gb|ACG75265.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
          Length = 348

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 64/188 (34%), Gaps = 9/188 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
              +           S G  DAP+T+VE++   C  C          +        K+R 
Sbjct: 170 PAYMPPKVEVAATGPSKGPNDAPITIVEFSDFQCPFCVRAEPTVKDVMAAYPG---KVRV 226

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           + R+FPL S                 G YW     LF       N K   D L   A+  
Sbjct: 227 VYRDFPLPSHDLAPKAAEAAHCAGDQGKYWEMHDRLFAA-----NGKLAVDDLKGYAREV 281

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G     FD CL        ++   K A E   +  TP FFI G L  G      F  +ID
Sbjct: 282 GVDGAKFDRCLESGEKAPVVQEHHK-AGEAAGVSGTPAFFINGRLISGAQPLEAFKAVID 340

Query: 224 SMIQDSTR 231
             ++ + +
Sbjct: 341 QELKAAGK 348


>gi|260566902|ref|ZP_05837372.1| DSBA oxidoreductase [Brucella suis bv. 4 str. 40]
 gi|260156420|gb|EEW91500.1| DSBA oxidoreductase [Brucella suis bv. 4 str. 40]
          Length = 245

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 53  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPK 112

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 113 IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 169

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 170 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 229

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 230 GDLSFEEMSGFIDSAL 245


>gi|83855279|ref|ZP_00948809.1| thiol:disulfide interchange protein, DsbA family protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83843122|gb|EAP82289.1| thiol:disulfide interchange protein, DsbA family protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 231

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/212 (24%), Positives = 88/212 (41%), Gaps = 1/212 (0%)

Query: 17  LFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMT 76
            F  +    +   + L             A   A+ + ++D+++G  D+ V ++EYAS T
Sbjct: 21  AFSGTNAVNSTPINPLVSAANAQSADTAEADAPAATTEIQDMTLGNPDSAVQIIEYASYT 80

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C HCA F    F+ L+  YI   K+ +  RE   D     A M++RC  +    G    +
Sbjct: 81  CPHCAAFDQGPFQQLKADYIDNDKIGFTYREVYFDRYGLWASMVSRCGGEDKFFGITDMI 140

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
               ++           + L  + + AG    + D CL D      + A  +   +   I
Sbjct: 141 YAGQSEWVRAGEPAAIVEELRKIGRLAGLDNAELDACLQDGEKAQSLVAWWEENQKADDI 200

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           +STP F I G  Y  +M      +IID+ +++
Sbjct: 201 NSTPSFIINGKKYS-NMPYAEMKEIIDAALEE 231


>gi|320162238|ref|YP_004175463.1| DSBA oxidoreductase family protein [Anaerolinea thermophila UNI-1]
 gi|319996092|dbj|BAJ64863.1| DSBA oxidoreductase family protein [Anaerolinea thermophila UNI-1]
          Length = 246

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/219 (20%), Positives = 80/219 (36%), Gaps = 8/219 (3%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAA-SPSTMKDVSIGQKDAPV 67
             LG  V  F  +        S  N+L   +  VD    +         D + G  DAP+
Sbjct: 29  FALGFAVAYFAFAVPLQKEVNSLKNQLAQSNQAVDVPQQVQRYDVPVDDDPAFGPADAPI 88

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T++E++   C  C ++H + +  +++++    +L            +  A          
Sbjct: 89  TIIEFSDYECPFCRKWHLEVWPRIQEEFGGQVRL-VYRDFPLYGLHANAAPSANAANCAG 147

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
             G YW +                 R A   + K  G     F  CL++    D+++A  
Sbjct: 148 EQGKYWEYHD-----GLFTYEGGYSRAAFEEIGKQVGLEMTAFTQCLDENRYKDEVEADY 202

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             A++   + STP FFI G   +G     VF ++I   +
Sbjct: 203 AYAAD-LGVQSTPTFFINGLALIGAQPYEVFRQVIQMEL 240


>gi|134097227|ref|YP_001102888.1| DsbA-like thioredoxin domain-containing protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|291005315|ref|ZP_06563288.1| DsbA-like thioredoxin domain-containing protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|133909850|emb|CAL99962.1| DsbA-like thioredoxin domain protein [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 232

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/221 (20%), Positives = 75/221 (33%), Gaps = 3/221 (1%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVT 68
           GVL   V+  +        +G A                  A       ++ G+ DAPV 
Sbjct: 14  GVLAAAVVFLLGYVLATQNRGDAPPAPEPAPQAQQNPLESLARRDPGDPLAKGRPDAPVV 73

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM 128
           +V Y    C  CA+F       L+ +Y+ TG +  I                        
Sbjct: 74  LVNYTDFRCPFCAKFGRDIEPELQRRYVDTG-VLRIEWRDFPIFGEESLSAAEAGRAAAR 132

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD-TCLNDQNILDDIKAGK 187
            G +W F   +F +     +    R+ L+ +A+ AG          + D  +   I+A  
Sbjct: 133 QGRFWEFHDAVFAQAPPTGHPPMPRERLVELARQAGVPDIQRFEADMGDPGVYAGIQADA 192

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
              ++   + STP F I G    G     VF+++I+     
Sbjct: 193 MEGAQ-LGVSSTPTFVINGQPVFGAQPLEVFTEVIEQARAR 232


>gi|261221714|ref|ZP_05935995.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|265997676|ref|ZP_06110233.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|260920298|gb|EEX86951.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|262552144|gb|EEZ08134.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
          Length = 245

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 75/195 (38%), Positives = 111/195 (56%), Gaps = 3/195 (1%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
                         A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  +
Sbjct: 54  GANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPKI 113

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
           ++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  +++
Sbjct: 114 KEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAED 170

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y G
Sbjct: 171 GKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAG 230

Query: 212 DMSEGVFSKIIDSMI 226
           D+S    S  IDS +
Sbjct: 231 DLSFEEMSGFIDSAL 245


>gi|83941802|ref|ZP_00954264.1| thiol:disulfide interchange protein, DsbA family protein
           [Sulfitobacter sp. EE-36]
 gi|83847622|gb|EAP85497.1| thiol:disulfide interchange protein, DsbA family protein
           [Sulfitobacter sp. EE-36]
          Length = 231

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/212 (24%), Positives = 88/212 (41%), Gaps = 1/212 (0%)

Query: 17  LFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMT 76
            F  +    +   + L             A   A+ + ++D+++G  D+ V ++EYAS T
Sbjct: 21  AFSGTNAVNSTPINPLVSAANAQSAHTAEADAPAATTEIQDMTLGNPDSAVQIIEYASYT 80

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C HCA F    F+ L+  YI   K+ +  RE   D     A M++RC  +    G    +
Sbjct: 81  CPHCAAFDQGPFQQLKADYIDNDKIGFTYREVYFDRYGLWASMVSRCGGEDKFFGITDMI 140

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
               ++           + L  + + AG    + D CL D      + A  +   +   I
Sbjct: 141 YAGQSEWVRAGEPAAIVEELRKIGRLAGLDNAELDACLQDGEKAQSLVAWWEENQKADDI 200

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           +STP F I G  Y  +M      +IID+ +++
Sbjct: 201 NSTPSFIINGKKYS-NMPYAEMKEIIDAALEE 231


>gi|306845124|ref|ZP_07477704.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. BO1]
 gi|306274539|gb|EFM56334.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. BO1]
          Length = 217

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 76/196 (38%), Positives = 111/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 25  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLVTFPK 84

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 85  IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 141

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +LDD++A  +R S++F +++TP FFI G  Y 
Sbjct: 142 DGKAALLQIAKLAGFTQESFEACLTNQQLLDDVRATVERGSKEFGVNATPTFFINGKKYA 201

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 202 GDLSFEEMSGFIDSAL 217


>gi|313679853|ref|YP_004057592.1| dsba oxidoreductase [Oceanithermus profundus DSM 14977]
 gi|313152568|gb|ADR36419.1| DSBA oxidoreductase [Oceanithermus profundus DSM 14977]
          Length = 207

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 52/220 (23%), Positives = 86/220 (39%), Gaps = 17/220 (7%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           ++ GI +L     ++ +                  +A   A P+       G  DAPVT+
Sbjct: 1   MVLGIAILLGGGLWYLSS--------------APKQATAEADPAAGAHFVYGSPDAPVTV 46

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           VE+++  C HC +   K+   +   Y+ TGK+RYI R+FP      V +     A     
Sbjct: 47  VEFSNYLCPHCKDHSEKSLPRIFADYVDTGKVRYIFRDFPFAGQDNVILAGEAAACAADQ 106

Query: 130 GGYWGFVSLLFNK--QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
           G Y+ +  LLF    Q   + +        + A+  G     FD CL+       + A  
Sbjct: 107 GRYYDYHQLLFRATGQWGRVPTSELPSFFSDYARQLGLDTARFDACLSSHEKRPLVLAD- 165

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           +  +    +  TP FF+ G    G      + KI+D  + 
Sbjct: 166 QELTRKLGLGGTPSFFVNGKFIEGFRPYDEWKKILDEALA 205


>gi|225627002|ref|ZP_03785041.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ceti str. Cudo]
 gi|260545771|ref|ZP_05821512.1| DSBA oxidoreductase [Brucella abortus NCTC 8038]
 gi|260563568|ref|ZP_05834054.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|260754275|ref|ZP_05866623.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260757494|ref|ZP_05869842.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260761319|ref|ZP_05873662.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883299|ref|ZP_05894913.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|261213521|ref|ZP_05927802.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|261218507|ref|ZP_05932788.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261317172|ref|ZP_05956369.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261320643|ref|ZP_05959840.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|261324626|ref|ZP_05963823.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|261751841|ref|ZP_05995550.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|261754496|ref|ZP_05998205.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|261757727|ref|ZP_06001436.1| DSBA oxidoreductase [Brucella sp. F5/99]
 gi|265988210|ref|ZP_06100767.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|265990625|ref|ZP_06103182.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994457|ref|ZP_06107014.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|265999581|ref|ZP_05466996.2| DSBA oxidoreductase [Brucella melitensis bv. 2 str. 63/9]
 gi|225618659|gb|EEH15702.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ceti str. Cudo]
 gi|260097178|gb|EEW81053.1| DSBA oxidoreductase [Brucella abortus NCTC 8038]
 gi|260153584|gb|EEW88676.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|260667812|gb|EEX54752.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260671751|gb|EEX58572.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674383|gb|EEX61204.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260872827|gb|EEX79896.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|260915128|gb|EEX81989.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|260923596|gb|EEX90164.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261293333|gb|EEX96829.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|261296395|gb|EEX99891.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261300606|gb|EEY04103.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|261737711|gb|EEY25707.1| DSBA oxidoreductase [Brucella sp. F5/99]
 gi|261741594|gb|EEY29520.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|261744249|gb|EEY32175.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|262765570|gb|EEZ11359.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|263001409|gb|EEZ13984.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094795|gb|EEZ18533.1| DSBA oxidoreductase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660407|gb|EEZ30668.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
          Length = 245

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 53  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPK 112

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 113 IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 169

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 170 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 229

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 230 GDLSFEEMSGFIDSAL 245


>gi|115379912|ref|ZP_01466971.1| disulfide interchange protein [Stigmatella aurantiaca DW4/3-1]
 gi|115363088|gb|EAU62264.1| disulfide interchange protein [Stigmatella aurantiaca DW4/3-1]
          Length = 203

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 67/194 (34%), Gaps = 9/194 (4%)

Query: 37  IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
                V        +       S G  DAP+T+VE++   C  C++      + ++    
Sbjct: 19  KEKADVQINLPEKRAEVAAIGPSKGPADAPITIVEFSDFQCPFCSKAIQNVDEVMKTYEG 78

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
              K++ + R FPL             A  +    +W F   LF  Q +        D L
Sbjct: 79  ---KVKLVFRHFPLSFHGDAPKAAEAAACAQDQNKFWEFHDKLFASQQNLKV-----DDL 130

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
              A   G     F+ CL+     + +K       E   +  TP FFI G    G +   
Sbjct: 131 KKYATELGLDSARFNECLDSNKKAELVKKDMADG-EKVGVTGTPAFFINGVALSGAVPAS 189

Query: 217 VFSKIIDSMIQDST 230
            F  IID+ ++   
Sbjct: 190 EFKTIIDAELKKKK 203


>gi|261315263|ref|ZP_05954460.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|261304289|gb|EEY07786.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
          Length = 245

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 53  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPK 112

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 113 IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 169

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 170 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 229

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 230 GDLSFEEMSGFIDSAL 245


>gi|294851871|ref|ZP_06792544.1| twin-arginine translocation pathway signal protein [Brucella sp.
           NVSL 07-0026]
 gi|294820460|gb|EFG37459.1| twin-arginine translocation pathway signal protein [Brucella sp.
           NVSL 07-0026]
          Length = 217

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 110/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA F   TF  
Sbjct: 25  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCANFKLITFPK 84

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 85  IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 141

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 142 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 201

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 202 GDLSFEEMSGFIDSAL 217


>gi|256159208|ref|ZP_05457019.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|256254535|ref|ZP_05460071.1| DSBA oxidoreductase [Brucella ceti B1/94]
          Length = 217

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 75/195 (38%), Positives = 111/195 (56%), Gaps = 3/195 (1%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
                         A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  +
Sbjct: 26  GANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPKI 85

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
           ++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  +++
Sbjct: 86  KEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAED 142

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y G
Sbjct: 143 GKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAG 202

Query: 212 DMSEGVFSKIIDSMI 226
           D+S    S  IDS +
Sbjct: 203 DLSFEEMSGFIDSAL 217


>gi|17987723|ref|NP_540357.1| thiol:disulfide interchange protein DSBA [Brucella melitensis bv. 1
           str. 16M]
 gi|23501397|ref|NP_697524.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella suis 1330]
 gi|62289477|ref|YP_221270.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699402|ref|YP_413976.1| DSBA oxidoreductase [Brucella melitensis biovar Abortus 2308]
 gi|161618469|ref|YP_001592356.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
 gi|189023726|ref|YP_001934494.1| DSBA oxidoreductase [Brucella abortus S19]
 gi|225852032|ref|YP_002732265.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
 gi|254688788|ref|ZP_05152042.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|254693271|ref|ZP_05155099.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|254696918|ref|ZP_05158746.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701299|ref|ZP_05163127.1| DSBA oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|254703844|ref|ZP_05165672.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|254707776|ref|ZP_05169604.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|254709639|ref|ZP_05171450.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|254712945|ref|ZP_05174756.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|254716701|ref|ZP_05178512.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|254729820|ref|ZP_05188398.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|256031132|ref|ZP_05444746.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|256044209|ref|ZP_05447116.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060629|ref|ZP_05450795.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|256113024|ref|ZP_05453921.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|256257034|ref|ZP_05462570.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|256368949|ref|YP_003106455.1| twin-arginine translocation signal domain protein [Brucella microti
           CCM 4915]
 gi|260168263|ref|ZP_05755074.1| twin-arginine translocation signal domain protein [Brucella sp.
           F5/99]
 gi|17983441|gb|AAL52621.1| thiol:disulfide interchange protein dsba [Brucella melitensis bv. 1
           str. 16M]
 gi|23347293|gb|AAN29439.1| twin-arginine translocation signal domain protein [Brucella suis
           1330]
 gi|62195609|gb|AAX73909.1| twin-arginine translocation signal domain protein [Brucella abortus
           bv. 1 str. 9-941]
 gi|82615503|emb|CAJ10477.1| DSBA oxidoreductase:Twin-arginine translocation pathway signal
           [Brucella melitensis biovar Abortus 2308]
 gi|161335280|gb|ABX61585.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
 gi|189019298|gb|ACD72020.1| DSBA oxidoreductase [Brucella abortus S19]
 gi|225640397|gb|ACO00311.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
 gi|255999107|gb|ACU47506.1| twin-arginine translocation signal domain protein [Brucella microti
           CCM 4915]
 gi|326408526|gb|ADZ65591.1| DSBA oxidoreductase [Brucella melitensis M28]
 gi|326538243|gb|ADZ86458.1| DSBA oxidoreductase [Brucella melitensis M5-90]
          Length = 217

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 25  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPK 84

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 85  IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 141

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 142 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 201

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 202 GDLSFEEMSGFIDSAL 217


>gi|163745416|ref|ZP_02152776.1| thiol:disulfide interchange protein, DsbA family [Oceanibulbus
           indolifex HEL-45]
 gi|161382234|gb|EDQ06643.1| thiol:disulfide interchange protein, DsbA family [Oceanibulbus
           indolifex HEL-45]
          Length = 228

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 60/208 (28%), Positives = 92/208 (44%), Gaps = 1/208 (0%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
           A+  F +    +    P                S + ++ +G ++APVTM+EYAS TC H
Sbjct: 21  AASSFGSSPLGSTALTPFVGAANAQTTEGDVDTSGITEMVMGDENAPVTMIEYASFTCPH 80

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           CA FHN+TFK L+  YI +GK+++I RE   D     A M+ARC  +    G    +   
Sbjct: 81  CATFHNETFKKLKADYIDSGKVKFIYREVFFDRYGLWASMVARCGGQEKFFGIADLIYKS 140

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
            ++           + L  + + AG      D CL D    + + A     SE   I ST
Sbjct: 141 QSEWTRAGEPAAIVEELRKIGRLAGLDNETLDECLKDGEKAEALVAWYTENSEKDDISST 200

Query: 200 PVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           P F I G  +  +MS      ++D+ + 
Sbjct: 201 PSFVIDGKKHS-NMSYADMKDLLDAALA 227


>gi|117923758|ref|YP_864375.1| DSBA oxidoreductase [Magnetococcus sp. MC-1]
 gi|117607514|gb|ABK42969.1| DSBA oxidoreductase [Magnetococcus sp. MC-1]
          Length = 335

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 63/184 (34%), Gaps = 9/184 (4%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
                   + ++    S+G  DAPVT+VE++   C +C        +    K     K++
Sbjct: 158 PEPEEPRYTFNSTMTPSLGAADAPVTIVEFSDFECPYCRRVQPALKQL---KTKYGDKIQ 214

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
           ++ R +PL       +             +W F   LF +  D       R  L  +A  
Sbjct: 215 FVFRHYPLSFHKLAPLASKAAMCGEDQQQFWAFHDALFEEGVDLS-----RAGLDKVAAD 269

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
                  F  CL+       + A      +   +  TP FFI G    G +      K++
Sbjct: 270 LKLDMALFKNCLDSNKHEAKLDADLTEG-QSLGVTGTPTFFINGRKSSGALPYSTLEKMV 328

Query: 223 DSMI 226
           +  +
Sbjct: 329 EQEL 332


>gi|119716099|ref|YP_923064.1| Na+/H+ antiporter NhaA [Nocardioides sp. JS614]
 gi|189029091|sp|A1SHU2|NHAA2_NOCSJ RecName: Full=Na(+)/H(+) antiporter nhaA 2; AltName:
           Full=Sodium/proton antiporter nhaA 2
 gi|119536760|gb|ABL81377.1| sodium/proton antiporter, NhaA family [Nocardioides sp. JS614]
          Length = 616

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 73/220 (33%), Gaps = 13/220 (5%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
              +G+L   VL     +  +        +        D    L        D   G++D
Sbjct: 407 RATVGILIAAVLATGLGWAVFHAAAVLRGQTDA-----DLPRFLDPPVDARHDHVRGRED 461

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           AP+T+VEY    C  CA     T +  E        +   L    +   + +A   A  A
Sbjct: 462 APLTLVEYGDFECPFCARATGVTTELRERFGDDLRYVFRHLPLVDVHPHAELAARAAVAA 521

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
           + +    +W    LLF  Q +        + L   A   G     F   L + +  D ++
Sbjct: 522 DHQG--RFWELHDLLFEHQGELEV-----EDLAGYAADLGLDVEAFLRDLEEDDTADRVR 574

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
                A E      TP FF+GG  + G       ++ ++ 
Sbjct: 575 RDVASA-EASGARGTPTFFVGGVRHTGPHDAETLARALEE 613


>gi|297247890|ref|ZP_06931608.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus bv. 5 str.
           B3196]
 gi|297175059|gb|EFH34406.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus bv. 5 str.
           B3196]
          Length = 220

 Score =  115 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 28  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPK 87

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 88  IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 144

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 145 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 204

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 205 GDLSFEEMSGFIDSAL 220


>gi|258592100|emb|CBE68405.1| DSBA oxidoreductase precursor [NC10 bacterium 'Dutch sediment']
          Length = 355

 Score =  115 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 38/189 (20%), Positives = 66/189 (34%), Gaps = 8/189 (4%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           +       + S     + G KDAP+T+VE++   C +C+       + +     +     
Sbjct: 175 EEPEPTRIAVSAEGAFAQGPKDAPITIVEFSDFQCPYCSRVVATLKEIVRLYPKQVRLAF 234

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
                   +     A            G +WG+   LF  Q                A+ 
Sbjct: 235 R--DFPIANLHPKAAKAHEAARCAGEQGKFWGYHDRLFESQAQATV-----ADFKRFAEQ 287

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
                 +F TCL+       ++A  +  +    I  TP FFI G L +G +   +F K I
Sbjct: 288 LKLDGKNFATCLDSGKYAAAVEADVQEGT-RLGITGTPTFFINGRLVVGALPLEMFQKFI 346

Query: 223 DSMIQDSTR 231
           D  ++ S +
Sbjct: 347 DRELRRSVK 355


>gi|116328111|ref|YP_797831.1| oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116120855|gb|ABJ78898.1| Oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
          Length = 348

 Score =  115 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 70/185 (37%), Gaps = 9/185 (4%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           +   L   + +   + SIG ++A VT++E++   C  C    +   +       +   + 
Sbjct: 172 ELPPLRDDTITAGNNPSIGPENAKVTVIEFSDFECPFCKRSQDVNAQLRAKYKDQIRWVF 231

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
                    +     +          +   +      F K     +    ++ +L++A+ 
Sbjct: 232 RDYPLSFHPNAMFAHIA--------ANCSTFQGKYWEFFKVLFDNSGNLSKERVLDLARG 283

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G     F  C+ND ++  +++A      E + +  TP FFI G +  G      F+K+I
Sbjct: 284 VGLDMKTFSQCVNDASVRKEVEADIAEG-EKYGVSGTPAFFINGIMVEGAQPIEAFTKVI 342

Query: 223 DSMIQ 227
           D  ++
Sbjct: 343 DQELK 347


>gi|116331436|ref|YP_801154.1| oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116125125|gb|ABJ76396.1| Oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 348

 Score =  115 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 81/185 (43%), Gaps = 9/185 (4%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           +   L   + +   + SIG ++A VT++E++   C  C    +   +    +     ++R
Sbjct: 172 ELPPLRDDTITAGNNPSIGPENAKVTVIEFSDFECPFCKRSQDVNAQL---RAKYKDQIR 228

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
           ++ R++PL                   G YW F  +LF+   +       ++ +L++A+ 
Sbjct: 229 WVFRDYPLSFHPNAMFAHIAANCSTSQGKYWEFFKVLFDNSGNLS-----KERVLDLARG 283

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G     F  C+ND ++  +++A      E + +  TP FFI G +  G      F+K+I
Sbjct: 284 VGLDMKTFSQCVNDASVRKEVEADIAEG-EKYGVSGTPAFFINGIMVEGAQPIEAFTKVI 342

Query: 223 DSMIQ 227
           D  ++
Sbjct: 343 DQELK 347


>gi|161528656|ref|YP_001582482.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339957|gb|ABX13044.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 265

 Score =  115 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 85/236 (36%), Gaps = 18/236 (7%)

Query: 10  VLGGIVLLFIASYFFYTRKGSA---------LNELPIPDGVVDFRALLAASPSTMKDVSI 60
           V   IV  F+  Y                   N  P       F   +  + S   D   
Sbjct: 31  VAVSIVSAFLGGYVIGGETAEPKEVVIRESVPNLQPSTASQQQFGPQIIRNISFDDDPMK 90

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVM 119
           G  +A +T+VE++   C  CA+FH  T   +E  YI+TGK+ ++ R+FP  +        
Sbjct: 91  GNPNASITIVEFSDFQCPFCAKFHETTLPLIEQNYIQTGKVNFVYRDFPIQNIHPNAVPA 150

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSKNDFDTCLNDQ 177
                     G +W    ++F  Q  W +    +        A   G    +FD+CL+  
Sbjct: 151 ALASECADDQGKFWEMHDMIFEDQQIWKDLPVAQSVTLYKQYASELGLDSIEFDSCLDSG 210

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGG-----NLYLGDMSEGVFSKIIDSMIQD 228
             +++++         + +  TP FF+G          G      F ++ID  +  
Sbjct: 211 KYIEEVQNDLNDG-RTYGVSGTPGFFVGNADIGFTPISGAQPYSTFQRVIDGQLNR 265


>gi|237814966|ref|ZP_04593964.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus str. 2308 A]
 gi|237789803|gb|EEP64013.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella abortus str. 2308 A]
          Length = 225

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 33  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPK 92

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 93  IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 149

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 150 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 209

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 210 GDLSFEEMSGFIDSAL 225


>gi|291442026|ref|ZP_06581416.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
 gi|291344921|gb|EFE71877.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
          Length = 261

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 66/208 (31%), Gaps = 1/208 (0%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
                 A           +   L  A       +++G  DAPV ++EY+   C  C  F 
Sbjct: 50  GGTAAPATVSTSEAQEPANPELLDLARLDDSDPLALGSPDAPVVLIEYSDFQCPFCGRFA 109

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
            +T   L   Y+  G LR   R FP+    +     A  A  + +  +          + 
Sbjct: 110 RETEPDLVRDYVDKGILRIEWRNFPVFGAESDQAARAGWAAGQQNRFWQFHDEAYAEPRR 169

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                    + +    K        F+  +        I    +       + STP F I
Sbjct: 170 RNAGDFGEDNLISMARKAGIQDLARFEKDMVSDAAHQAIARDSEEGY-GIGVTSTPAFLI 228

Query: 205 GGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
            G   LG     VF+ +ID   + + ++
Sbjct: 229 NGRPVLGAQPTDVFTDLIDEAAEQARQQ 256


>gi|329765084|ref|ZP_08256668.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329138461|gb|EGG42713.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 233

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 50/229 (21%), Positives = 87/229 (37%), Gaps = 10/229 (4%)

Query: 7   RIGVLGGIVLLFIASYFFY---TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
            + +  GI  + I   FF          L   P P        + A +        +G  
Sbjct: 6   SLAIGAGIASVVIIGVFFSFGILNNEPELAVKPTPSTQPGPVQVTADTFMENGSPVLGDP 65

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +AP+T++E+    C+ C +F +KT   L   +++TGK++ I ++F +    +        
Sbjct: 66  NAPITLIEFGDYQCYFCNQFFHKTEDELFKNFVETGKVKVIFKDFTIIGADS-ISAAHAA 124

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                 G +W +   L+N      N       LL  A   G + ++F  C+ D      I
Sbjct: 125 HCADDQGFFWEYHDTLYNNWTGENNGWASSKNLLQFAGDVGLNIDEFSKCMIDSKYSTKI 184

Query: 184 KAGKKRASEDFAIDSTPVFFI---GGN--LYLGDMSEGVFSKIIDSMIQ 227
               K A +D  +  TP FF+           G     VF +I +S ++
Sbjct: 185 ANSNKDA-KDLGLTGTPAFFVISPDNKVTKIGGAQPYDVFERIFNSALE 232


>gi|148658073|ref|YP_001278278.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
 gi|148570183|gb|ABQ92328.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
          Length = 253

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 77/228 (33%), Gaps = 10/228 (4%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI-GQKDAPV 67
            V+G  VLL IA       +         P       A   A+          G  DAPV
Sbjct: 25  LVMGAAVLLVIAVAATIALQNRQSAATATPGRDPARPATGVATGVGADGFFFKGNADAPV 84

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE-- 125
           T+ E++   C  CA +        E +Y+ TGK+R++  E+PL+                
Sbjct: 85  TVTEFSDYQCPGCAYYATILAAQFEQEYVATGKVRFVYHEYPLNGHINGVPAAIAARCAG 144

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
           ++    YW     LF  Q  W    N +   +  A+  G     F+ C       D I  
Sbjct: 145 EQGADNYWAMHDYLFTNQRQWSGQPNPQAQFVAYARQIGLDTAAFERCYTSNRFRDAINQ 204

Query: 186 GKKRASEDFAIDSTPVFFIGGNLY--LGDMSEGV----FSKIIDSMIQ 227
            K    +   I  TP F + G L    G  S         + +D  + 
Sbjct: 205 AKASG-DALRIPGTPSFAVNGQLVDTTGASSVEEIYVRMRQAVDRALA 251


>gi|108804655|ref|YP_644592.1| DSBA oxidoreductase [Rubrobacter xylanophilus DSM 9941]
 gi|108765898|gb|ABG04780.1| DSBA oxidoreductase [Rubrobacter xylanophilus DSM 9941]
          Length = 230

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 78/192 (40%), Gaps = 2/192 (1%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
                           +   S+G++DAPV MVEYA   C +C E+  +    L +KY+++
Sbjct: 39  PADRGAGESPPGGGERLPAPSLGREDAPVVMVEYADFQCPYCGEYAREVQPKLVEKYVES 98

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
           G LR   R+FP     +V   LA     +  G +W +  LL+  Q    +       L+ 
Sbjct: 99  GTLRIEWRDFPYLGQESVNAALAA-RAAQAQGRFWEYHDLLYENQKPVNSGGFSDANLIK 157

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
            AK AG     F+  L        +    +       +  TP F I G + +G   + VF
Sbjct: 158 FAKKAGLDVERFEEDLKSGRYEAAVARDFREGQRR-GVAGTPTFVINGKVVVGAQPQEVF 216

Query: 219 SKIIDSMIQDST 230
            K I+   +++ 
Sbjct: 217 EKAIEKAEREAQ 228


>gi|110346928|ref|YP_665746.1| DSBA oxidoreductase [Mesorhizobium sp. BNC1]
 gi|110283039|gb|ABG61099.1| DSBA oxidoreductase [Chelativorans sp. BNC1]
          Length = 210

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 66/227 (29%), Positives = 110/227 (48%), Gaps = 17/227 (7%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R  ++ G+  + +++ +          E  +              P  + + S G  D
Sbjct: 1   MKRRNLIFGMAAVGMSATYPALLSAQPTPEALLA-------------PGPLPEKSFGPDD 47

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT++EYAS+TC HC  FH   +  L+ KY+ TG++R+++REFP D  ++   M    A
Sbjct: 48  ATVTIIEYASLTCPHCRTFHVNVWPELKKKYVDTGQVRFVMREFPFDPRASAGFM---LA 104

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
               D  ++  + LL+  QD+W    +   AL ++    G    DF+ CL DQ +L+ + 
Sbjct: 105 RCVSDDKWYPTIDLLYRTQDNWARVSDGTAALKSVMGMTGMGTADFEKCLQDQALLEKVT 164

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           A        F +DSTP FFI G +  G +S   FS+IID ++  + +
Sbjct: 165 A-VAEGGRSFGVDSTPTFFINGQMQKGALSIERFSEIIDPLVAAAKQ 210


>gi|182677739|ref|YP_001831885.1| DSBA oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633622|gb|ACB94396.1| DSBA oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 225

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 65/189 (34%), Positives = 102/189 (53%), Gaps = 3/189 (1%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
                       +P  + D+++G + AP+T+VEYASMTC HCA FH +T+  L+ KYI T
Sbjct: 39  AQGTSIPTDQLMAPQALPDIALGSEQAPITIVEYASMTCSHCAAFHAETYPVLKSKYIDT 98

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
           GK+R+ILREFPLD    +A      A           V LLF +Q +W       +AL  
Sbjct: 99  GKVRFILREFPLD---PLATAGFMLARCAGPDKREAMVDLLFAQQKNWAFVDKPLEALAA 155

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
           + K  G  ++ F+ CL DQ++ D +   + +A+E F +++TP FFI G    G++S    
Sbjct: 156 LVKQTGIGQDRFEACLKDQDLFDKVNKVRDQAAEKFNVNATPTFFINGKKQNGEISPDAL 215

Query: 219 SKIIDSMIQ 227
             ++  +++
Sbjct: 216 DALLQPLLK 224


>gi|301167710|emb|CBW27294.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 351

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 7/186 (3%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           +       +        +G  DA V ++E++   C  C++         + KY    K+ 
Sbjct: 173 NEPMRPVFNVPAGDSPFMGGADAKVEIIEFSDFQCPFCSKGAGIINDLKK-KYGNKIKVV 231

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
           +     P  + +  A   A C  ++    +W     +F  Q         R  L+N AK 
Sbjct: 232 FKNFPLPFHNHAKKAAEAALCVHEQDKAKFWQMHDAMFADQTKLD-----RQGLVNSAKS 286

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
               +  F  CL+       ++A  +   ++  + STP FF+ G +  G      FS++I
Sbjct: 287 LKIDEAKFTQCLDSGKYTAKVEATMEEG-KNVGVKSTPTFFVNGKMINGAHPVETFSELI 345

Query: 223 DSMIQD 228
           D  +  
Sbjct: 346 DQELAK 351


>gi|288932140|ref|YP_003436200.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
 gi|288894388|gb|ADC65925.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
          Length = 284

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 60/189 (31%), Gaps = 11/189 (5%)

Query: 40  GVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG 99
                            +   G  +A +T+VE++S  C  CA+F  +T   +   +    
Sbjct: 107 SGEVENEKAEKLIDVENEPWKGDPNAKITIVEFSSYDCPFCAKFALETLPKILQNFSVKV 166

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
             +       + +         +          +                      LL  
Sbjct: 167 VFKDFPIHGEVKAHEAANCAGEQGKYWEYHDVLFQRQEEWRKN----------ESKLLEY 216

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           AK  G + ++F+ CLN     +++   K+   +   +  TP FF+ G +  G      F 
Sbjct: 217 AKELGLNVSEFEICLNSDKYREEVLKDKEEGIK-LGVRGTPTFFVNGKVVEGAKPYEEFE 275

Query: 220 KIIDSMIQD 228
           KI+  + + 
Sbjct: 276 KILKELEEK 284


>gi|239933637|ref|ZP_04690590.1| hypothetical protein SghaA1_35750 [Streptomyces ghanaensis ATCC
           14672]
          Length = 235

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 66/208 (31%), Gaps = 1/208 (0%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
                 A           +   L  A       +++G  DAPV ++EY+   C  C  F 
Sbjct: 24  GGTAAPATVSTSEAQEPANPELLDLARLDDSDPLALGSPDAPVVLIEYSDFQCPFCGRFA 83

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
            +T   L   Y+  G LR   R FP+    +     A  A  + +  +          + 
Sbjct: 84  RETEPDLVRDYVDKGILRIEWRNFPVFGAESDQAARAGWAAGQQNRFWQFHDEAYAEPRR 143

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                    + +    K        F+  +        I    +       + STP F I
Sbjct: 144 RNAGDFGEDNLISMARKAGIQDLARFEKDMVSDAAHQAIARDSEEGY-GIGVTSTPAFLI 202

Query: 205 GGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
            G   LG     VF+ +ID   + + ++
Sbjct: 203 NGRPVLGAQPTDVFTDLIDEAAEQARQQ 230


>gi|156743646|ref|YP_001433775.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
 gi|156234974|gb|ABU59757.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
          Length = 268

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/221 (20%), Positives = 86/221 (38%), Gaps = 9/221 (4%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAAS---PSTMKDV-SIGQKDAPVTM 69
            V+    +           +E P P GV    A        PS   D  ++G  DAP+ +
Sbjct: 46  AVVALPTATRQTVVVRPTDSERPRPSGVTPVPAPTDVPERAPSFDGDPRTMGDPDAPIVV 105

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKRM 128
           VE++   C  CA F  +    +E++Y+ TGK+R++ R+FP +       +          
Sbjct: 106 VEFSDFQCPFCASFSREVRPLIEERYVSTGKVRFVYRDFPLMSIHPGALLAAHVANCAGD 165

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF---SKNDFDTCLNDQNILDDIKA 185
            G +W   + +F   +    +           K+A            C+        I+ 
Sbjct: 166 QGAFWEMHNRIFAGMEQREWASGDAGDFRTFLKYADELNLDTAQVQQCVESNRHGPRIQE 225

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             + A++   + STP F I G L +G     V+ ++ ++++
Sbjct: 226 DIQ-AAQRAGVRSTPSFLINGQLLVGAQPFEVWERMFETIL 265


>gi|188582613|ref|YP_001926058.1| DsbA oxidoreductase [Methylobacterium populi BJ001]
 gi|179346111|gb|ACB81523.1| DsbA oxidoreductase [Methylobacterium populi BJ001]
          Length = 217

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 78/222 (35%), Positives = 104/222 (46%), Gaps = 8/222 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR   L    L    +    +    AL +                 P  + DV +G  D
Sbjct: 2   ITRRDALKITGLALGTAALLPSFSLEALAQ--------SADTAALMQPGPLGDVWLGPAD 53

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT++EYASMTC HCA FH  T+  L+++YI TGK+R+ LREFPLD ++T A MLARC 
Sbjct: 54  AKVTIIEYASMTCSHCAHFHATTWPVLKERYIDTGKVRFTLREFPLDPLATAAFMLARCD 113

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                      +             ++  DAL  + + AGFSK  F+ CL DQ     I 
Sbjct: 114 GDAKYYPITDLLFDQQPNWAFVRKPQSPVDALEQLLRQAGFSKEKFEACLKDQKTYAAIN 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A K R  E   ++STP FFI G    G +S     KII  ++
Sbjct: 174 AVKTRGLETLKVESTPTFFINGEKRAGALSIEEMEKIIKPIL 215


>gi|126736226|ref|ZP_01751969.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter sp. CCS2]
 gi|126714392|gb|EBA11260.1| thiol-disulfide oxidoreductase D, Putative [Roseobacter sp. CCS2]
          Length = 221

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 95/223 (42%), Gaps = 4/223 (1%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R  +L       +A    +T          +P   +   A   A      ++ +G  +
Sbjct: 1   MKRRTLLAAGGGALVALGAGWTLTRPDPQTGLLPGAAMAQTADGEAPEVV--EMILGDPN 58

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APV ++EYAS TC HCA FH   FK L++ YI TG++++I RE   D     A M+ARC+
Sbjct: 59  APVEVIEYASFTCPHCATFHANQFKALKENYIDTGRIKFIYREVYFDRPGLWASMIARCS 118

Query: 125 EKRMDGGYW-GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                   +   +     +     +     + L  +AK AG      D CL+D    + +
Sbjct: 119 NDADFFFAFSELLYAEQREWAGSGDPATIIEELRTLAKTAGLDDATLDACLSDGAKAEAL 178

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
               +  +E   + STP F I G  Y  +M+   F+ I+D  +
Sbjct: 179 FTWYQENAERDEVRSTPTFMIDGQQYS-NMAYDEFAGILDGKL 220


>gi|115371834|ref|ZP_01459147.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310824163|ref|YP_003956521.1| DSBA-like thioredoxin domain-containing protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115371069|gb|EAU69991.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309397235|gb|ADO74694.1| DSBA-like thioredoxin domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 667

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 63/209 (30%), Gaps = 8/209 (3%)

Query: 22  YFFYTRKGSALNELPIPDGVVDFRALL-AASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
             +     + L E+P P             +       + G KDAP+T+V ++   C +C
Sbjct: 452 GVYAALIANGLEEIPEPGLAELPPLPKGTYTVDIGGSPTRGPKDAPITLVTFSDFQCPYC 511

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
           A       +  E+   +   +         D+ +      A  A +              
Sbjct: 512 ARLEKTLARLGEEYGDRLRVVW-------KDAPNLDFHKEAMLAHEAGRAAGEQGRFWEM 564

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
           + Q         R  L   A+  G     F   L+     + I+              TP
Sbjct: 565 HHQIFRRPYLLGRPTLEKYARELGLDMERFRAALDSGKHQEAIREEFAYGVSLAGQSGTP 624

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             F+ G L  G    GV  +II+  +  +
Sbjct: 625 TLFLNGRLIPGAYPYGVLRQIIEEELARA 653



 Score = 75.0 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/195 (15%), Positives = 55/195 (28%), Gaps = 8/195 (4%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
                  +    +             G   A VT+  +      +CA    +  +     
Sbjct: 30  KERTQRPLPSATVERTWVPLSATPLRGPATAKVTLALFCDFQSPYCARASEQLAEVQRAY 89

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
                 +R   R  PL       +     A     G +W +  LLF++Q     +   R 
Sbjct: 90  KDT---VRLQYRHNPLPLYPLSQLAAEASAAAGEQGQFWRYHDLLFSRQA----TAPERA 142

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
            L   A+  G     F   L+ +     + A    A +   +   PV F+ G    G   
Sbjct: 143 TLEGYAQELGLDLVRFRDALDSERARMTVDADSILAGK-LGVRGAPVVFVNGRPLRGLTE 201

Query: 215 EGVFSKIIDSMIQDS 229
                 +I+     +
Sbjct: 202 LAKLEALIEEERAGA 216



 Score = 74.3 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 62/207 (29%), Gaps = 10/207 (4%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
           +     +    +P         +   P      S G KDA VT+V ++   C +     +
Sbjct: 245 SPPEPVIAPPAVPRSRRLDPKTVYKLPVGEDAPSKGPKDAKVTIVLWSDFECGY--RCSD 302

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
                          +R + +  P+   +   +          +  +W     LF +   
Sbjct: 303 IEPTLQALLAAHPQDVRLVWKFRPVPDHADSLLASEATLAAAQENKFWQLHDRLFAE--- 359

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
                  R  L   A   G     F   L+++   + + A     S+  +I + P  FI 
Sbjct: 360 ---PGLDRAKLEQHAGQLGLDMARFRQALDERTYTEQVLADLDL-SDKLSIANLPQLFIN 415

Query: 206 GNLYL-GDMSEGVFSKIIDSMIQDSTR 231
           G      ++S       +   +  + +
Sbjct: 416 GKPQPRDEVSAEALEARVKEELDRAKQ 442


>gi|217977767|ref|YP_002361914.1| DSBA oxidoreductase [Methylocella silvestris BL2]
 gi|217503143|gb|ACK50552.1| DSBA oxidoreductase [Methylocella silvestris BL2]
          Length = 229

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 68/188 (36%), Positives = 103/188 (54%), Gaps = 3/188 (1%)

Query: 40  GVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG 99
                      +P  + D+ +G  DAP+T+VEYASMTC HCA FH  TF  L+ KYI TG
Sbjct: 44  QGATVPPDQLMAPGALPDLPLGSADAPITIVEYASMTCSHCAAFHTTTFPVLKSKYIDTG 103

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           K+R+ILREFPLD    +A      A    D      V LLF +Q +W  ++   +AL ++
Sbjct: 104 KVRFILREFPLD---PLATAGFMLARCAGDDKRNAIVDLLFAQQKNWAFTEKPVEALSSL 160

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
            K AG  +  F+ CL +Q + +++   +  AS  F + +TP FFI G    G++S     
Sbjct: 161 LKQAGIGQEGFEACLKNQELYNNVNKVRDNASAKFNVTATPTFFINGKKESGEISPETLD 220

Query: 220 KIIDSMIQ 227
           K+++ +++
Sbjct: 221 KLLEPLLK 228


>gi|291295950|ref|YP_003507348.1| DSBA oxidoreductase [Meiothermus ruber DSM 1279]
 gi|290470909|gb|ADD28328.1| DSBA oxidoreductase [Meiothermus ruber DSM 1279]
          Length = 227

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/227 (22%), Positives = 86/227 (37%), Gaps = 18/227 (7%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  T   V+  + +   A  F   R     +      G                   IG 
Sbjct: 1   MQRTLFAVVVVLAIAIAAVLFVVLRPKPTASTTDAAAGARF---------------VIGN 45

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            +A VT+V++++  C HC +  N+ F  ++  YI TGK+RY+ R+FP      V      
Sbjct: 46  PEAKVTVVDFSNYLCSHCRDHANEVFPLIKRDYIDTGKIRYVFRDFPFGGQENVIRAGEA 105

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWI--NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
            A       Y  +   LF  Q  W   + +   +   ++A   G +   F  CL   +  
Sbjct: 106 AACAADHNLYVEYHEALFRAQMQWAGLSGEALDNYFTDLAGQIGIAPATFSQCLKSGSKR 165

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             + A +K A++   +  TP F + G  Y G      + +I+D  + 
Sbjct: 166 AGVLADQKLATD-LGLTGTPSFIVNGETYTGQRPYDSWQEILDKALA 211


>gi|161529166|ref|YP_001582992.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160340467|gb|ABX13554.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 263

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 86/242 (35%), Gaps = 22/242 (9%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELP-------------IPDGVVDFRALLAASPST 54
           + V+   +  F A  +        + +                               S 
Sbjct: 23  VLVITIAISAFFAGNYVSNMNSDKVTQSDLNNAFAKLEEKIGTSTQPSIQPNTQPIKVSI 82

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSV 113
             D   G  +AP+T++E++   C  C +F+  T   +E+ YI TGK+ ++ R+FP     
Sbjct: 83  DDDPMKGDPNAPITIIEFSDYECPFCGKFYTDTLPLIEENYINTGKVNFVYRDFPIQSIH 142

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY--RDALLNMAKFAGFSKNDFD 171
                             +W +  ++F  +  W   +       L+  A   G    +F 
Sbjct: 143 PNAVHTAMAAECADDQEMFWPYHDMIFENKSTWEKQRGQSLVSELVQYADVLGLDTEEFT 202

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-----NLYLGDMSEGVFSKIIDSMI 226
           TCL     LD+++   +   + + I  TP FFIG          G      F++I++ M+
Sbjct: 203 TCLESNKHLDEVRNDLQDG-QSYGISGTPGFFIGNDNSGYIKVSGAKPYQTFAEILEGML 261

Query: 227 QD 228
           + 
Sbjct: 262 RR 263


>gi|153003349|ref|YP_001377674.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
 gi|152026922|gb|ABS24690.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
          Length = 354

 Score =  113 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 65/188 (34%), Gaps = 9/188 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
                          S G + APVT+VE++   C +C    +   +          K+R 
Sbjct: 176 PAYEPPKVEVAATGPSKGPQGAPVTIVEFSDFECPYCVRAEDTVKQV---LAAYPDKIRL 232

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           + R+FPL   +               G YW     LF   +           L   A   
Sbjct: 233 VYRDFPLPMHARAPKAAEAAHCAGDQGKYWEMHQRLFASSNAIDVPD-----LKKYAGEL 287

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
              +  FD CL+       ++  +K A E+  +  TP FFI G +  G      F K+ID
Sbjct: 288 KLDQAKFDKCLDSGEKTQVVEEHRK-AGEEAGVSGTPAFFINGRMLSGAQPLDAFKKVID 346

Query: 224 SMIQDSTR 231
             +  + +
Sbjct: 347 QELASAGK 354


>gi|163852592|ref|YP_001640635.1| DsbA oxidoreductase [Methylobacterium extorquens PA1]
 gi|218531433|ref|YP_002422249.1| DsbA oxidoreductase [Methylobacterium chloromethanicum CM4]
 gi|240139927|ref|YP_002964404.1| putative protein disulfide isomerase, putative protein precursor
           (tat pathway signal) [Methylobacterium extorquens AM1]
 gi|163664197|gb|ABY31564.1| DsbA oxidoreductase [Methylobacterium extorquens PA1]
 gi|218523736|gb|ACK84321.1| DsbA oxidoreductase [Methylobacterium chloromethanicum CM4]
 gi|240009901|gb|ACS41127.1| putative protein disulfide isomerase, putative protein precursor
           (tat pathway signal) [Methylobacterium extorquens AM1]
          Length = 217

 Score =  113 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 77/222 (34%), Positives = 104/222 (46%), Gaps = 8/222 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR   L    L    +         AL +                 P  + DV +G  D
Sbjct: 2   ITRRDALKLTGLALGTAALLPRLTFEALAQ--------SADTAALMQPGPLGDVWLGPAD 53

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT++EYASMTC HCA FH  T+  L+++YI TGK+R+ LREFPLD ++T A MLARC 
Sbjct: 54  AKVTIIEYASMTCSHCAHFHATTWPVLKERYIDTGKVRFTLREFPLDPLATAAFMLARCD 113

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            +         +             ++  DAL  + + AGFSK  F+ CL DQ     I 
Sbjct: 114 GEAKYYPITDLLFDQQQNWAFVRKPQSPVDALEQLLRQAGFSKEKFEACLKDQKTYAAIN 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A K R  +   ++STP FFI G    G +S     KII  ++
Sbjct: 174 AVKTRGLDTLKVESTPTFFINGEKRAGALSIEEMEKIIKPIL 215


>gi|254562351|ref|YP_003069446.1| hypothetical protein METDI3965 [Methylobacterium extorquens DM4]
 gi|254269629|emb|CAX25600.1| putative protein disulfide isomerase, putative protein precursor
           (tat pathway signal) [Methylobacterium extorquens DM4]
          Length = 217

 Score =  113 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 77/222 (34%), Positives = 104/222 (46%), Gaps = 8/222 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR   L    L    +         AL +                 P  + DV +G  D
Sbjct: 2   ITRRDALKLTGLALGTAALLPRLTFEALAQ--------SADTAALMQPGPLGDVWLGPAD 53

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT++EYASMTC HCA FH  T+  L+++YI TGK+R+ LREFPLD ++T A MLARC 
Sbjct: 54  AKVTIIEYASMTCSHCAHFHATTWPVLKERYIDTGKVRFTLREFPLDPLATAAFMLARCD 113

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            +         +             ++  DAL  + + AGFSK  F+ CL DQ     I 
Sbjct: 114 GESKYYPITDLLFDQQQNWAFVRKPQSPVDALEQLLRQAGFSKEKFEACLKDQKTYAAIN 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A K R  +   ++STP FFI G    G +S     KII  ++
Sbjct: 174 AVKTRGLDTLKVESTPTFFINGEKRAGALSIEEMEKIIKPIL 215


>gi|298294359|ref|YP_003696298.1| DSBA oxidoreductase [Starkeya novella DSM 506]
 gi|296930870|gb|ADH91679.1| DSBA oxidoreductase [Starkeya novella DSM 506]
          Length = 221

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 74/188 (39%), Positives = 98/188 (52%), Gaps = 4/188 (2%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
                       +   + D  +G+ DAPVT+VEYAS+TC HCA FH  T+  L+ KYI T
Sbjct: 35  AEAQSADEAKLMALGALPDQVLGKADAPVTIVEYASLTCSHCAHFHETTYPVLKSKYIDT 94

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
           GK+R+ILREFPLD    VA      A    DG Y+     LF  Q +W  S+N   AL+ 
Sbjct: 95  GKVRFILREFPLDI---VAKAAFMLARCAGDGKYYPMTDTLFETQKNWAYSQNPAQALMA 151

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
           +AK  G S+  F+ CLND  +   I    KR SE   +D+TP FFI G    G +S    
Sbjct: 152 IAKQGGMSEQQFNACLNDAKLAGQIDEVAKRGSE-LGVDATPTFFINGKKVSGALSPEDL 210

Query: 219 SKIIDSMI 226
            K +  ++
Sbjct: 211 DKELAPLL 218


>gi|114765135|ref|ZP_01444280.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Pelagibaca bermudensis HTCC2601]
 gi|114542539|gb|EAU45565.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Roseovarius sp. HTCC2601]
          Length = 214

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 57/226 (25%), Positives = 94/226 (41%), Gaps = 12/226 (5%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             RI     +     A   +     +                   A  +T+ D+++GQ D
Sbjct: 1   MKRILTTVALAATIAAGGSWVLNPTAQP-----------PIGAAGAQEATVTDMTLGQAD 49

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APV ++EY S TC HCA F  + F  L++ YI TGK+++  RE   +     A ++ARC 
Sbjct: 50  APVEIIEYGSFTCPHCATFEQEVFPQLKEDYIDTGKVKFTFREAYFNKYDMWASLMARCG 109

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            +    G    +    N+           DA+  M   AG  +   D C+ D   L  + 
Sbjct: 110 GEMKYFGIVDMIYETQNEWARQSTEAGVADAIRKMGLQAGIGQEQLDACMQDGETLKALV 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
              ++  E+   +STP F I G L+  +M    F +I+D  ++ + 
Sbjct: 170 GWYQQNVEEDGFNSTPSFMIDGELHT-NMPYDEFVEILDERVEAAQ 214


>gi|296447825|ref|ZP_06889738.1| DSBA oxidoreductase [Methylosinus trichosporium OB3b]
 gi|296254684|gb|EFH01798.1| DSBA oxidoreductase [Methylosinus trichosporium OB3b]
          Length = 218

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 79/218 (36%), Positives = 113/218 (51%), Gaps = 10/218 (4%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           RI    G+ +   A   F     +         G          +P+ + DV  G+ DAP
Sbjct: 7   RISRRAGLTVAACALIGFALPAAAEKA------GSGKVSVDELMAPNALPDVVEGKADAP 60

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+VEYASMTC HCA FH + +  L+  YI +GK+++ILREFPLD ++T A MLAR    
Sbjct: 61  VTIVEYASMTCSHCAAFHREVYPALKKNYIDSGKVKFILREFPLDPLATAAFMLAR---- 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
                    V LLF +Q +W   +   D L  + KF G  +  F+  L D+ + +++   
Sbjct: 117 NAGEKRDAVVDLLFAQQKNWAFVEKPLDGLAGVLKFTGVGQQAFEATLKDEALYENVNKV 176

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           + RA+E F I+STP FFI G  + G++S   F KII  
Sbjct: 177 RDRAAEKFGINSTPTFFINGERFSGEISIADFDKIIAE 214


>gi|163842778|ref|YP_001627182.1| DSBA oxidoreductase [Brucella suis ATCC 23445]
 gi|163673501|gb|ABY37612.1| DSBA oxidoreductase [Brucella suis ATCC 23445]
          Length = 217

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 3/196 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 25  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCLHCADFKLITFPK 84

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 85  IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAE 141

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 142 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 201

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 202 GDLSFEEMSGFIDSAL 217


>gi|11498950|ref|NP_070183.1| hypothetical protein AF1354 [Archaeoglobus fulgidus DSM 4304]
 gi|2649220|gb|AAB89891.1| membrane protein, putative [Archaeoglobus fulgidus DSM 4304]
          Length = 305

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/195 (21%), Positives = 77/195 (39%), Gaps = 15/195 (7%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
               +  + S   D   G +DA V +VE+++  C HCA+F  +T   + +KY    K+ +
Sbjct: 118 SEEEVRINVSIDDDPFKGAEDAKVVIVEFSNYACGHCADFAIETEPKILEKYGDKVKIVF 177

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
                  +     A            G YW F  LLF  Q +     +    + + A+  
Sbjct: 178 RDFPGFGEISYFAAEAANCA---GEQGKYWEFHDLLFENQRE---WISNNSKIYDYAEQL 231

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI--------GGNLYLGDMSE 215
           G + ++F  C+      +++    K     + +  TP FFI         G    G ++ 
Sbjct: 232 GLNVDEFKACIESGKYREEVDKDYKDGIS-YGVTGTPTFFIGTPNGTFVNGKKVAGALNF 290

Query: 216 GVFSKIIDSMIQDST 230
             F+ +I+  +Q ++
Sbjct: 291 EQFAALIEQELQQAS 305


>gi|116624599|ref|YP_826755.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116227761|gb|ABJ86470.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 340

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 38/185 (20%), Positives = 62/185 (33%), Gaps = 8/185 (4%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
               +  +  S     S G   APVT+VE++   C  C +  +           K   + 
Sbjct: 159 APPPVFRSEVSVEGAPSRGGVAAPVTIVEFSDFHCPFCRKAQSVLDNLRAKYGEKIRFVY 218

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
                          V           G +W F   LF+      +    + AL  +AK 
Sbjct: 219 RDFPLE--GLHPQARVAAEASRCAAEQGKFWEFHDRLFH-----GDPDASQAALSRIAKE 271

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           +G     F+ C       + ++A  +  +    I  TP FF+ G + +G  S   F  II
Sbjct: 272 SGMDLTAFEACRTSGKYKNSVQASAQEGA-RLGITGTPTFFVNGRMLVGSQSLDEFVSII 330

Query: 223 DSMIQ 227
           D  + 
Sbjct: 331 DEELA 335


>gi|114707685|ref|ZP_01440580.1| hypothetical protein FP2506_02415 [Fulvimarina pelagi HTCC2506]
 gi|114536929|gb|EAU40058.1| hypothetical protein FP2506_02415 [Fulvimarina pelagi HTCC2506]
          Length = 270

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 64/195 (32%), Positives = 103/195 (52%), Gaps = 4/195 (2%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
              E+P   G VD   L++     + D+  G  +APVT+VEYASMTC HCA+FH  ++  
Sbjct: 76  PAAEVPESSGSVDVADLMSEQ--ALPDIVQGDPEAPVTIVEYASMTCGHCADFHENSYPA 133

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++ Y+ TGK + I+REFP D VS              D      V +LF++Q  W  ++
Sbjct: 134 IKEAYLDTGKAKLIIREFPFDPVSLA--AFMMARCAGDDQRRTAMVDVLFDQQSTWATAE 191

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           +    LL +A+  G  +++F  CL+++ +   I   +K+   +F + +TP FFI G  Y 
Sbjct: 192 SPSQELLKIARMTGMGQDEFVACLDNKELQQQIVDVQKKGETEFGVSATPTFFINGAKYS 251

Query: 211 GDMSEGVFSKIIDSM 225
           G MS    +  I++ 
Sbjct: 252 GSMSPENMAAAIEAA 266


>gi|240850103|ref|YP_002971496.1| DSBA oxidoreductase [Bartonella grahamii as4aup]
 gi|240267226|gb|ACS50814.1| DSBA oxidoreductase [Bartonella grahamii as4aup]
          Length = 218

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 112/226 (49%), Gaps = 8/226 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M   R  +  GI+ LFI           AL   P P   VD   +L      +KD   G+
Sbjct: 1   MVKYRSFLSFGIIFLFIT--IAQNSVTVALARDPKPVATVDMEEIL--QSGKVKDRFEGE 56

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPV +VEYAS+TC HCA F+N     +  KYIKTGK++ I R++  D     A     
Sbjct: 57  ADAPVVIVEYASLTCTHCAHFYNDILPQIRKKYIKTGKVKLIFRDYAFD---PRATAGFM 113

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A+   +  Y+  + +LF KQ++W   K+    L  +   AGF+   F  CL +Q ILD+
Sbjct: 114 LAQCAPEDRYFPLIEVLFQKQNEWAFGKDALTPLKKIGLMAGFTDESFTACLKNQAILDE 173

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + A  +R  +   + +TP FFI G+ Y G M    F  +IDS ++ 
Sbjct: 174 VNASFERG-KKLGVTATPTFFINGSKYEGAMKVEDFFSVIDSFLKK 218


>gi|148657335|ref|YP_001277540.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
 gi|148569445|gb|ABQ91590.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
          Length = 269

 Score =  112 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 80/220 (36%), Gaps = 13/220 (5%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPST--------MKDVSIGQKDAPVTMVEYAS 74
               R   +  E P P GV    A  +                 + G  DAP+T+VE++ 
Sbjct: 50  AIVVRPSPSDAERPRPSGVTPIPAPTSIPDDPPVSEPAPFDDPRAQGAPDAPITVVEFSD 109

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKRMDGGYW 133
             C  CA F  +    +E++Y++TGK+R + R+FP +       +           G +W
Sbjct: 110 FQCPFCASFAREVRPLIEERYVRTGKVRLVYRDFPLMSIHPGALLAAHVANCAGEQGAFW 169

Query: 134 GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK---NDFDTCLNDQNILDDIKAGKKRA 190
              + +F        S    +      ++A   +        C+        I+     A
Sbjct: 170 QMHTRIFEGMTQREWSSGDANDFRTFLRYAEELELDAGAVQQCVESNRYGAQIQEDI-LA 228

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            +   + STP F I G L +G     V+ +I + ++    
Sbjct: 229 GQQAGVRSTPSFLINGQLLVGAQPFEVWEQIFERILSTQK 268


>gi|332969282|gb|EGK08309.1| disulfide bond formation protein D [Desmospora sp. 8437]
          Length = 256

 Score =  112 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 77/224 (34%), Gaps = 4/224 (1%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           +    V++       +    + +              +     +  +   +G  DAPV +
Sbjct: 34  LTLATVIILFLGLGVFALVNNIIGGDEEKGDAGQEATVDETVFAYDQQPVLGNGDAPVRI 93

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA-VMLARCAEKRM 128
           VE+    C  C  F ++ +  L+  Y+   K  +           ++   +      ++ 
Sbjct: 94  VEFGDYKCPTCKRFADEIYPKLKKDYLDNDKAGFYFINNQFLGEDSITAGIAGEAVHEQD 153

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD--TCLNDQNILDDIKAG 186
              +W F   ++  Q +   +   +D L+ +AK A    +       ++ ++    ++  
Sbjct: 154 PAAFWKFHEEIYKNQGNERETWATKDFLVKLAKQAAPGIDHDKLEKAIDKESFKQQVEQD 213

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           K  A +   + S P  FI G      +      K+I+  ++ + 
Sbjct: 214 KAIAIQS-GVSSVPSLFINGRPVPDSLDYEGIKKMIEEELKKAK 256


>gi|148560495|ref|YP_001258509.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella ovis ATCC 25840]
 gi|148371752|gb|ABQ61731.1| twin-arginine translocation signal domain protein [Brucella ovis
           ATCC 25840]
          Length = 244

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 4/196 (2%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 53  RGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPK 112

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 113 IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQ-QWATAE 168

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +L+D++A  +R S++F +++TP FFI G  Y 
Sbjct: 169 DGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYA 228

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 229 GDLSFEEMSGFIDSAL 244


>gi|90420094|ref|ZP_01228002.1| possible protein disulfide isomerase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335428|gb|EAS49178.1| possible protein disulfide isomerase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 257

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 114/208 (54%), Gaps = 4/208 (1%)

Query: 15  VLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYAS 74
            +L   +        +   E P   G VD   L+A  P  + DV IG  DAPVT+VEYAS
Sbjct: 50  AVLMAQADTAPATPATPAVEAPESSGSVDVADLMAEGP--LPDVVIGDADAPVTIVEYAS 107

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
           MTC HCA+FH  ++  ++  ++ TGK + I+REFP D  +    ML        D     
Sbjct: 108 MTCSHCADFHENSYPQIKTDFLDTGKAKLIIREFPFDPRALAGFML--ARCTGDDAKRTA 165

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
            + +LF++QDDW  + N   ALL +AK AG S+++F +CLND+ + + I   +++   +F
Sbjct: 166 MIDVLFSQQDDWARADNASAALLKIAKLAGMSQDEFTSCLNDKEMQEKIVEIQQKGQNEF 225

Query: 195 AIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            +++TP FFI G+ + G +S    +  I
Sbjct: 226 GVNATPTFFINGDKFSGALSAEQMAAAI 253


>gi|328950917|ref|YP_004368252.1| DSBA oxidoreductase [Marinithermus hydrothermalis DSM 14884]
 gi|328451241|gb|AEB12142.1| DSBA oxidoreductase [Marinithermus hydrothermalis DSM 14884]
          Length = 214

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 89/228 (39%), Gaps = 21/228 (9%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R    G +++  + +   +                    AL A  P+     ++G+ DAP
Sbjct: 3   RQAFFGVLIIATLFTAGLFVFTR---------------PALPAEDPAAGAHFAVGRPDAP 47

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           +T+VE+A+  C HC     +    +   Y++TGK+RY+ R+FP     T   ++      
Sbjct: 48  ITVVEFANYQCPHCRTHALEVLPRILRDYVETGKVRYVFRDFPFKGAPTYRPVVRAGEAA 107

Query: 127 RMDGGYWGFVSLLF-----NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                   ++           Q      +      ++ A   G  +  F  CL       
Sbjct: 108 ACAADQGRYLEYHTLLFRAQGQWGRYRGEALDRLFIDYAGQIGLDREAFAACLASGEKER 167

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            +    K A+E   ++STP FFIG  +Y G +    + +++D+++ + 
Sbjct: 168 IVLEDLK-AAEALNLNSTPTFFIGDKMYRGVLPYEEWQRLLDALLAEK 214


>gi|116751066|ref|YP_847753.1| DSBA oxidoreductase [Syntrophobacter fumaroxidans MPOB]
 gi|116700130|gb|ABK19318.1| DSBA oxidoreductase [Syntrophobacter fumaroxidans MPOB]
          Length = 339

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 70/209 (33%), Gaps = 9/209 (4%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                G +L         +                S+G  DAPVT+VE++   C  C   
Sbjct: 139 AIRAYGKSLEPKYGAAIYLKEPQYPIVEVKLDGSPSLGPADAPVTLVEFSDYQCPACRAT 198

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                K    K     ++R + +++PL       +             +W +  +LF   
Sbjct: 199 QEGVKKV---KSHFGDRVRLVFKDYPLKRHKNAHLAAQAARCAGDQSRFWDYQDVLFA-- 253

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
                 +     L   A+  G S   FD CL+       ++   + A     +D TP F 
Sbjct: 254 ---WEQELDVTQLKRFARDLGLSTRMFDECLDSGKYKTAVERDVEEAV-RIGVDRTPSFI 309

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           + G L +G  S   F KII+  +     +
Sbjct: 310 VNGKLIVGGPSFERFEKIIEEELNKPKGK 338


>gi|209886100|ref|YP_002289957.1| protein-disulfide isomerase [Oligotropha carboxidovorans OM5]
 gi|209874296|gb|ACI94092.1| protein-disulfide isomerase [Oligotropha carboxidovorans OM5]
          Length = 217

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 77/190 (40%), Positives = 106/190 (55%), Gaps = 3/190 (1%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
              +       A PST+ D+S+G KDAPVT++EYASMTC HCA F    F  ++  YI T
Sbjct: 29  SSALAQEPAAIAKPSTLGDMSLGAKDAPVTIIEYASMTCPHCAAFTKDVFPQIKSTYIDT 88

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
           GK+R+I REFPLD V+  A  LARC  K     Y+  + +LFN+Q    N     + +  
Sbjct: 89  GKVRFIFREFPLDQVALAASALARCVAKDDSNKYFAIIDILFNQQAGLQNQAF--ETINR 146

Query: 159 MAKFAGFSKNDFDTCLNDQ-NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
           + K AG ++     C+ D   +   I A ++ A++   IDSTP FFI G L  G+ S   
Sbjct: 147 VGKQAGLTEAMIKACVQDDLTVQKGILADREYANQTLKIDSTPSFFINGTLVKGETSFDG 206

Query: 218 FSKIIDSMIQ 227
           F KIID +I+
Sbjct: 207 FKKIIDPLIK 216


>gi|319403864|emb|CBI77450.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 216

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 113/217 (52%), Gaps = 6/217 (2%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
            +   V++FI          + L     P   VD   LL +    +KD   G+ +APVT+
Sbjct: 6   FIVSFVVIFIWGITAQVCATTTLVSKAKPVATVDMVELLKS--GKVKDKVEGEDNAPVTI 63

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           +EYAS+TC  CA+F+N     L  KYIKTGK++ I R+F  D     A      A    +
Sbjct: 64  IEYASLTCAFCADFYNVILPELRKKYIKTGKVKLIFRDFAYD---PRATAGFMLARCAPE 120

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
             Y+  + +LF KQ +W+ + +  + L  +A  AGF+   F+ CL +Q+IL+++ A  +R
Sbjct: 121 ERYFPLIEVLFQKQSEWVIAPDALEPLKKIAFMAGFNDESFNACLKNQSILNEVNASFER 180

Query: 190 ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             ++  + +TP FFI G  Y G MS   F  +IDS +
Sbjct: 181 G-KELGVTATPTFFINGKKYEGAMSTEDFFSVIDSFL 216


>gi|259417523|ref|ZP_05741442.1| thiol:disulfide interchange protein, DsbA family [Silicibacter sp.
           TrichCH4B]
 gi|259346429|gb|EEW58243.1| thiol:disulfide interchange protein, DsbA family [Silicibacter sp.
           TrichCH4B]
          Length = 230

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 83/179 (46%), Gaps = 1/179 (0%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
              ST+ ++  G +DAPVT++EYAS TC HCA FH   +K L+ +YI TGK+++I RE  
Sbjct: 53  VDTSTIIEMVQGAEDAPVTLIEYASYTCPHCANFHEGAYKKLKAEYIDTGKVKFIYREVY 112

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
            D     A M+ARC  +    G    +    ++           DAL  + + AG     
Sbjct: 113 FDRFGLWASMVARCGGEEKFFGITDRIFKQQSEWTRAGGPAEMVDALKKIGRVAGIDNEQ 172

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            + C+ D      +    +  +    ++STP F + G     +        +ID+ +++
Sbjct: 173 LEACMQDATKAQTLVTWYQENATKDEVESTPSFILNGTKVS-NQPYEDLKALIDAELEE 230


>gi|309790379|ref|ZP_07684944.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
 gi|308227571|gb|EFO81234.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
          Length = 243

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 94/239 (39%), Gaps = 21/239 (8%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAAS------------------ 51
           VL  +  L +            ++ +               +                  
Sbjct: 6   VLIILAALALVGCGTPAPPAPTVSAVEQRQTSAALSERPTLAPVPTTPPPTPRPFPQVLA 65

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
            S     ++G  +APVT+ E+    C  C +F+ +T   L  +Y++TGK+R + R+FPL+
Sbjct: 66  TSADDPRAMGDPNAPVTIYEFTDYECPFCKQFYAETRAQLITEYVETGKVRLVARDFPLE 125

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVS--LLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
             ++  +             +W         ++ +     K  R+ L+++A   G     
Sbjct: 126 IHASAMLAAVAGHCAAAQQNFWPMYETLFETHQVEWGGVPKRDRETLIDLATQIGIEPVA 185

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F  CL+D      ++A  + A +   I+STP F + G L  G +  G F ++IDS++ +
Sbjct: 186 FTACLDDPATEQAVQAEMQAAMQ-LGINSTPNFMVNGTLLRGSLPIGSFRQLIDSLLAE 243


>gi|86160465|ref|YP_467250.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776976|gb|ABC83813.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 671

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/225 (14%), Positives = 61/225 (27%), Gaps = 7/225 (3%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD-VSIGQKDAP 66
           + ++ G  + F+    +      +      P          A       D    G  DA 
Sbjct: 8   VALVIGFAIGFVGRGSWDMGGRPSRAPAGAPTRARPVEDPKAVYRVPADDSPVRGPADAL 67

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+VE +   C +C        +  +    K   +               A+       +
Sbjct: 68  VTIVESSDFQCPYCKRGAATMKQVEDAYRGKVRFVFKHNPLSFHPQAMPAALAAEEARAQ 127

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
             D  +W         +         + A+   A   G         +        I+  
Sbjct: 128 GGDEKFWALHD-----KLFDSAPALDQAAIEKAAGELGLDVAKVREAMQSGTHRARIERD 182

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +K         +TP FF+ G    G      F  +ID  ++ + +
Sbjct: 183 QKLVV-GLGAPATPTFFVNGRKIAGAQPIEAFRTVIDEELRKAEQ 226



 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 63/206 (30%), Gaps = 9/206 (4%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                K +A  +  +    +     +        D + G   APVT+V ++   C  CA 
Sbjct: 474 ANLALKPAAPQQGAVIPAALPAGQPVQGLAVRADDPTRGNPKAPVTIVLFSDFQCPFCAR 533

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
                 +  +       K+R + +  PL                R  G +W     LF  
Sbjct: 534 VEPTLAQVQKTY---GDKVRVVWKHQPLGMHPNAMPAAEAAEAAREQGKFWQMHEKLFAS 590

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           Q +  ++   R      A+  G     FD           I   +  A+      +TP  
Sbjct: 591 QRELSDALYERA-----AREIGLDVARFDAARRSGRGRARIAEDQALAA-RIGAQATPTM 644

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F+ G    G +       ++D+ +  
Sbjct: 645 FVNGVKVEGAVPFEQIRAVVDAELAR 670



 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/218 (15%), Positives = 62/218 (28%), Gaps = 9/218 (4%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
               +    +         +              A  A  P    D + G  DA +T+V 
Sbjct: 246 ATAPVFLPGTVPPPAAAAPSAAAPAPAAPAAPPPATYAKVPLRADDPARGPADAKLTVVL 305

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           ++   C  C+       +    +    G++R + +  PL                R  G 
Sbjct: 306 FSDFQCPFCSRVEPTLKQL---EEAYPGQVRIVWKHQPLSFHPNALPAAIAAEAARDQGK 362

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           +W     LF  Q                AK  G     F   +  +   D I A ++ A 
Sbjct: 363 FWPMHEKLFANQQALSP-----ATYEQYAKELGLDLRKFQAAVAARKGADRIAADQQLA- 416

Query: 192 EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                + TP  F      +G +       I++  ++ +
Sbjct: 417 NGVGANGTPTMFFNCRQVVGALPLERMRPIVEEELKKA 454


>gi|319406876|emb|CBI80511.1| conserved exported hypothetical protein [Bartonella sp. 1-1C]
          Length = 216

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 113/217 (52%), Gaps = 6/217 (2%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
            +   V++FI       R  + L     P   VD   LL +    +KD   G+ +APVT+
Sbjct: 6   FIVSFVVIFIWGITAQVRATTTLVSKAEPVETVDMVELLKS--GKVKDKVEGEDNAPVTI 63

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           +EYAS+TC  CA+F+N     L  KYIKTGK++ I R+F  D     A      A    +
Sbjct: 64  IEYASLTCAFCADFYNAILPELRKKYIKTGKVKLIFRDFAYD---PRATAGFMLARCAPE 120

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
             Y+  + +LF KQ +W    +  + L  +A  AGF+  DF+ CL +Q+IL+++ A  +R
Sbjct: 121 DRYFPLIEVLFQKQSEWAIVPDALEPLKKIAFMAGFNDEDFNACLKNQSILNEVNASFER 180

Query: 190 ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             ++  + +TP FFI G  Y G MS+  F   IDS +
Sbjct: 181 G-KELGVTATPTFFINGKKYEGAMSKENFFSAIDSFL 216


>gi|149377658|ref|ZP_01895395.1| DSBA oxidoreductase [Marinobacter algicola DG893]
 gi|149358070|gb|EDM46555.1| DSBA oxidoreductase [Marinobacter algicola DG893]
          Length = 243

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 85/221 (38%), Gaps = 5/221 (2%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  IVL+F+A   F+     A     +P    +     A        VS+G +DAPV + 
Sbjct: 28  ISVIVLVFVAVGVFFLTASPAPTSDELPVAGPNADPFPAQ--LDRFGVSVGDEDAPVVVR 85

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           E+A   C  CA F + + +  ++      K+R++  + PL                    
Sbjct: 86  EFADYQCPACARFSDASQQLKQEYVETG-KVRFVYFDLPLQQHDNAMPAAQAARCAGDQD 144

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
           GYW     LF+ Q +W  S +  D     A   G  +  F  C+     +++I+  ++ A
Sbjct: 145 GYWAMHDKLFDMQTEWSGSSSPVDTFSRYADDLGLDERRFSRCMTTDLHVEEIEQSRRVA 204

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            +   + STP   +           G  S +++  +  S +
Sbjct: 205 MQ-LRVTSTPTVLVDNIRLTRP-GWGQLSAVVERELAGSQQ 243


>gi|99082483|ref|YP_614637.1| DsbA family thiol:disulfide interchange protein [Ruegeria sp.
           TM1040]
 gi|99038763|gb|ABF65375.1| thiol:disulfide interchange protein DsbA family [Ruegeria sp.
           TM1040]
          Length = 233

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/194 (25%), Positives = 80/194 (41%), Gaps = 1/194 (0%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
                              ST+ ++  G +DAPVT++EY+S TC HCA FH   +K L+ 
Sbjct: 40  SAANAQESSQGAEAAEVDTSTIMEMVQGAEDAPVTLIEYSSYTCPHCANFHADAYKKLKA 99

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           +YI TGK++ + RE   D     A M+ARC  +    G    +     +           
Sbjct: 100 EYIDTGKVKLVYREVYFDRFGLWASMVARCGGEEKFFGITDLIFKQQAEWTRAGGPAEMV 159

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
           +AL  + + AG   +  + CL D      +    +  +    I STP F + G     + 
Sbjct: 160 EALKKIGRVAGVDGDALEACLQDATKAQTLVTWYQENATKDDISSTPSFILNGTKIA-NQ 218

Query: 214 SEGVFSKIIDSMIQ 227
                  +ID+ ++
Sbjct: 219 PYEDLKALIDAELE 232


>gi|260574056|ref|ZP_05842061.1| thiol-disulfide oxidoreductase D, putative [Rhodobacter sp. SW2]
 gi|259023522|gb|EEW26813.1| thiol-disulfide oxidoreductase D, putative [Rhodobacter sp. SW2]
          Length = 220

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 86/197 (43%), Gaps = 1/197 (0%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
              L       D     A     + +++IG  DA VT+ EYAS TC HCA FH   FK L
Sbjct: 25  PQALTSAARAQDTATTPAPVVPAVPELAIGNPDAKVTVTEYASYTCPHCAHFHEDVFKPL 84

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
           +  YI TGK+R+I RE   D     A M+ARC  +    G  G +     +   + ++  
Sbjct: 85  KADYIDTGKVRFIFREVYFDKYGLWASMIARCGGEMRYFGISGMMFETQKEWAAFSDATA 144

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
             D L  + + AG      + CLND ++   +    +   E   I+ TP   I G  Y  
Sbjct: 145 VVDQLKTIGRAAGMDDATMEACLNDNDMAMAMVTAFQANMEADGIEGTPSLIINGTKYQ- 203

Query: 212 DMSEGVFSKIIDSMIQD 228
           +MS      I+D+ +  
Sbjct: 204 NMSYAELKPILDAELAK 220


>gi|220919271|ref|YP_002494575.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957125|gb|ACL67509.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 671

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 61/225 (27%), Gaps = 7/225 (3%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD-VSIGQKDAP 66
           + ++ G  + F+    +      +   +  P          A       D    G  DA 
Sbjct: 8   VALVIGFAIGFVGRGSWDAGGRPSRAPVGAPTRARPVEDPKAVYRVPADDSPVRGPADAL 67

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+VE +   C +C        +  E    K   +               A+       +
Sbjct: 68  VTIVESSDFQCPYCKRGAATMKQVEEAYRGKVRFVFKHNPLSFHPQAMPAALAAEEARAQ 127

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
             D  +W         +         + A+   A   G         +        I+  
Sbjct: 128 GGDEKFWALHD-----KLFDSAPALDQAAIEKAAGELGLDVAKVREAMQAGTHRARIERD 182

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +K         +TP FF+ G    G      F  +ID  +  + +
Sbjct: 183 QKLVV-GLGAPATPTFFVNGRKIAGAQPIEAFRAVIDEELARAEQ 226



 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 62/206 (30%), Gaps = 9/206 (4%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                K +A  +  +    +     +        D   G   APVT+V ++   C  CA 
Sbjct: 474 ANLALKPAAPQQGAVVPAALPAGQPVQGLAVRADDPIRGNPKAPVTIVLFSDFQCPFCAR 533

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
                 +  +       K+R + +  PL                R  G +W     LF  
Sbjct: 534 VEPTLAQVQKTY---GDKVRVVWKHQPLGMHPNALPAAEAAEAAREQGKFWQMHEKLFAS 590

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           Q +  ++   R      A+  G     FD           I   +  A+      +TP  
Sbjct: 591 QRELSDALYERA-----AREIGLDVARFDAARRSGRARTRIAEDQALAA-RIGAQATPTM 644

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F+ G    G +       ++D+ +  
Sbjct: 645 FVNGVKVEGAVPFEQIRAVVDAELAR 670



 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/218 (15%), Positives = 63/218 (28%), Gaps = 9/218 (4%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
               +    +    T    +              A  A  P    D + G  DA +T+V 
Sbjct: 246 ATAPVFLPGTVPPPTAAAPSPAAPAPAAPAAPPPATYAKVPLRADDPARGPADAKLTVVL 305

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           ++   C  C+       +  +    +   +R + +  PL                R  G 
Sbjct: 306 FSDFQCPFCSRVEPTLKQLEQAYPGQ---VRIVWKHQPLSFHPNAMPAAIAAEAAREQGK 362

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           +W     LF+ Q                AK  G     F   +  +   D I A ++ A 
Sbjct: 363 FWPMHEKLFSNQQALSP-----ATYEQYAKELGLDLRKFQAAVAARKGADRIAADQQLAG 417

Query: 192 EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                + TP  F      +G +       +++  ++ +
Sbjct: 418 S-VGANGTPTMFFNCRQVVGALPLERMRPVVEEELKKA 454


>gi|312115735|ref|YP_004013331.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220864|gb|ADP72232.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
          Length = 215

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 59/185 (31%), Positives = 97/185 (52%), Gaps = 4/185 (2%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
               A  AA+   + D+++G+ DAPVT++EY+S++C HCA FH+     L+ ++I TGK+
Sbjct: 32  SPAVAQDAAAQPALPDMALGKADAPVTIIEYSSLSCPHCAHFHSDVLPELKKQFIDTGKV 91

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
           RY+ REFPL+         +  A       ++ F  LLF K DDW   ++    L   AK
Sbjct: 92  RYVQREFPLND---AGFAGSVLARCLDSSRFFAFNDLLFKKMDDWAFKQDALTPLKLYAK 148

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
            AG +  +F+ CL D+++   I A +    +   +  TP FFI G  + G  +   F++ 
Sbjct: 149 QAGLNDAEFNKCLADEDLQKKILAVRGLGEKQ-GVRGTPTFFINGKKFDGAPTIEAFAEA 207

Query: 222 IDSMI 226
           +   +
Sbjct: 208 MKPYL 212


>gi|265983650|ref|ZP_06096385.1| DSBA oxidoreductase [Brucella sp. 83/13]
 gi|264662242|gb|EEZ32503.1| DSBA oxidoreductase [Brucella sp. 83/13]
          Length = 244

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 76/196 (38%), Positives = 110/196 (56%), Gaps = 4/196 (2%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 53  RSANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLVTFPK 112

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 113 IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQ-QWATAE 168

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +LDD++A  +R S++F ++ TP FFI G  Y 
Sbjct: 169 DGKAALLQIAKLAGFTQESFEACLTNQQLLDDVRATVERGSKEFGVNETPTFFINGKKYA 228

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 229 GDLSFEEMSGFIDSAL 244


>gi|197124546|ref|YP_002136497.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
 gi|196174395|gb|ACG75368.1| DSBA oxidoreductase [Anaeromyxobacter sp. K]
          Length = 671

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 61/225 (27%), Gaps = 7/225 (3%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD-VSIGQKDAP 66
           + ++ G  + F+    +      +   +  P          A       D    G  DA 
Sbjct: 8   VALVIGFAIGFVGRGSWDAGGRPSRAPVGAPTRARPVEDPKAVYKVPADDSPVRGPADAL 67

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+VE +   C +C        +  E    K   +               A+       +
Sbjct: 68  VTIVESSDFQCPYCKRGAATMKQVEEAYRGKVRFVFKHNPLSFHPQAMPAALAAEEARAQ 127

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
             D  +W         +         + A+   A   G         +        I+  
Sbjct: 128 GGDEKFWALHD-----KLFDSAPALDQAAIEKAAGELGLDVAKVREAMQAGTHRARIERD 182

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +K         +TP FF+ G    G      F  +ID  +  + +
Sbjct: 183 QKLVV-GLGAPATPTFFVNGRKIAGAQPIEAFRAVIDEELARAEQ 226



 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 62/206 (30%), Gaps = 9/206 (4%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                K +A  +  +    +     +        D   G   APVT+V ++   C  CA 
Sbjct: 474 ANLALKPAAPQQGAVVPAALPAGQPVQGLAVRADDPIRGNPKAPVTIVLFSDFQCPFCAR 533

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
                 +  +       K+R + +  PL                R  G +W     LF  
Sbjct: 534 VEPTLAQVQKTY---GDKVRVVWKHQPLGMHPNALPAAEAAEAAREQGKFWQMHEKLFAS 590

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           Q +  ++   R      A+  G     FD           I   +  A+      +TP  
Sbjct: 591 QRELSDALYERA-----AREIGLDVARFDAARRSGRARTRIAEDQALAA-RIGAQATPTM 644

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F+ G    G +       ++D+ +  
Sbjct: 645 FVNGVKVEGAVPFEQIRAVVDAELAR 670



 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/218 (15%), Positives = 62/218 (28%), Gaps = 9/218 (4%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
               +    +    T    +              A  A  P    D + G  DA +T+V 
Sbjct: 246 ATAPVFLPGTVPPPTAAAPSPAAPAPAAPAAPPPATYAKVPLRADDPARGPADAKLTVVL 305

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           ++   C  C+       +  +    +   +R + +  PL                R  G 
Sbjct: 306 FSDFQCPFCSRVEPTLKQLEQAYPGQ---VRIVWKHQPLSFHPNAMPAAIAAEAAREQGK 362

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           +W     LF  Q                AK  G     F   +  +   D I A ++ A 
Sbjct: 363 FWPMHEKLFANQQALSP-----ATYEQYAKELGLDLRKFQAAVAARKGADRIAADQQLAG 417

Query: 192 EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                + TP  F      +G +       +++  ++ +
Sbjct: 418 S-VGANGTPTMFFNCRQVVGALPLERMRPVVEEELKKA 454


>gi|330468867|ref|YP_004406610.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
 gi|328811838|gb|AEB46010.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
          Length = 241

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 72/200 (36%), Gaps = 2/200 (1%)

Query: 27  RKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNK 86
                           +      A  +    V++G+ DAPV ++EYA   C  C +   +
Sbjct: 41  TDQPTAPAAGTAGSQQENPFAELARRAPGDPVALGEPDAPVVVIEYADFQCPFCGKHARE 100

Query: 87  TFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW 146
           T   L  +Y+  G +R   R+ P     + A   A  A     G +W F   L+ KQ   
Sbjct: 101 TAPRLIREYVDRGLVRIEWRDLPYLGDESRAAASAARAAAAQ-GRFWEFHDALYAKQRRV 159

Query: 147 INSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
            +      AL ++A   G     FD         + I   ++ A+    +  TP F +G 
Sbjct: 160 NSGALNDAALRDIASRLGLDLARFDADRASAVTREAIDRDQREAAS-MGLTGTPAFIVGD 218

Query: 207 NLYLGDMSEGVFSKIIDSMI 226
              +G      F + ID  +
Sbjct: 219 TPIIGAQPYESFKQAIDEQL 238


>gi|118575694|ref|YP_875437.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
 gi|118194215|gb|ABK77133.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
          Length = 246

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 72/180 (40%), Gaps = 7/180 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST  D   G  DAP+T++E++   C  C  F+  T   LE +YI TGK+  + R+ PLD 
Sbjct: 67  STDDDPVKGSPDAPLTVIEFSDFQCPFCNRFYQDTLPQLEREYIDTGKVNLVFRDMPLDI 126

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFD 171
                            G +W +  LLF++   W           L          + FD
Sbjct: 127 HPNALPAHMAAECADGQGAFWEYHDLLFDRAGQWGRLGPADLIEQLGAYADELGVGSGFD 186

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-----NLYLGDMSEGVFSKIIDSMI 226
            C+   + + +++    + S  + +  TP FFIG          G      F  II+S +
Sbjct: 187 ECMVMPDTVSEVRKDLAQGS-GYGVTGTPTFFIGNDDVGYTKVSGAKPYESFRSIIESKL 245


>gi|149922961|ref|ZP_01911381.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149816212|gb|EDM75719.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 704

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 60/201 (29%), Gaps = 4/201 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
             N+                +         G+ +A VT+VEY+   C +C +      + 
Sbjct: 273 RPNKKKQGKQAGKPDPAANYAVPVTDRPMKGKAEALVTIVEYSDFECPYCRKVLPTLTQI 332

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
              +      +R + R+ PL                     +W     LF K      + 
Sbjct: 333 ---EEEYGDDVRVVFRQQPLPMHKNAKPAALAALAAHKQDKFWEMHDALFEKAGSERGAL 389

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
                   +A   G     F+  + D  +   I   +K A + F    TP FF+ G    
Sbjct: 390 GKEGVYSELATQLGLDVAKFEADMKDPELAKMIAEDQKVA-QQFGAGGTPAFFVNGRFVS 448

Query: 211 GDMSEGVFSKIIDSMIQDSTR 231
           G      F  IID     + +
Sbjct: 449 GAQPFEAFKAIIDQEKAKAEK 469



 Score = 88.5 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 26/172 (15%), Positives = 53/172 (30%), Gaps = 7/172 (4%)

Query: 55  MKDVSIGQKD-APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
             D+  G +  A VT+VEY+   C +C+   +   +  E        +            
Sbjct: 74  EGDMWHGAESGALVTIVEYSDFQCPYCSRLTDALRELAEKHPEDVRIVFKHYPLAMHRDA 133

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
              +  +              F   + +         +  D +    +      + F   
Sbjct: 134 RPASEAVL-----AAHAQGKEFGWAMHDIVFKNARKLSKDDLIAYAEQAKVPDMDKFKAD 188

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           L  +     ++A   +  + F + STP FFI G    G  +     K+++  
Sbjct: 189 LEGKTFGGAVEADMTQG-KRFGVTSTPSFFINGRPQRGAKNLEALEKLVEEE 239



 Score = 85.0 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 50/193 (25%), Gaps = 8/193 (4%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQK-DAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
                                    G   D  +T+VE +   C +C              
Sbjct: 490 ETEVKAPPIADHQRRQFDLSAVPGKGNTTDPKLTIVECSDFDCPYCTRGAKLIEDI-FAA 548

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
                K+ +    FPL                   G ++    +LF  +           
Sbjct: 549 PEYKDKVAFYFLNFPLPMHKNAESAHRAAVAAGKQGKFFEMHDVLFANKGKRTEQDYRD- 607

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
                A   G   + F    N +     ++  K   +++  +  TP FFI G    G + 
Sbjct: 608 ----FAAQIGIDVDKFIADWNSEETAQKVQDDKAVCAKN-GVSGTPNFFINGRSMRGAVP 662

Query: 215 EGVFSKIIDSMIQ 227
             +   ++D  + 
Sbjct: 663 FEMAKAVLDEELA 675


>gi|299134657|ref|ZP_07027849.1| DSBA oxidoreductase [Afipia sp. 1NLS2]
 gi|298590467|gb|EFI50670.1| DSBA oxidoreductase [Afipia sp. 1NLS2]
          Length = 217

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 77/188 (40%), Positives = 108/188 (57%), Gaps = 3/188 (1%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
            V       A PST+ D+++G KDAPVT++EYASMTC HCA F  + F  L+  YI TGK
Sbjct: 31  AVAQEPAQIAKPSTLGDMALGSKDAPVTIIEYASMTCPHCAAFEKEVFPQLKSAYIDTGK 90

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
           +++I REFPLD V+  A  LARC  K     Y+  +S+LFN+Q D        + +  + 
Sbjct: 91  VKFIFREFPLDQVALAASALARCVAKDDSNKYFAIISILFNQQADLQTQAF--ETINRVG 148

Query: 161 KFAGFSKNDFDTCLNDQ-NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           K AGFS+     C+ D   +   I A ++ A++   IDSTP FFI G L  G+ S   F 
Sbjct: 149 KQAGFSEAMIKACVQDDLTVQKGILADREYANKTLKIDSTPSFFINGKLVKGETSFDSFK 208

Query: 220 KIIDSMIQ 227
            +ID +++
Sbjct: 209 GMIDPLLK 216


>gi|115374845|ref|ZP_01462119.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115379192|ref|ZP_01466311.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115363812|gb|EAU62928.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115368154|gb|EAU67115.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 248

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 73/228 (32%), Gaps = 12/228 (5%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELP---IPDGVVDFRALLAASPSTMKDVSI 60
           +       G  V+  +           + +  P    P           ++    +  S+
Sbjct: 30  TMKSFLSAGAAVVALLGLSTPAVASTPSSSNPPEECKPLRRESLEKQAISATPRTEAPSL 89

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DA VT+  ++   C  CA          E    +   +R + R+ PL S     +  
Sbjct: 90  GSADAKVTVEVWSDFECPFCARGAETVKALREKYGEQ---VRIVFRQNPLPSHKNARLAA 146

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                    G +W F   LF  QD        R +L  +A         F   L+     
Sbjct: 147 VASMAAHEQGKFWEFHDALFAHQDTLD-----RASLEKLAGQLNLDVERFQRALDSSTWN 201

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + +   +   S+   + + P FF+ G   LG     VF++ ID  +  
Sbjct: 202 NYVDMERTE-SQRRRVTAAPTFFVNGKPLLGAQPLSVFAQTIDEALAR 248


>gi|254718669|ref|ZP_05180480.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. 83/13]
 gi|306837782|ref|ZP_07470646.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. NF 2653]
 gi|306407123|gb|EFM63338.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Brucella sp. NF 2653]
          Length = 216

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 76/196 (38%), Positives = 110/196 (56%), Gaps = 4/196 (2%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                          A+  A P  +KD+  G+ DAPVT+VEYAS+TC HCA+F   TF  
Sbjct: 25  RSANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLVTFPK 84

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++KYI TGK R I R+FP D     A      A    +  Y+  + L F +Q  W  ++
Sbjct: 85  IKEKYIDTGKARLIFRDFPFD---PRATAAVMLARCAPEDHYFPMIDLFFRQQ-QWATAE 140

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           + + ALL +AK AGF++  F+ CL +Q +LDD++A  +R S++F ++ TP FFI G  Y 
Sbjct: 141 DGKAALLQIAKLAGFTQESFEACLTNQQLLDDVRATVERGSKEFGVNETPTFFINGKKYA 200

Query: 211 GDMSEGVFSKIIDSMI 226
           GD+S    S  IDS +
Sbjct: 201 GDLSFEEMSGFIDSAL 216


>gi|319898542|ref|YP_004158635.1| hypothetical protein BARCL_0368 [Bartonella clarridgeiae 73]
 gi|319402506|emb|CBI76049.1| conserved exported protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 216

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 113/217 (52%), Gaps = 6/217 (2%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
            +   V++FI S     R  + L     P   VD   LL +    +KD   G+++APVT+
Sbjct: 6   FIVSFVVIFIWSITAQARATTTLISKTEPVATVDMAELLKS--GKVKDRVEGEENAPVTI 63

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           +EYAS+TC  CA+F+N     L  KYIKTGK++ I R+F  D     A      A    +
Sbjct: 64  IEYASLTCTFCADFYNVILPELRKKYIKTGKVKLIFRDFAYD---PRATAGFMLARCAPE 120

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
             Y+  + +LF KQ +W  +K+  + L  +A  AGF+   F  CL +Q+ILD++ A  +R
Sbjct: 121 DRYFPLIEVLFQKQYEWAGAKDALEPLKKIAFMAGFTDESFSACLKNQSILDEVNASFER 180

Query: 190 ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             ++  + +TP FFI G  Y G MS       ID+ +
Sbjct: 181 G-KELGVTATPTFFINGKKYEGAMSMEALFTAIDNFL 216


>gi|49474015|ref|YP_032057.1| hypothetical protein BQ03750 [Bartonella quintana str. Toulouse]
 gi|49239518|emb|CAF25875.1| hypothetical protein BQ03750 [Bartonella quintana str. Toulouse]
          Length = 218

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 107/214 (50%), Gaps = 6/214 (2%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYA 73
             ++F           + L     P   VD   +L   P  +KD   G+ +APVT+VEYA
Sbjct: 10  FAIIFALMTIVQISATAILAAEVKPVSNVDMAEVL--QPGKVKDRVEGEANAPVTIVEYA 67

Query: 74  SMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYW 133
           S+TC  CA F+N     +  KYIKTGK++ I R+F  D     A      A    +  Y+
Sbjct: 68  SLTCAPCAHFYNDVLPQIRKKYIKTGKVKLIFRDFAFD---PRATAGFMLARCAPEDRYF 124

Query: 134 GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASED 193
             + +LF KQ +W+  ++    L  +   AGF+   F+ CL +Q+ILD++    +R  + 
Sbjct: 125 PLIEVLFQKQHEWVWEQDALTPLKKIGLMAGFTDESFNACLKNQSILDEVNMSFERG-KK 183

Query: 194 FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             + +TP FFI GN Y G MS   F  +IDS ++
Sbjct: 184 LGVTATPTFFINGNKYTGVMSVEAFFSVIDSFLK 217


>gi|183220540|ref|YP_001838536.1| hypothetical protein LEPBI_I1143 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910650|ref|YP_001962205.1| oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167775326|gb|ABZ93627.1| Oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167778962|gb|ABZ97260.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 349

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 73/188 (38%), Gaps = 10/188 (5%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           +     +  +     + SIG KDA VT++E++   C  C    +   +  E    +   +
Sbjct: 171 IKEPEAIRVTVDEKNNPSIGPKDAKVTVIEFSDFECPFCKRSQDVNNQLREKYKGQ---I 227

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
           R++ R+FPL                  +G YW   ++LF    +   SK     L     
Sbjct: 228 RWVFRDFPLPFHQDAMYAHMAANCSIEEGKYWDVFNVLFENSGNLSKSKVDEFVLKTGLS 287

Query: 162 FAGFSKNDFDTCLNDQ-NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
                K  + +C+ DQ  +  +I+A  +   +   +  TP FFI G    G +    F +
Sbjct: 288 -----KEKYQSCMKDQSKLKSEIEADIQDG-QKVGVSGTPAFFINGIFVSGALPFENFDE 341

Query: 221 IIDSMIQD 228
           II   ++ 
Sbjct: 342 IIQKELKQ 349


>gi|120401682|ref|YP_951511.1| Na+/H+ antiporter NhaA [Mycobacterium vanbaalenii PYR-1]
 gi|189029136|sp|A1T2V5|NHAA1_MYCVP RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|119954500|gb|ABM11505.1| sodium/proton antiporter, NhaA family [Mycobacterium vanbaalenii
           PYR-1]
          Length = 617

 Score =  110 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 76/219 (34%), Gaps = 13/219 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            RIGVL   VL F+  +  +      + +   P   V  + L    P   +D   G+ DA
Sbjct: 409 ARIGVLAASVLAFVFGWAIF-----RITDWLSPPEPVGLKLLRPVEPD--RDHVRGRYDA 461

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+ +VEY    C  C+       +           +          +             
Sbjct: 462 PLVLVEYGDFECPFCSRATGAIDEVRAHFGDDLLYVWRHFPLER--AHPRAFDAARASEA 519

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
             + G +W     LF+ QDD   S  YR A+        F ++     ++   +L  +  
Sbjct: 520 AALQGKFWEMAHELFDHQDDLEWSDMYRYAVAAGCDIEQFDQDVR---VHSSKVLHRVTD 576

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             + A E   +++TP  F+ G  + G        + +++
Sbjct: 577 DAEDA-EAMDLNATPTLFVNGIRHKGPWDAASLIRALEA 614


>gi|116625220|ref|YP_827376.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116228382|gb|ABJ87091.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 344

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/182 (26%), Positives = 67/182 (36%), Gaps = 10/182 (5%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
               A  S       G  DAPV +VEYA   C +C        K         GK+ +  
Sbjct: 162 PAPRAKVSLAGAPVRGAADAPVVLVEYADYECPYCQMVQPALDKV---LGDYKGKVAFAF 218

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
           ++ PL   +               G YW +  LLF+ +            L   A+    
Sbjct: 219 KDVPLPMHANAIKAAEATRCAEAQGKYWEYHDLLFSTKMVEP------ARLKEHARTLKL 272

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
               FDTCL+     D IK     A +D  ++STP FFI G    G++S     +IID  
Sbjct: 273 DTAAFDTCLDSGAKSDSIKTALNEA-QDLGLNSTPSFFINGRFTQGNLSYEQLRQIIDEE 331

Query: 226 IQ 227
           + 
Sbjct: 332 LA 333


>gi|89052888|ref|YP_508339.1| DsbA family thiol:disulfide interchange protein [Jannaschia sp.
           CCS1]
 gi|88862437|gb|ABD53314.1| thiol:disulfide interchange protein DsbA family [Jannaschia sp.
           CCS1]
          Length = 227

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 9/228 (3%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD---VSIGQK 63
           R  +L G     + +  +    G           +  F A  A   + + D   +S G  
Sbjct: 3   RRAMLLGGATGILGAGAYLLWNGRGGQRFQTEAPLTPFTAANAQEATDLPDVLEMSKGNP 62

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           D+ VT++EYAS TC HC  FH   +  L   YI+ G + ++ RE   D     A M    
Sbjct: 63  DSGVTLIEYASFTCPHCRSFHTNVYPDLNRDYIEPGLINFVYREVYFDRYGLWAGM---V 119

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYR--DALLNMAKFAGFSKNDFDTCLNDQNILD 181
           A       Y+G V L++ +Q +W         + L  + + AG S  + D C+ D  + +
Sbjct: 120 ARCGGPLRYFGIVDLIYAQQSEWTQGSPAEIAENLKRIGRAAGLSNEELDACMTDAAMAE 179

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            + A  +   E+  I  TP F + G +  G+M+       +D+ I+ +
Sbjct: 180 AMIANYEAQMEEHPIAGTPAFVLNGEM-SGNMNYNELRGRLDAAIEAA 226


>gi|288961585|ref|YP_003451895.1| DsbA oxidoreductase [Azospirillum sp. B510]
 gi|288913865|dbj|BAI75351.1| DsbA oxidoreductase [Azospirillum sp. B510]
          Length = 220

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 58/213 (27%), Positives = 93/213 (43%), Gaps = 5/213 (2%)

Query: 17  LFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMT 76
             +A         +    L          A L      M +  +G   APVT+++Y+SMT
Sbjct: 11  FGLAGLLAIGASAAFGATLTAAPPAAQAAATLPPLSELMAERVLGDPKAPVTILDYSSMT 70

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C HCA FH +    +++ YI TGK++ + R+FP D  +  A MLA CA       Y+   
Sbjct: 71  CPHCAHFHAEILPKIKEAYIDTGKVKLVFRDFPFDQAALSASMLAHCAPVE---RYFPLT 127

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
            +LF  Q  W  + +   AL    K AG S+   D C  ++ + D I   +      + +
Sbjct: 128 DVLFKSQPTWSRAADPAKALAQYGKLAGMSQETIDACFANKELADAILNSRLTGQNQYKV 187

Query: 197 DSTPVFFIGG--NLYLGDMSEGVFSKIIDSMIQ 227
           ++TP F +        G      F+K ID +++
Sbjct: 188 EATPTFILNDGKVRIEGAQPFEAFAKEIDKLLK 220


>gi|83313081|ref|YP_423345.1| protein-disulfide isomerase [Magnetospirillum magneticum AMB-1]
 gi|82947922|dbj|BAE52786.1| Protein-disulfide isomerase [Magnetospirillum magneticum AMB-1]
          Length = 201

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 93/188 (49%), Gaps = 5/188 (2%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
             A  AA  S   D  +G+ DAP+T++EYAS TC HCA FH  T    + ++++TGK + 
Sbjct: 19  QTAAAAADLSYSIDQVLGKPDAPITVIEYASTTCPHCATFHKTTLPKFKSEWVETGKAKL 78

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           I R+FP                      Y+G ++L+  +Q+ W+NS+N    L  +AK A
Sbjct: 79  IYRDFPTGPRGLSVGASMIAHC-AGPDRYFGLLALIMEQQEKWMNSQNPLVELKKLAKLA 137

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G  ++  D CL  Q++ + I    K  +E   ++STP   I G +  G +         D
Sbjct: 138 GLGEDKVDDCLKRQDLANAINERAKEGNEKLGVESTPSLIIAGKVIPGAIPYDEL----D 193

Query: 224 SMIQDSTR 231
            +++ +++
Sbjct: 194 KLLKAASK 201


>gi|154245118|ref|YP_001416076.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
 gi|154159203|gb|ABS66419.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
          Length = 270

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 76/192 (39%), Positives = 109/192 (56%), Gaps = 3/192 (1%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
           P     V+   L+A + S + + +IG   APVT+VEYAS TC HCA FH  TF  L+ KY
Sbjct: 80  PAAAQTVEQAKLMAPAASPLPEKAIGSATAPVTVVEYASATCSHCAAFHTTTFPELKTKY 139

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           I TGK+R+I REFP + V+T A MLARC        Y+  VS LF  Q  W  S++    
Sbjct: 140 IDTGKVRFIFREFPFEPVATAAFMLARCMPDD---KYFPMVSTLFETQKAWAYSQDPAAG 196

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           LL +AK AG S+ DF+ CL DQ + + ++     A+++  +++TP FFI G    G +  
Sbjct: 197 LLAVAKQAGMSQADFEKCLTDQTLGEKVQESALYANKELGVNATPTFFINGKKISGALGI 256

Query: 216 GVFSKIIDSMIQ 227
             + K +  ++ 
Sbjct: 257 AEWDKELAPLLA 268


>gi|49475253|ref|YP_033294.1| hypothetical protein BH04560 [Bartonella henselae str. Houston-1]
 gi|49238058|emb|CAF27265.1| hypothetical protein BH04560 [Bartonella henselae str. Houston-1]
          Length = 218

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 113/214 (52%), Gaps = 6/214 (2%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYA 73
             ++F           + L     P   VD   LL +     KD   G+++APVT+VEYA
Sbjct: 10  FAVIFALMTTMQISVTTVLASGVKPVSTVDMAELLKS--GKAKDRFEGEENAPVTIVEYA 67

Query: 74  SMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYW 133
           S+TC HCA F+N     +  KYIKTGK++ I R+F  D   + A      A    +  Y+
Sbjct: 68  SLTCVHCAHFYNDVLPQIRKKYIKTGKVKLIFRDFAFD---SRATAGFMLARCAPEDRYF 124

Query: 134 GFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASED 193
             + +LF KQ +W+ +++    L  +   AGF+   F+ CL +Q+ILD++ A  +R  ++
Sbjct: 125 PLIEVLFQKQSEWVWARDAVTPLKKIGLMAGFTDESFNACLKNQSILDEVNASFERG-KE 183

Query: 194 FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             +++TP FFI GN Y G MS   F  +IDS ++
Sbjct: 184 LGVNATPTFFINGNKYEGAMSVEAFFSVIDSFLK 217


>gi|126433087|ref|YP_001068778.1| Na+/H+ antiporter NhaA [Mycobacterium sp. JLS]
 gi|189029134|sp|A3PTR0|NHAA1_MYCSJ RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|126232887|gb|ABN96287.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. JLS]
          Length = 613

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 73/219 (33%), Gaps = 13/219 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            R+GVL   VL F  S+  +      + +   P   V    +    P   +D   G  DA
Sbjct: 406 ARVGVLIASVLAFTLSWALF-----RITDWISPPEPVGLTLVRPVDP--ERDHIRGDPDA 458

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+ +VEY    C  C        +           +          +             
Sbjct: 459 PLVLVEYGDYECPFCGRATGAIDEVRTHFGDDLLYVWRHFPLER--AHPRSFDAARASEG 516

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
               G ++     LF  QDD   S  YR A+        F ++     ++   +L  ++ 
Sbjct: 517 AAAQGKFFEMGRELFAHQDDLEWSDMYRYAVAIGLDIEQFDQDVR---VHASKVLHRVRD 573

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             + A E   ++STP FF+ G  + G        + +++
Sbjct: 574 DAQDA-EVMDLNSTPTFFVNGKRHKGPWDAASLIRALEA 611


>gi|108797466|ref|YP_637663.1| Na+/H+ antiporter NhaA [Mycobacterium sp. MCS]
 gi|119866551|ref|YP_936503.1| Na+/H+ antiporter NhaA [Mycobacterium sp. KMS]
 gi|122977483|sp|Q1BES7|NHAA1_MYCSS RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|189029135|sp|A1UA55|NHAA1_MYCSK RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|108767885|gb|ABG06607.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. MCS]
 gi|119692640|gb|ABL89713.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. KMS]
          Length = 613

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 73/219 (33%), Gaps = 13/219 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            R+GVL   VL F  S+  +      + +   P   V    +    P   +D   G  DA
Sbjct: 406 ARVGVLIASVLAFTLSWALF-----RITDWISPPEPVGLTLVRPVDP--ERDHIRGDPDA 458

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+ +VEY    C  C        +           +          +             
Sbjct: 459 PLVLVEYGDYECPFCGRATGAIDEVRTHFGDDLLYVWRHFPLER--AHPRSFDAARASEG 516

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
               G ++     LF  QDD   S  YR A+        F ++     ++   +L  ++ 
Sbjct: 517 AAAQGKFFEMGRELFAHQDDLEWSDMYRYAVAIGLDIEQFDQDVR---VHASKVLHRVRD 573

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             + A E   ++STP FF+ G  + G        + +++
Sbjct: 574 DAQDA-EVMDLNSTPTFFVNGKRHKGPWDAASLIRALEA 611


>gi|304319999|ref|YP_003853642.1| twin-arginine translocation signal domain protein [Parvularcula
           bermudensis HTCC2503]
 gi|303298902|gb|ADM08501.1| twin-arginine translocation signal domain protein [Parvularcula
           bermudensis HTCC2503]
          Length = 229

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 59/226 (26%), Positives = 104/226 (46%), Gaps = 6/226 (2%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD--VSIGQKDAPVT 68
           L G+ ++ +A        G+  N     +        LAA   ++    +++G ++AP+T
Sbjct: 4   LVGVWVVLLAGVLSGCGGGAQENATAEGETSASQSQTLAAPEGSLAGATMALGSEEAPLT 63

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE--- 125
           ++EYAS+TC  CA FH + F  +++KYI TGK+R+I REFP    +              
Sbjct: 64  IIEYASVTCPACAAFHAQYFPEIKEKYIDTGKVRFIYREFPTAPQNLAYAGFYTARCAAT 123

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            R    Y+  +  L+ +Q +W    N  D L N+A  AG  + + +TC   ++I   +KA
Sbjct: 124 DRGPVAYFAMLDTLYARQREWAYGDNPGDVLENIAAQAGIDRQELETCFRREDIRSAVKA 183

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
                 E   ++STP F +       +      S+ I+  +  + +
Sbjct: 184 NVLEGVEAHGVNSTPTFIVDDEELDWNRGSETMSEAIERALA-ARQ 228


>gi|269926838|ref|YP_003323461.1| DSBA oxidoreductase [Thermobaculum terrenum ATCC BAA-798]
 gi|269790498|gb|ACZ42639.1| DSBA oxidoreductase [Thermobaculum terrenum ATCC BAA-798]
          Length = 231

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/192 (20%), Positives = 75/192 (39%), Gaps = 2/192 (1%)

Query: 33  NELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLE 92
                P+   +   +   +    +   +G  +APVT+  +A   C +C EF       L+
Sbjct: 38  PASTTPESASNRNQVAVPTGVPAEGNVMGDPNAPVTVEVWADYQCPYCREFVMGPEAQLK 97

Query: 93  DKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY 152
              I  GK++ + R F      +V    A     +  G +W +   LF++Q    +    
Sbjct: 98  KTLIPEGKVKLVYRNFAFIGQESVDA-AAAAYCAQDQGRFWDYNYKLFSEQGAENSGTFS 156

Query: 153 RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
           +  L+  A   G +   F +CL+    L  ++A  +       + +TP  F+ G    G 
Sbjct: 157 KANLIRFASDLGLNVAQFRSCLDSGKYLSKVQADTQDGRAK-GVRATPTIFVNGEKIEGL 215

Query: 213 MSEGVFSKIIDS 224
            S     ++I+S
Sbjct: 216 PSYEQLVQVINS 227


>gi|194015641|ref|ZP_03054257.1| disulfide bond formation protein D (Disulfide oxidoreductaseD)
           (Thiol-disulfide oxidoreductase D) [Bacillus pumilus
           ATCC 7061]
 gi|194013045|gb|EDW22611.1| disulfide bond formation protein D (Disulfide oxidoreductaseD)
           (Thiol-disulfide oxidoreductase D) [Bacillus pumilus
           ATCC 7061]
          Length = 228

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 71/230 (30%), Gaps = 14/230 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S+ +  V+  I+   +   F      ++                + + PS      IG K
Sbjct: 9   SSIKFAVILTIIAALLIGIFVVIGNKNSQE-----------AQTVDSKPSIKGQPVIGDK 57

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST---VAVML 120
           DA V +VE+    C  C  F    F  L+  YI  G + +     PL        +A + 
Sbjct: 58  DAAVQIVEFGDYKCPSCKSFETDIFPKLKADYIDKGDVSFSFINLPLPVHGDGAVLAALA 117

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           +    K     +W +   ++  Q D          L  +AK       D       +   
Sbjct: 118 SEEVWKEDPKNFWAYHEAVYQAQPDSEAEWVTPAKLTELAKKTTKIDTDKLKDNLSKKTY 177

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                   +    + ++STP  FI               ++ID  ++   
Sbjct: 178 QPQLNTDDQLVNKYKVNSTPTIFINNKQVQNFYDYDEIKELIDQELKGKK 227


>gi|161528658|ref|YP_001582484.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339959|gb|ABX13046.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 247

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 55/234 (23%), Positives = 96/234 (41%), Gaps = 16/234 (6%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVV-------DFRALLAASPSTMKDVSIGQ 62
           V   ++++F   Y      G           +        D ++   +  S   D  +G 
Sbjct: 15  VASVVLVVFFLGYLVGMEVGQDTVRKQELANLEQRLAELKDSKSNTPSQISKDNDPLLGD 74

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS-TVAVMLA 121
            DAP+++VE+++  C  C  F++ T   L+ +YI TGK+  I R+FP+  +         
Sbjct: 75  PDAPLSIVEFSNFQCKFCLRFYSDTLPLLKTQYIDTGKVNLIYRDFPIPKIYDNSMSAAL 134

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL--LNMAKFAGFSKNDFDTCLNDQNI 179
                   G +W +  +LF  Q  W  +++    L     A     ++  FD+CL+    
Sbjct: 135 ASECANEQGKFWEYHDILFENQHTWRQNESDLSLLTFKQFANTLVLNQEKFDSCLDSGKY 194

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLY-----LGDMSEGVFSKIIDSMIQD 228
            D+I +       D+A+  TP FF+G +        G  S   F KIID  ++ 
Sbjct: 195 ADEINSDVGDG-RDYAVSGTPTFFVGNDKVGYSSLFGTQSFSDFQKIIDEKLEQ 247


>gi|153003254|ref|YP_001377579.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
 gi|152026827|gb|ABS24595.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
          Length = 664

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 54/175 (30%), Gaps = 9/175 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G   APVT+V ++   C  CA       +          K+R + +  PL  
Sbjct: 497 VRTDDPVRGNPKAPVTIVLFSDFQCPFCARVGPTLDEVQRTYGD---KVRVVWKHQPLPF 553

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
                         R  G +W     LF  Q +       R     +A+  G     F  
Sbjct: 554 HQQALPAAEAAEAAREQGRFWQMHDKLFASQRELSPDAYGR-----IAREIGLDAKKFQA 608

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            +        I+  ++ AS       TP  F+ G   +G +       +ID  + 
Sbjct: 609 SVQSGKARARIQEDQQLAS-RVGAQGTPTMFVNGEKIVGAVPFAQIKAVIDRQLA 662



 Score =  105 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 58/225 (25%), Gaps = 12/225 (5%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPST------MKDVSIGQKD 64
           +  +V+ F   +F                      A     PS             G  D
Sbjct: 7   IIALVIGFSVGFFSRGAIDGGGRGARPSGQAQQRPARPVEDPSAVYRVPVDDTPLRGPAD 66

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT+VE +   C  C        +  E    K                   A+      
Sbjct: 67  ALVTIVESSDFECPFCKRVGPTLKQLEEAFPGKLRFSFRHNPLPFHARALPAAIAAEEAR 126

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            +  D  +W         +   +       ++   A+  G         +      D I+
Sbjct: 127 AQGGDAKFWAMHD-----KLFELAPALDDASIERAAQEIGIDAAKVKEAIASGKHKDRIQ 181

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
              +R  +     +TP FFI G    G      F  ++   ++ +
Sbjct: 182 RD-QRVVQSVGAPATPSFFINGRKLAGAQPFETFRALVAEELKKA 225



 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 59/209 (28%), Gaps = 9/209 (4%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
            Y       +A  +           A+    P    D + G   A +T+V ++   C  C
Sbjct: 251 VYLPTPTGQAAPQDGAPKAPAAAPAAVYRKVPLRADDPARGPASAKLTVVLFSDFQCPFC 310

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
           A       +    +    G+LR + +  PL                R  G +W     LF
Sbjct: 311 ARVEPTLKQL---EEAYPGQLRVVWKHQPLGFHQQAMPAALAAEAAREQGKFWQLHDKLF 367

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
             Q           +L   AK  G      +  L  +     I+   +  +       TP
Sbjct: 368 ENQRALD-----DASLARYAKEIGLDARKLEQALQSKKHEPRIQEDMRLGAS-VGASGTP 421

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             F      +G         + D  ++ +
Sbjct: 422 TLFFNCRQLVGAQPFDRMKAVADEELKKA 450


>gi|108760353|ref|YP_635417.1| thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108464233|gb|ABF89418.1| thioredoxin domain protein [Myxococcus xanthus DK 1622]
          Length = 439

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/209 (22%), Positives = 74/209 (35%), Gaps = 11/209 (5%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
            +     +  +  P+   + +  A+      T    + G  +APVT+V ++   C  CA 
Sbjct: 242 VYARTISAGKDSPPMEQMMPEEPAIQQVDVGTA--PTRGPANAPVTVVAFSDFECPFCAR 299

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
                      +    GKLR   +  PL   +   V      E    G +W F  +LF  
Sbjct: 300 VVPTMKAL---EAAYPGKLRVAFKHQPLAQHANAQVAAEAAMEAHAQGRFWEFHDVLFAN 356

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           Q         R +L + A+  G     F+  L+ +     + A   +A        TP F
Sbjct: 357 QRKLD-----RASLEHYARQVGLDVGRFNAALDSRKHDAHVSADVAQAM-RVGATGTPTF 410

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           FI G    G      F  IID  ++ + R
Sbjct: 411 FINGRPVTGARPVEHFRAIIDDELRKAAR 439



 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 74/238 (31%), Gaps = 20/238 (8%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI-- 60
           MS + + V   + L    +     R             +        A P      ++  
Sbjct: 1   MSKSSVWVSLSVGLALGFAGGRLARPTELATGTAHAANLAAKAPAPGARPRAPISPTVYK 60

Query: 61  ---------GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
                    G +DA VT+VE++   C  C+  +    +  E       KLR +++  PL 
Sbjct: 61  VPVNDSPTAGAEDALVTLVEFSDYECPFCSRANGTVKQLQERYGR---KLRVVMKHHPLA 117

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
           +                 G +W     LF               +   A   G + + ++
Sbjct: 118 NHPRARPAALAALAAGEQGKFWEMHEALFAN-----PRALSEADMERYAMKVGLNISRWN 172

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
               D  + + I+  +  A        TP F++ G    G     VF+ ++D  +  +
Sbjct: 173 QDRADPRLAERIRQDEALAM-RLGATGTPAFYVNGRFISGAQPLEVFTGVVDEELSKA 229


>gi|157693761|ref|YP_001488223.1| disulfide dehydrogenase D [Bacillus pumilus SAFR-032]
 gi|157682519|gb|ABV63663.1| disulfide dehydrogenase D [Bacillus pumilus SAFR-032]
          Length = 228

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 71/230 (30%), Gaps = 14/230 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S+ +  V+  I+   +   F      ++                + + PS      IG K
Sbjct: 9   SSIKFAVILTIIAALLIGIFVVIGNKNSQE-----------AQTVDSKPSIQGQPVIGDK 57

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST---VAVML 120
           +A V +VE+    C  C  F    F  L+  YI  G + +     PL        +A + 
Sbjct: 58  NAAVQIVEFGDYKCPSCKSFETDIFPKLKADYIDKGDVSFSFINLPLPVHGDGAVLAALA 117

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           +    K     +W F   ++  Q D          L  +AK       D       +   
Sbjct: 118 SEEVWKEDPKNFWAFHEAVYQAQPDSEAEWVTPAKLTELAKKTTKIDTDKLKDHLSKKTY 177

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                   +    + ++STP  FI               ++ID  ++   
Sbjct: 178 QPQLNTDNQLVNKYKVNSTPTIFINNKQVQNFYDYDEIKELIDQELKGKK 227


>gi|75812802|ref|YP_320419.1| DSBA oxidoreductase [Anabaena variabilis ATCC 29413]
 gi|75705558|gb|ABA25230.1| DSBA oxidoreductase [Anabaena variabilis ATCC 29413]
          Length = 196

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 63/194 (32%), Gaps = 8/194 (4%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
            LP+ D      A    +P   +D   G K+APVT+VEY    C +C   H    +  + 
Sbjct: 10  SLPVSDAFSFRDATANGTPEGERDHIRGPKNAPVTLVEYGDYECPYCGRAHFIVKELQQL 69

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
                  +        +   +  A   A  A  +    +W   + LF  Q         R
Sbjct: 70  TGDLMRFVYRHFPLTSVHPHAEQAAEAAEAAAAQG--KFWEMHNHLFEHQQALD-----R 122

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
             L+  A   G     F   L +      I+       +   ++ TP FFI G  + G  
Sbjct: 123 KHLIEYAANLGLDVPRFSHELAEHAHAAKIREDLLSGIQS-GVNGTPTFFINGVRHDGSY 181

Query: 214 SEGVFSKIIDSMIQ 227
                   I +  +
Sbjct: 182 DLRSLLAAIQNAAE 195


>gi|315442203|ref|YP_004075082.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. Spyr1]
 gi|315260506|gb|ADT97247.1| sodium/proton antiporter, NhaA family [Mycobacterium sp. Spyr1]
          Length = 615

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 74/219 (33%), Gaps = 13/219 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            RIGVL   VL F   +  +      + +   P   V  + L    P   +D   G+ DA
Sbjct: 407 ARIGVLAASVLAFALGWAIF-----RITDWLSPPEPVGLKLLRPIDP--ERDHVRGRPDA 459

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+T+VEY    C  C+       +           +          +             
Sbjct: 460 PLTLVEYGDFECPFCSRVTGAIDEVRAHFGDDLLYVWRHFPLER--AHPRAFDAARASEA 517

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
             + G +W     LF  QDD   S  YR A+        F ++     ++   +L  +  
Sbjct: 518 AALQGRFWEMTHELFTHQDDLEWSDMYRYAVAAGCDIEQFDQDVR---VHSSKVLHRVSD 574

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             + A     +++TP  F+ G  + G        + +++
Sbjct: 575 DAEDADAMD-LNATPTLFVNGKRHRGPWDAASLIRALEA 612


>gi|145220843|ref|YP_001131521.1| Na+/H+ antiporter NhaA [Mycobacterium gilvum PYR-GCK]
 gi|189029133|sp|A4T134|NHAA1_MYCGI RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|145213329|gb|ABP42733.1| sodium/proton antiporter, NhaA family [Mycobacterium gilvum
           PYR-GCK]
          Length = 617

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 74/219 (33%), Gaps = 13/219 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            RIGVL   VL F   +  +      + +   P   V  + L    P   +D   G+ DA
Sbjct: 409 ARIGVLAASVLAFALGWAIF-----RITDWLSPPEPVGLKLLRPIDP--ERDHVRGRPDA 461

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+T+VEY    C  C+       +           +          +             
Sbjct: 462 PLTLVEYGDFECPFCSRVTGAIDEVRAHFGDDLLYVWRHFPLER--AHPRAFDAARASEA 519

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
             + G +W     LF  QDD   S  YR A+        F ++     ++   +L  +  
Sbjct: 520 AALQGRFWEMTHELFTHQDDLEWSDMYRYAVAAGCDIEQFDQDVR---VHSSKVLHRVSD 576

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             + A     +++TP  F+ G  + G        + +++
Sbjct: 577 DAEDADAMD-LNATPTLFVNGKRHRGPWDAASLIRALEA 614


>gi|51893196|ref|YP_075887.1| hypothetical protein STH2058 [Symbiobacterium thermophilum IAM
           14863]
 gi|51856885|dbj|BAD41043.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 260

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/216 (20%), Positives = 70/216 (32%), Gaps = 7/216 (3%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           V+G  V +  A           L E+ +P        +L           +G  DAPV +
Sbjct: 44  VIGVAVGVTAALIVASNVTARRLGEIVLP------SIILTDQERGADRHVLGSADAPVEL 97

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           VE++   C HC E H      +E+   +            +D   T              
Sbjct: 98  VEFSDFRCPHCRESHEILGSQIEELVAEGTARYVRKHMLVIDPSDTSLNAAEAVECAADQ 157

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
           G YW F+ +LF  Q                A+  G     F+ C++ Q   D + A    
Sbjct: 158 GYYWAFLDMLFANQAAQGQKWTRDAM-KTYARELGLDTKAFNECMDQQKYRDKVLADSAE 216

Query: 190 ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
                 I  TP F + G L      + V S ++ + 
Sbjct: 217 GYSTPGITGTPSFLVNGELLRIRSYQDVISAVLAAA 252


>gi|297154110|gb|ADI03822.1| Na+/H+ antiporter NhaA [Streptomyces bingchenggensis BCW-1]
          Length = 626

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 66/215 (30%), Gaps = 11/215 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPD--GVVDFRALLAASPSTMKDVSIGQK 63
            +IG+L  ++  F+ S+      G    E  +    G  +    L       +D   G +
Sbjct: 406 AKIGILSAVLCSFVISWLITRAIGGLPREAQLRALLGKAETIIDLPVPVDPHRDHVRGPR 465

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           DAPVT+VEY    C  C +      +                     D      +     
Sbjct: 466 DAPVTVVEYGDYECPFCGQAEPVIREL---LGDFGDVRYVWRHLPLTDVHVHAQLAAEAA 522

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
               + GGYW    LL + Q          D L   A   G     F+  +  +     +
Sbjct: 523 EAAALQGGYWDMHDLLLSHQGALRF-----DDLRGYAADIGLDVARFERDMRSRAGSARV 577

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
               + A +   +  TP FF+ G  + G       
Sbjct: 578 AEDVESA-DVGGVAGTPTFFVNGRRHQGAYDITGL 611


>gi|21218835|ref|NP_624614.1| sodium/proton antiporter [Streptomyces coelicolor A3(2)]
 gi|81552762|sp|Q9S2C8|NHAA2_STRCO RecName: Full=Na(+)/H(+) antiporter nhaA 2; AltName:
           Full=Sodium/proton antiporter nhaA 2
 gi|5824094|emb|CAB54170.1| putative sodium/proton antiporter [Streptomyces coelicolor A3(2)]
          Length = 629

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 67/226 (29%), Gaps = 11/226 (4%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKG--SALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
            RIG+L  +V  F+ S+      G            G VD    LA       D   G +
Sbjct: 410 ARIGILVTLVGAFLTSWAVTAVIGLLPERRRARALLGDVDPLTDLAVPVDRRHDRIRGPE 469

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            A VT+VEY    C +C +        L  +                D      +     
Sbjct: 470 SAVVTVVEYGDFECPYCGQAEPVVRDLLGQESDVR---YVWRHLPLRDVHPRAQLAAEAS 526

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                   +W    LL  +Q+           LL  A   G     F   L D      +
Sbjct: 527 EAAARQDRFWEMHDLLLERQNALAAPD-----LLRYAGELGLDVERFRQDLRDHLGARRV 581

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                 A +   +  TP FFI G  + G       ++ ++   Q +
Sbjct: 582 AEDVDSA-DLSRVSGTPTFFINGRRHHGAYDIAALTRAVELARQRA 626


>gi|119384827|ref|YP_915883.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
 gi|119374594|gb|ABL70187.1| DSBA oxidoreductase [Paracoccus denitrificans PD1222]
          Length = 223

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 54/199 (27%), Positives = 86/199 (43%), Gaps = 1/199 (0%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
                       A        + D+++GQ DAPVT++EYAS TC HCA FH++    L+ 
Sbjct: 25  AQEAKPADNAQAAEQMPEGKVLPDIALGQADAPVTIIEYASFTCSHCAAFHDQNLPKLKA 84

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           +Y+ TGK+++I R+   D+V   A +LARC            +           +     
Sbjct: 85  EYVDTGKVKFIQRDVYFDAVGLWAGILARCGGDEKYYAVSDLIFGDQKNWLSAKSGDEIA 144

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
             L  +   AG +    DTC NDQ  + D+    +  +    I+ TP F I G     + 
Sbjct: 145 ANLRKIGAKAGMTPEQMDTCWNDQQKVADLVTTFQTHATADQIEGTPTFIIAGEKVQ-NQ 203

Query: 214 SEGVFSKIIDSMIQDSTRR 232
                 KIID+ + ++  +
Sbjct: 204 PWDDLKKIIDAKLAEAESK 222


>gi|256790168|ref|ZP_05528599.1| sodium/proton antiporter [Streptomyces lividans TK24]
          Length = 606

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 68/226 (30%), Gaps = 11/226 (4%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKG--SALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
            RIG+L  +V  F+ S+      G            G VD    LA       D   G +
Sbjct: 387 ARIGILVTLVGAFLTSWAVTAVIGLLPERRRARALLGDVDPLTDLAVPVDRRHDRIRGPE 446

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            A VT+VEY    C +C +        L  +                D      +     
Sbjct: 447 SAVVTVVEYGDFECPYCGQAEPVVRDLLGQESDVR---YVWRHLPLRDVHPRAQLAAEAS 503

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                 G +W    LL  +Q+           LL  A   G     F   L D      +
Sbjct: 504 EAAARQGRFWEMHDLLLERQNALAAPD-----LLRYAGELGLDVERFRQDLRDHLGARRV 558

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                 A +   +  TP FFI G  + G       ++ ++   Q +
Sbjct: 559 AEDVDSA-DLSRVSGTPTFFINGRRHHGAYDIAALTRAVELARQRA 603


>gi|170747150|ref|YP_001753410.1| DsbA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
 gi|170653672|gb|ACB22727.1| DsbA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
          Length = 214

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 75/189 (39%), Positives = 104/189 (55%), Gaps = 3/189 (1%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P    +        P  + DV +G  DA  T++EYASMTC HCA FH  T+  L+++YI 
Sbjct: 27  PAQAQNSEMAALLQPGPLGDVWLGPADAKCTIIEYASMTCSHCAAFHRNTWPTLKERYID 86

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK+R+ LREFPLD    +A      A  + D  Y+    LLF++Q  W  +    DAL 
Sbjct: 87  TGKVRFTLREFPLD---PLATAAFMLARCQGDSKYYPITDLLFDQQAAWAFTPKPVDALE 143

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            M + AG++K  F+ CL DQ I   + A K+R  + F +DSTP FFI G  Y G+M+   
Sbjct: 144 QMLRQAGYNKQTFEACLKDQKIYSAVNAVKQRGLDVFKVDSTPTFFINGERYTGEMTVEG 203

Query: 218 FSKIIDSMI 226
             K+I  +I
Sbjct: 204 MEKVIKPII 212


>gi|289774045|ref|ZP_06533423.1| sodium/proton antiporter [Streptomyces lividans TK24]
 gi|289704244|gb|EFD71673.1| sodium/proton antiporter [Streptomyces lividans TK24]
          Length = 643

 Score =  108 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 68/226 (30%), Gaps = 11/226 (4%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKG--SALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
            RIG+L  +V  F+ S+      G            G VD    LA       D   G +
Sbjct: 424 ARIGILVTLVGAFLTSWAVTAVIGLLPERRRARALLGDVDPLTDLAVPVDRRHDRIRGPE 483

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            A VT+VEY    C +C +        L  +                D      +     
Sbjct: 484 SAVVTVVEYGDFECPYCGQAEPVVRDLLGQESDVR---YVWRHLPLRDVHPRAQLAAEAS 540

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                 G +W    LL  +Q+           LL  A   G     F   L D      +
Sbjct: 541 EAAARQGRFWEMHDLLLERQNALAAPD-----LLRYAGELGLDVERFRQDLRDHLGARRV 595

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                 A +   +  TP FFI G  + G       ++ ++   Q +
Sbjct: 596 AEDVDSA-DLSRVSGTPTFFINGRRHHGAYDIAALTRAVELARQRA 640


>gi|254462151|ref|ZP_05075567.1| dsba oxidoreductase:tat pathway signal [Rhodobacterales bacterium
           HTCC2083]
 gi|206678740|gb|EDZ43227.1| dsba oxidoreductase:tat pathway signal [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 198

 Score =  108 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 53/194 (27%), Positives = 85/194 (43%), Gaps = 1/194 (0%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
           +     V+   ++  A    + D+  G  DA V ++EYAS TC HCA FH   +K L+  
Sbjct: 6   VTTAAAVLFSLSMATAQEGDIADMVQGSPDAKVEIIEYASYTCPHCASFHAGPYKDLKKD 65

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           Y+ TGK++++ RE   D     A M+ARCA      G    +    +      +      
Sbjct: 66  YVDTGKVKFVFREVYFDRFGLWASMIARCAGPDRFFGMTDLLFKEQSLWSRAGDPAAIVA 125

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
            L  +    G  +   + CL D +    + A  +  +E   + STP F I G  Y  +M+
Sbjct: 126 ELRKIGLKGGMEEAQLNACLEDADNAQALVAWYQENAERDDVGSTPSFLINGEPYS-NMN 184

Query: 215 EGVFSKIIDSMIQD 228
              FS II+  + +
Sbjct: 185 YADFSAIIEENLAE 198


>gi|310817656|ref|YP_003950014.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|309390728|gb|ADO68187.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 218

 Score =  108 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 72/227 (31%), Gaps = 12/227 (5%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELP---IPDGVVDFRALLAASPSTMKDVSIG 61
                  G  V+  +           + +  P    P           ++    +  S+G
Sbjct: 1   MKSFLSAGAAVVALLGLSTPAVASTPSSSNPPEECKPLRRESLEKQAISATPRTEAPSLG 60

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             DA VT+  ++   C  CA          E    +   +R + R+ PL S     +   
Sbjct: 61  SADAKVTVEVWSDFECPFCARGAETVKALREKYGEQ---VRIVFRQNPLPSHKNARLAAV 117

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                   G +W F   LF  QD        R +L  +A         F   L+     +
Sbjct: 118 ASMAAHEQGKFWEFHDALFAHQDTLD-----RASLEKLAGQLNLDVERFQRALDSSTWNN 172

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            +   +   S+   + + P FF+ G   LG     VF++ ID  +  
Sbjct: 173 YVDMERTE-SQRRRVTAAPTFFVNGKPLLGAQPLSVFAQTIDEALAR 218


>gi|319408233|emb|CBI81886.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 204

 Score =  108 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 78/211 (36%), Positives = 113/211 (53%), Gaps = 8/211 (3%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ I++        +AL     P   VD   LL       KD   G  +APVT+VEYAS+
Sbjct: 2   VILISAITAQINATTALAGKVKPVATVDMVKLLQ----DGKDRVEGDINAPVTIVEYASV 57

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
           TC HCA+F+N     +  KYIKTGK++ I REF  D     A      A    +  Y+  
Sbjct: 58  TCGHCADFYNNVLPKIRKKYIKTGKVKLIFREFAFD---PRATAGFMLARCAPEDRYFPL 114

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           + +LF KQ +W+  ++    L  ++  AGF+   F+ CL +Q+ILD++ A  +R  ++F 
Sbjct: 115 IEVLFQKQSEWVWVEDSLTPLKKISSLAGFTDESFEACLKNQSILDEVNASFERG-KEFG 173

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + +TP FFI GN Y G MSE  F  IIDS +
Sbjct: 174 VTATPTFFINGNKYEGLMSEEDFFSIIDSFL 204


>gi|312115734|ref|YP_004013330.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220863|gb|ADP72231.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
          Length = 263

 Score =  108 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 105/240 (43%), Gaps = 21/240 (8%)

Query: 1   MVMSTTRIGVLGGIVLLFIASY--FFYTRKGSALNELPI---------------PDGVVD 43
           M +S+    V        +A            ++  LP                P     
Sbjct: 1   MTLSSVARLVGAASFAALLAGCTSGVSLPAMPSMPSLPSLSLGADEAAQADADKPKSERV 60

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
             A   A P  + D  IG+ +APVT+VEY S+TC + A+F  +T   L+  YI  GK++ 
Sbjct: 61  ISAADLAEPGPLGDQVIGKGNAPVTVVEYLSLTCANSAKFQAETLPKLKKAYIDKGKVKL 120

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           +LRE+P+   +    +L+RC  ++     +  V  L + Q  W+  +   D + N  KF 
Sbjct: 121 VLREYPIGKAAAATAVLSRCLPQKDY---FKVVEKLLSTQQTWVAQEVKPDDIYNAVKFT 177

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G  ++ FD CL +Q+I D +   K+R    F +  TP FF+ G    G +S      II+
Sbjct: 178 GIKRDKFDECLTNQSINDALVLVKQRG-RGFGVSGTPTFFVNGKKLAGAVSFEEMQPIIE 236


>gi|121602418|ref|YP_988736.1| DSBA-like thioredoxin domain-containing protein [Bartonella
           bacilliformis KC583]
 gi|120614595|gb|ABM45196.1| DSBA-like thioredoxin domain protein [Bartonella bacilliformis
           KC583]
          Length = 216

 Score =  108 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 75/216 (34%), Positives = 112/216 (51%), Gaps = 6/216 (2%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           L  +V++ I +         A +    P  +VD   LL      +KD   G  +APVT++
Sbjct: 7   LLSLVIICILAITTQINATVAFSGEVKPVAIVDMAKLL--QSGKVKDRFEGDINAPVTII 64

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           EYAS+TC HCA+F+N     +  KYIKTGK++ I R+F  D     A      A    + 
Sbjct: 65  EYASLTCAHCADFYNTVLPKIRKKYIKTGKVKLIFRDFAYD---PRATAGFMLARCAPED 121

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
            Y+  + +LF KQ DW   ++    L  +   AGF+   FD+CL +Q+ILD++ A  +R 
Sbjct: 122 RYFPLIEVLFEKQKDWAWVQDALTPLRKIGAMAGFTNESFDSCLQNQSILDEVNASTERG 181

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            ++  + +TP FFI G+ Y G M    F  IIDS +
Sbjct: 182 -KELGVTATPTFFINGHQYNGGMPTENFFSIIDSFL 216


>gi|167042115|gb|ABZ06849.1| putative DSBA-like thioredoxin domain protein [uncultured marine
           crenarchaeote HF4000_ANIW93E5]
          Length = 224

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/229 (20%), Positives = 86/229 (37%), Gaps = 10/229 (4%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M    I V G  V + +     +T   S  +  P   G+     +   +       ++G 
Sbjct: 1   MEAKTIIVAGTFVGIVLIVVTLFTSFQSGWDNNPGGMGMKTESTINLEN----GSPALGS 56

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           + AP+T+VE+    C  C  + + T   + D YI+TGK + I  + P     +     A 
Sbjct: 57  ESAPITIVEFGDYQCESCYYWFHNTRSTIIDNYIETGKAKLIFVDLPFLGRDSKTAAQAS 116

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
              +     +     L   +     +    +D L + A     + ++F+ C++       
Sbjct: 117 YCAEDQGKYWEYHTMLYTFQDGAPDSGWASQDRLNSFAFTLEMNMDEFNDCMDSSKYKIR 176

Query: 183 IKAGKKRASEDFAIDSTPVFFI---GG--NLYLGDMSEGVFSKIIDSMI 226
           ++A    A +     STP F I    G    + G     VF+  I+SM+
Sbjct: 177 VQANYHEAVKQ-GAQSTPTFIIISSDGTTKKFAGAQPYSVFAATIESML 224


>gi|329765194|ref|ZP_08256774.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329138100|gb|EGG42356.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 214

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 83/224 (37%), Gaps = 15/224 (6%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
              I +L   + + + +  F     S+ +             L  ++        +G   
Sbjct: 1   MKNIYLLAIPIGVGLLTGLFLAFFPSSNDNSNT---------LTESNLIQNGSPILGNPS 51

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A +T++E+    C  C +FH  T   ++  +I TGK++ + ++FPL+   +  +      
Sbjct: 52  ASITILEFGDYQCTFCYKFHQGTLNTIKHDFIDTGKVKLVFKDFPLNGADS-ILAAEGAH 110

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             +    YW +   ++            RD+L   A       + F+ CL+    L+ + 
Sbjct: 111 CAQDQEKYWQYHDEIYKNWAGERTGWVTRDSLDKFATTVNLDLDKFNECLDSHKYLEKVN 170

Query: 185 AGKKRASEDFAIDSTPVFFI--GGN--LYLGDMSEGVFSKIIDS 224
                  +   +D+TP FF+          G+    VF K ID 
Sbjct: 171 QLYDFG-KKIGVDATPSFFVFNNEKIIKITGNQPLEVFLKTIDE 213


>gi|83950888|ref|ZP_00959621.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseovarius nubinhibens ISM]
 gi|83838787|gb|EAP78083.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseovarius nubinhibens ISM]
          Length = 331

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 1/172 (0%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           ++ +G +DA VT++EYAS TC HCA FH   FK L+  YI TGK+R++ R+   D     
Sbjct: 161 EMVLGNEDAKVTVMEYASFTCPHCASFHENQFKQLKADYIDTGKIRFVYRDVYFDRYGLW 220

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A M+ARC       G    +     +  D  +     + L  + + AG   +    CL D
Sbjct: 221 AAMVARCEGPSKFFGISNLLYEQQREWMDTQDPVKTSENLRRLGRIAGLDGDKLTACLED 280

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++    + +  +  SE   I STP   I G  + G+M+     ++I++ + +
Sbjct: 281 EDKARALVSWWQENSEADDISSTPTLLINGESH-GNMNYADLKELIEAELAE 331


>gi|319405305|emb|CBI78919.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 216

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 113/217 (52%), Gaps = 6/217 (2%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
            +   V++FI          + L     P   +D   LL +    +KD   G+ +APV +
Sbjct: 6   FIVSFVIIFIWGVTAQVHATTTLVSKAKPVATIDMAELLKS--GKVKDKVEGEDNAPVII 63

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           +EYAS++C  CA+F+N     L  KYIKTGK++ I R+F  D     A      A    +
Sbjct: 64  IEYASLSCAFCADFYNVILPQLRKKYIKTGKVKLIFRDFSYD---PRATAGFMLARCAPE 120

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
             Y+  + +LF KQ++W+ + +  + L  +A  AGF+   F+ CL +Q+ILD++ A  +R
Sbjct: 121 DRYFPLIEVLFQKQNEWVMAADALEPLKKIAFMAGFTDESFNACLKNQSILDEVNASFER 180

Query: 190 ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             ++  + +TP FFI G  Y G MS   F  +IDS +
Sbjct: 181 G-KELGVTATPTFFINGKKYEGAMSMQDFFSVIDSFL 216


>gi|149203474|ref|ZP_01880444.1| thiol:disulfide interchange protein, DsbA family [Roseovarius sp.
           TM1035]
 gi|149143307|gb|EDM31346.1| thiol:disulfide interchange protein, DsbA family [Roseovarius sp.
           TM1035]
          Length = 202

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 52/188 (27%), Positives = 81/188 (43%), Gaps = 2/188 (1%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                   A   S + ++++G +DA VT++EYAS TC HCA FH    K L+ +YI T K
Sbjct: 17  GPAVAQEAAPDTSQIVEMTMGPEDAKVTIIEYASFTCPHCANFHKGPLKQLKAEYIDTDK 76

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
           + +I R+   D     A M+ARC       G    +     +           D L  + 
Sbjct: 77  VHFIYRDVYFDRFGLWASMVARCGGPEKFFGISDMIYEQQGEWTQ-GEPAAIADNLRRIG 135

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
           K AG   +  + CLND      + A  +  +E   ++STP   I    Y  +M+      
Sbjct: 136 KVAGLEPDAVEACLNDTEKAKALVAWYQENAEAHGVESTPTLVINEQKYA-NMAYDDLKA 194

Query: 221 IIDSMIQD 228
           II+  + +
Sbjct: 195 IIEEKLAE 202


>gi|145594211|ref|YP_001158508.1| Na+/H+ antiporter NhaA [Salinispora tropica CNB-440]
 gi|189029102|sp|A4X5I0|NHAA3_SALTO RecName: Full=Na(+)/H(+) antiporter nhaA 3; AltName:
           Full=Sodium/proton antiporter nhaA 3
 gi|145303548|gb|ABP54130.1| Na+/H+ antiporter NhaA [Salinispora tropica CNB-440]
          Length = 652

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 73/229 (31%), Gaps = 11/229 (4%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPD--GVVDFRALLAASPSTMKDVSIGQK 63
            ++G+L   V   + ++  +                G  +    L       +D   G +
Sbjct: 409 AKVGILVATVGASLTTWLVFRLAARLAPARRARALLGASEGIIDLMVPVDPDRDHVRGPR 468

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +APVT+VEYA   C +C +      + L D                 D      +     
Sbjct: 469 EAPVTVVEYADFECPYCGQAEPAVRELLVDYTSVR---YVWRHLPLTDVHPYAQMAAEAA 525

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                 G +W    LL   QD+          LL  A+      + F   L D+     I
Sbjct: 526 EAAAEQGAFWEMHDLLLAHQDELRP-----ADLLRYAERLDLDLDRFREHLADRRGAGRI 580

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
                 A++  ++  TP FF+ G  + G  +    S  + S    +  R
Sbjct: 581 AQDVD-AADLSSVSGTPTFFVNGRRHHGPYNIEALSAAVMSAFASARLR 628


>gi|260426823|ref|ZP_05780802.1| dsba oxidoreductase [Citreicella sp. SE45]
 gi|260421315|gb|EEX14566.1| dsba oxidoreductase [Citreicella sp. SE45]
          Length = 223

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 54/194 (27%), Positives = 89/194 (45%), Gaps = 1/194 (0%)

Query: 37  IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
                    A    + S + D+++GQ DAPV ++EY S TC HCA F    F  +++ YI
Sbjct: 31  PSAQPPLGAAGAQEAASPVVDMTLGQADAPVEIIEYGSFTCPHCAAFEETVFPQIKENYI 90

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
            TGK+++  RE   +     A ++ARC  +    G    +    N+     + +   DA+
Sbjct: 91  DTGKVKFTFREAYFNKYDMWASLMARCGGEMKYFGIVDMIYSTQNEWARQSSEQGVADAI 150

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
             M   AG  + + D C+ D   L  + A  +   E    +STP F + G L+  +M   
Sbjct: 151 RKMGLQAGIGQEELDACMQDGEQLKALVAWYQGNVEKDGFNSTPSFIVDGELHS-NMPYD 209

Query: 217 VFSKIIDSMIQDST 230
            FSK++D   + + 
Sbjct: 210 EFSKLLDERYEAAQ 223


>gi|42522366|ref|NP_967746.1| disulfide interchange protein [Bdellovibrio bacteriovorus HD100]
 gi|39574898|emb|CAE78739.1| disulfide interchange protein [Bdellovibrio bacteriovorus HD100]
          Length = 260

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 66/206 (32%), Gaps = 4/206 (1%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
             RK              D              V  G KDA VT++EY+   C +CA+ H
Sbjct: 59  AQRKAQEKAVAEEGKKRDDEFKNPLKPAIEEGRVIFGPKDAKVTIIEYSDFECPYCAKGH 118

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
               + ++        +R + +  PLD                +              ++
Sbjct: 119 ATVDEVMKAYPK---DVRVVYKHLPLDFHPMAMPAAQYFEAIALQDAAKAEKFYNLVFEN 175

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                     AL   AK AG      +  LN + +   I+A  + A + F    TP F I
Sbjct: 176 QGDLRTKKEGALKEAAKKAGADMKKLEKDLNSEVVKKRIEADMEEARK-FNFSGTPGFLI 234

Query: 205 GGNLYLGDMSEGVFSKIIDSMIQDST 230
            G    G      F +IID  + ++ 
Sbjct: 235 NGVSLRGAYPFADFKEIIDRHLAEAK 260


>gi|169631363|ref|YP_001705012.1| hypothetical protein MAB_4285 [Mycobacterium abscessus ATCC 19977]
 gi|169243330|emb|CAM64358.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 229

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/218 (21%), Positives = 84/218 (38%), Gaps = 3/218 (1%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I  + G+V++ +A+Y     +  +      P       +L    P  +  +++G  DAPV
Sbjct: 13  IAGILGVVIVALATYLLVDHRSQSTASTDSPTVTGHSSSLARLRP--LDPLALGPVDAPV 70

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            ++ Y+   C  CA+F   T   L ++Y+ TGKLR   R+ P+    +V    A  A   
Sbjct: 71  VLIIYSDYRCPFCAKFSRDTEPQLIERYVNTGKLRIEWRDLPIFGTQSVQAAKAGRAAAE 130

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
               +    ++  +  D        +  L    +        F T +    +L  ++   
Sbjct: 131 QGRFWEFNRAVYRHAPDRGHAELTDKILLDRAREAEVPDLARFQTAVESDRLLPAVQQDI 190

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + A       STPVF I     +G     VF  +I+  
Sbjct: 191 QEAV-AIGAASTPVFLINDQPVVGAQPLDVFISVIEQA 227


>gi|72161925|ref|YP_289582.1| protein-disulfide isomerase [Thermobifida fusca YX]
 gi|71915657|gb|AAZ55559.1| similar to Protein-disulfide isomerase [Thermobifida fusca YX]
          Length = 279

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 81/201 (40%), Gaps = 2/201 (0%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKT 87
             S   +  +              P    ++ +G+ DAPVTMV ++   C +CA F  + 
Sbjct: 79  SDSRPGDGAVAGSASPPVVAGPVPPQVDPELVLGRSDAPVTMVVFSDYQCPYCARFALEQ 138

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI 147
              L ++Y++TG++R + R++P     +              G YW +   L+   + W 
Sbjct: 139 QPVLVERYVETGQVRLVWRDYPYLGEES-VRAAVAARAAGRQGRYWDYHEALYESSEVWR 197

Query: 148 NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            +   R++L+ +A   G   + F   L D  + + ++     A     +  TP F I G 
Sbjct: 198 AAGASRESLVEVAATIGLDTDQFAVDLADPVLREAVEEDFAFAL-GLGVPGTPAFLIDGE 256

Query: 208 LYLGDMSEGVFSKIIDSMIQD 228
            + G      F++ +D  +  
Sbjct: 257 AFFGAQPVERFAERLDEALGK 277


>gi|322382283|ref|ZP_08056193.1| thiol-disulfide oxidoreductase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153785|gb|EFX46156.1| thiol-disulfide oxidoreductase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 228

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 90/230 (39%), Gaps = 6/230 (2%)

Query: 3   MSTTRIGVL-GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           M+  + G+L   IV + + +  F+ ++ S       PD        +           IG
Sbjct: 1   MNKKQTGILLVIIVFVVLITSIFFIQQASEKKGDTFPDLDTAKVDKVPEDFDYANQPVIG 60

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
            ++APV +VE+    C  C ++       L+  YI++GK    + ++P     +    LA
Sbjct: 61  NREAPVKIVEFTDYKCPSCKKWTETVLPKLDQDYIQSGKAAVYVLDYPFLGPDSNLAALA 120

Query: 122 RCAEKRMDGGYWG-FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQN 178
                + +  ++  +  L+  KQ +  ++   +D LLN+ K      +   F+  L+   
Sbjct: 121 GETLYQQNHEFFETYHKLMMEKQKNEKSNWATKDFLLNLVKEGIPGADLQQFEKDLDAGT 180

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            L  +K  K+   +  AI  TP  ++ G              +I+  +  
Sbjct: 181 YLQQMKKDKEIG-KRLAIPGTPTIYVNGLPAENA-DYETVKALIEQELAK 228


>gi|23016159|ref|ZP_00055918.1| COG1651: Protein-disulfide isomerase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 200

 Score =  107 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 5/187 (2%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +   AA  S   D  +G+ DAP+T++EYAS TC HCA FH  T    + ++I+TGK R I
Sbjct: 19  QTAAAADLSYPIDQVLGKADAPITVIEYASTTCPHCATFHKTTLPKFKAEWIETGKARLI 78

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
            R+FP                      Y+G ++L+  +Q+ W++S N    L  +AK AG
Sbjct: 79  YRDFPTGPRGLSVGASMIAHC-AGPERYFGLLALIMEQQEKWMSSPNPLVELKKLAKLAG 137

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             ++  D CL  Q++   I    K  +E   ++STP   IGG +  G +         D 
Sbjct: 138 MGEDKVDDCLKRQDLASAINERAKEGNEKLGVESTPSLIIGGKVTPGAIPYDEL----DK 193

Query: 225 MIQDSTR 231
           +++ +++
Sbjct: 194 LLKAASK 200


>gi|38233011|ref|NP_938778.1| hypothetical protein DIP0397 [Corynebacterium diphtheriae NCTC
           13129]
 gi|38199270|emb|CAE48901.1| Putative secreted protein [Corynebacterium diphtheriae]
          Length = 289

 Score =  107 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/266 (16%), Positives = 85/266 (31%), Gaps = 44/266 (16%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPI-----PDGVVDFRALLAASPS--------- 53
           I +L  +VL+ +A   +     SA  +        P G         A+P          
Sbjct: 13  IAILAIVVLIVVAGGAYMLGNKSAGTQAEKTATDLPPGFSGKAGSANATPGTKGLDGPTP 72

Query: 54  ------------------------------TMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                                              ++G  DAP+ + E++   C  CA +
Sbjct: 73  LADGSFDATIFGPAKELKSADDILNVHRRNAKDPFAVGAVDAPLVITEFSDFECPFCARW 132

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
            N+T   L ++Y+  G +R    + P++    +A   A  A            +L    +
Sbjct: 133 SNQTEPTLMEEYVSKGLVRIEWNDLPVNGEHALAAAKAGRAAAAQGKFDEFRKALFEASR 192

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
           +   +  N        A+ AG    +  +     +  D++       +    +  TP F 
Sbjct: 193 NVSGHPNNTLKDFERFARNAGVKDMERFSREAQDSTYDEVLTKAADYAHGLGVSGTPAFV 252

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +G     G      F K+I+S ++ S
Sbjct: 253 VGTQYISGAQPTEEFIKVIESELKKS 278


>gi|159037284|ref|YP_001536537.1| Na+/H+ antiporter NhaA [Salinispora arenicola CNS-205]
 gi|189029143|sp|A8LVS8|NHAA1_SALAI RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|157916119|gb|ABV97546.1| Na+/H+ antiporter NhaA [Salinispora arenicola CNS-205]
          Length = 652

 Score =  107 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/227 (18%), Positives = 69/227 (30%), Gaps = 11/227 (4%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKG--SALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
            +IG+L   V   + ++  +                GV +    L       +D   G +
Sbjct: 409 AKIGILVATVGASLTTWLVFRLAARLPPARRARALLGVSEGIIDLMVPVDPDRDHVRGPR 468

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +APVT+VEY    C +C +      +        T            D      V     
Sbjct: 469 EAPVTVVEYGDFECPYCGQAEPAVREL---LTDFTNIRYVWRHLPLTDVHPYAQVAAEAA 525

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                 G +W    LL   Q +          LL  A+      + F   L D+     I
Sbjct: 526 EAAGDQGAFWEMHDLLLAHQGELRP-----ADLLGYAERLDLDLDRFREHLADRRGAVRI 580

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                  ++  ++  TP FF+ G  + G  +    S  + S    + 
Sbjct: 581 AEDVD-GADLSSVSGTPTFFVNGRRHHGSYNIEALSAAVTSAFAGTR 626


>gi|298251327|ref|ZP_06975130.1| DSBA oxidoreductase [Ktedonobacter racemifer DSM 44963]
 gi|297545919|gb|EFH79787.1| DSBA oxidoreductase [Ktedonobacter racemifer DSM 44963]
          Length = 179

 Score =  107 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 61/177 (34%), Gaps = 8/177 (4%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
             P + +D  +G + APVT+VEY    C +C   H    + L+    +   +        
Sbjct: 11  TPPVSKQDHVLGPESAPVTLVEYGDYECPYCGMAHLTVKEVLQLLGDQLRLVFRHFPLIQ 70

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           +   +  A   A  A  +    +W     LF  Q            L+  A      K+ 
Sbjct: 71  IHPHAERAAEAAEAAGAQG--KFWAMHDTLFEHQRALD-----DTHLVLYATALDLDKDR 123

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           F   L +    D +       +    ++ TP FFI G  Y G          I++++
Sbjct: 124 FVRELAEHKYADRVIKDLLSGA-RSGVNGTPTFFINGLRYEGVYDLQTLLAAINAVV 179


>gi|88607835|ref|YP_504726.1| hypothetical protein APH_0098 [Anaplasma phagocytophilum HZ]
 gi|88598898|gb|ABD44368.1| conserved hypothetical protein [Anaplasma phagocytophilum HZ]
          Length = 227

 Score =  107 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 61/222 (27%), Positives = 95/222 (42%), Gaps = 3/222 (1%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M   R+ +    VL+        T   +   +L      V+  A          D  +G 
Sbjct: 1   MGFLRLCLGIFAVLVVFVCSVSSTMLEAKGGDLLSGGEAVELTAQQLLMRLPE-DRYLGN 59

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           +DAPV MVEYAS +C HCA+F  K F  ++ +YI TG+L YI R+               
Sbjct: 60  EDAPVVMVEYASFSCAHCADFITKVFPRIKKEYIDTGRLLYIYRD--FPLDRLSLSAAML 117

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            +  + +  ++ +V  +F   D  I +      L+N+AK +  S  DF  C  D+ ++D 
Sbjct: 118 GSCYKDNTAFFSYVRAVFGSYDTLIATYKDLGLLVNIAKISNISDEDFKRCTTDEELMDR 177

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           +   K  A     +++TP FFI G  Y G       +  ID 
Sbjct: 178 VVQQKFLAVNTLDVNATPSFFINGERYSGGHDFDSIAAEIDR 219


>gi|161528147|ref|YP_001581973.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339448|gb|ABX12535.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 220

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/200 (19%), Positives = 71/200 (35%), Gaps = 5/200 (2%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
           +L+  P     +D         + M    +G  +AP+T+VE+    C  C  + + T   
Sbjct: 22  SLSATPAETVNLDMTRTHGTISTAMGSPILGDPNAPITIVEFGDYQCHQCYNWFHNTKPT 81

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +   YI TGK   +  +       +     A    +     +     L   ++       
Sbjct: 82  ITRDYIDTGKANLVFVDMAFLGRDSSPAAQATYCAEDQGMYWEYHDMLYNAQESKIDGGW 141

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG---- 206
              + L   A   G     F++CL+       ++   ++A  D  +  TP FFI G    
Sbjct: 142 ANNERLKAFAFSMGLDMELFESCLDSGKYSKRVQYNTQQA-RDHNVRGTPGFFIVGPDGQ 200

Query: 207 NLYLGDMSEGVFSKIIDSMI 226
               G     VF +++D M+
Sbjct: 201 QQIGGAQPFSVFKQVLDPMV 220


>gi|323136739|ref|ZP_08071820.1| DSBA oxidoreductase [Methylocystis sp. ATCC 49242]
 gi|322398056|gb|EFY00577.1| DSBA oxidoreductase [Methylocystis sp. ATCC 49242]
          Length = 274

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 75/173 (43%), Positives = 107/173 (61%), Gaps = 4/173 (2%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P+ + DV  G  DAPVT+VEYASMTC HCA FH++ +  L+  YI TGK+++ILREFPLD
Sbjct: 100 PNALPDVVEGGADAPVTIVEYASMTCSHCAAFHHEVYPALKKNYIDTGKVKFILREFPLD 159

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            ++T A MLAR     +       V LLF++Q +W  +    D L N+ K AG  +  F+
Sbjct: 160 PLATAAFMLAR----ELGDKRDAAVDLLFSQQKNWAFTDKPLDGLANVLKQAGLGQEKFE 215

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             L DQ + + +   ++R SE F ++STP FF+ G+ Y G++S   F KII +
Sbjct: 216 AILKDQALYEKVNKVRERGSEKFGVNSTPTFFVNGDKYTGEISVADFDKIIAA 268


>gi|319647757|ref|ZP_08001975.1| BdbD protein [Bacillus sp. BT1B_CT2]
 gi|317390098|gb|EFV70907.1| BdbD protein [Bacillus sp. BT1B_CT2]
          Length = 223

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/228 (13%), Positives = 67/228 (29%), Gaps = 19/228 (8%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           +  V+  +V++F+          +                     PST     +G KDA 
Sbjct: 2   KFAVIMTVVVVFLIGALVVINNQTQNAS-----------QTFDDKPSTEGQPLLGNKDAA 50

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV-------STVAVM 119
           VT+ E+    C  C ++    F  L+  YI   ++ +    F  +         +  +  
Sbjct: 51  VTITEFGDYKCPSCKQWTETVFPDLKKDYIDKDQVNFSYINFVNEQHGRGSELSALASEQ 110

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
           + +         +        +                         ++   + LND+  
Sbjct: 111 VWKEDPDSFWKFHEALYKAQPDNDTMENEWATPAKLADITEANTKIKRDKLVSSLNDKTF 170

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            + +K         + +DSTP  F+ G             + I+  ++
Sbjct: 171 AEQLKTDNSL-INKYGVDSTPTIFVNGVKIDKPFDYDKIKETIEKELK 217


>gi|14548129|gb|AAK66786.1|U40238_6 periplasmic disulfide bond isomerase [uncultured crenarchaeote 4B7]
          Length = 223

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 88/230 (38%), Gaps = 12/230 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           + +T +I V    V+L  A    ++   S  + +            L   P       +G
Sbjct: 1   MANTKKIAVGVVAVILIAAVTISFSSYMSEFDNVQSSPQDEFETISLTQVP------ILG 54

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
            + A VT+VE     C  C  + + T + + + Y+ TGK   +  + P     +V     
Sbjct: 55  SQTATVTIVEIGDYQCPACKSWFDNTRQDIIENYVDTGKANLVFIDMPFIGADSV-SAAE 113

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                   G YW +   L+  Q    +     D L  +A   G     F+ C+N +    
Sbjct: 114 ATYCADDQGMYWDYHVKLYQFQQHENDGWANIDRLTAIAFDLGLDTEKFNECMNSKKYYS 173

Query: 182 DIKAGKKRASEDFAIDSTPVFFI-----GGNLYLGDMSEGVFSKIIDSMI 226
            +   K++AS DF  +STP F I       +  +G      F K++DSM+
Sbjct: 174 QVNLNKQKASTDFGANSTPTFVIVNSSGDIDRLIGPHPYATFEKVLDSML 223


>gi|52081839|ref|YP_080630.1| thiol-disulfide oxidoreductase [Bacillus licheniformis ATCC 14580]
 gi|52787228|ref|YP_093057.1| BdbD [Bacillus licheniformis ATCC 14580]
 gi|52005050|gb|AAU24992.1| thiol-disulfide oxidoreductase [Bacillus licheniformis ATCC 14580]
 gi|52349730|gb|AAU42364.1| BdbD [Bacillus licheniformis ATCC 14580]
          Length = 231

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/231 (13%), Positives = 68/231 (29%), Gaps = 19/231 (8%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S  +  V+  +V++F+          +                     PST     +G K
Sbjct: 7   SPMKFAVIMTVVVVFLIGALVVINNQTQNAS-----------QTFDDKPSTEGQPLLGNK 55

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV-------STV 116
           DA VT+ E+    C  C ++    F  L+  YI   ++ +    F  +         +  
Sbjct: 56  DAAVTITEFGDYKCPSCKQWTETVFPDLKKDYIDKDQVNFSYINFVNEQHGRGSELSALA 115

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           +  + +         +        +                         ++   + LND
Sbjct: 116 SEQVWKEDPDSFWKFHEALYKAQPDNDTMENEWATPAKLADITEANTKIKRDKLVSSLND 175

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           +   + +K         + +DSTP  F+ G             + I+  ++
Sbjct: 176 KTFAEQLKTDNSL-INKYGVDSTPTIFVNGVKIDKPFDYDKIKETIEKELK 225


>gi|163848707|ref|YP_001636751.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222526649|ref|YP_002571120.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
 gi|163669996|gb|ABY36362.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222450528|gb|ACM54794.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
          Length = 262

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 83/206 (40%), Gaps = 4/206 (1%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
                      P P        +     +     ++G  +APV M+E+    C  CA F 
Sbjct: 56  TVPPAPTELSRPTPTPAPPVDLVELLKLTDDDPRAMGDPNAPVLMIEFTDYECPFCARFV 115

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
           +++   +  ++++TG +R ++R+FPL S+   A++ A  A      G +  V  +  +  
Sbjct: 116 SESRPRIVREFVETGVVRLVVRDFPLTSIHPSALLAAGVAHCAAAQGQFWPVYEMLFQTH 175

Query: 145 DWIN---SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
           +          RD L+ +A   G        CL+D      I A  + A+    I+STP 
Sbjct: 176 NVEWGGVPNRDRDVLIELAGKLGVDTAQLRACLDDPATEATIIAEVETAT-RLGINSTPN 234

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           F I G +  G      F+ +I  + +
Sbjct: 235 FIINGRIVRGAFPFESFASLIRRLAE 260


>gi|304393525|ref|ZP_07375453.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Ahrensia sp. R2A130]
 gi|303294532|gb|EFL88904.1| twin-arginine translocation pathway signal sequence
           domain-containing protein [Ahrensia sp. R2A130]
          Length = 207

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 69/203 (33%), Positives = 100/203 (49%), Gaps = 4/203 (1%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
            F     +A     +P        L+   P  ++D  +GQ DAPVT+VEYASMTC HC  
Sbjct: 8   IFLASTAAAAVTFSLPAFAQSVEGLMNNIP--LEDKVMGQADAPVTIVEYASMTCPHCKT 65

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
           FH+     L+  YI+TGK +YILR FP D            A    +  Y+  V  LF  
Sbjct: 66  FHDTILPDLKKDYIETGKAKYILRPFPFDGDR-RGEAAFMLALCAPNDNYYAMVDALFAT 124

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           Q +W    N    LL ++K AG S+ DF  CL +Q++L  +  G+ +A ++F + +TP  
Sbjct: 125 QKNWGGQGNPVPELLRISKLAGMSEADFKACLGNQDLLTKMVQGRNKAVKEFGVRATPTV 184

Query: 203 FIGGNLYLGDMSEGVFSKIIDSM 225
           FI G    G+ S     + I++ 
Sbjct: 185 FINGEKV-GEPSLANLKEAIEAA 206


>gi|114769699|ref|ZP_01447309.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [alpha proteobacterium HTCC2255]
 gi|114549404|gb|EAU52286.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [alpha proteobacterium HTCC2255]
          Length = 205

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 86/192 (44%), Gaps = 1/192 (0%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
                    F    A +P  + D+ +G  DAPVT++EYAS TC HCA FH   F  L   
Sbjct: 14  ALSASATRSFADNTATNPINIPDMEMGSNDAPVTIIEYASFTCPHCASFHKNVFPSLRKN 73

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           YI TGK+++I RE   D     A +LARC + +   G    +     +            
Sbjct: 74  YIDTGKVKFIYREVYFDGPGLWAALLARCGDTKKYFGISDLLYSKQREWTKGDGGAAIAQ 133

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
            L  + + AG  ++  + CL ++++   + A  +  ++   + STP   + G    G+MS
Sbjct: 134 NLYKIGRIAGLDQSTMEACLQNKDVATAMVARFQETTKADNVSSTPSLILNGKNI-GNMS 192

Query: 215 EGVFSKIIDSMI 226
               + +ID  +
Sbjct: 193 FTDLAALIDEAM 204


>gi|148655441|ref|YP_001275646.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
 gi|148567551|gb|ABQ89696.1| DSBA oxidoreductase [Roseiflexus sp. RS-1]
          Length = 254

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/191 (23%), Positives = 78/191 (40%), Gaps = 3/191 (1%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           + P+P    +  +L     +      +G  DAPVT++E++   C  CA    +T   + +
Sbjct: 65  DAPVPASSGELASLERGR-TPEGYHYLGNPDAPVTILEFSDFLCTACAFHVEETEPKIIE 123

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
            Y+ +GK R + R        +              G +W     ++  Q     + ++ 
Sbjct: 124 TYVASGKARIVYRHLLQLGEES-LRAAEAAECAGDQGKFWEMRDAIYRNQVALYTTGDFD 182

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
            AL  +A+      N++  C+  +     I+A   RA++D  I S PVF I G   +G  
Sbjct: 183 AALAYLAQTVDLDSNEYSVCMQSRTHRARIEADF-RAAQDAGIRSRPVFDINGQRLVGAR 241

Query: 214 SEGVFSKIIDS 224
               F  IID+
Sbjct: 242 PFEDFQGIIDA 252


>gi|315498144|ref|YP_004086948.1| dsba oxidoreductase [Asticcacaulis excentricus CB 48]
 gi|315416156|gb|ADU12797.1| DSBA oxidoreductase [Asticcacaulis excentricus CB 48]
          Length = 211

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 61/224 (27%), Positives = 94/224 (41%), Gaps = 19/224 (8%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR  ++ G ++   A                  D                 D+ +G+
Sbjct: 1   MHLTRHTLVRGALMAAAAFGTLALAACGGSKTDAGAD-----------------DMVLGK 43

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAP+T+VEYAS+TC HCA F+ K F  ++ KYI TGK++YI REF        A     
Sbjct: 44  ADAPITLVEYASVTCTHCAAFNEKVFPTVKAKYIDTGKVKYIYREFLTPPADVSA-AGVL 102

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A       Y+  +  +   Q +   + + +  L  +A  AG S   F  C+ND   L+ 
Sbjct: 103 VARCAGKDKYFEVIDAIMRSQKELFTTGDAKGILKRVANSAGLSDEAFAKCVNDPKGLER 162

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDM-SEGVFSKIIDSM 225
           I+   ++ ++   I  TP   I G  + GD  S   F+  +D  
Sbjct: 163 IQTNMEKYAKADNITGTPTLIINGQKFEGDYTSVEAFTAALDKA 206


>gi|239926954|ref|ZP_04683907.1| hypothetical protein SghaA1_01906 [Streptomyces ghanaensis ATCC
           14672]
 gi|291435302|ref|ZP_06574692.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
 gi|291338197|gb|EFE65153.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
          Length = 223

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 72/227 (31%), Gaps = 5/227 (2%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M      ++   VLL   +    +      ++     G     A  A             
Sbjct: 1   MKKLTKHLIVAAVLLAGFAAALGSYLLLRPDDGSGSGGPDVRPAARAMPVRESSHRLTDP 60

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            D+ +T+VE+    C  C  +     K    +     ++ ++ R FP+       +    
Sbjct: 61  ADSELTLVEFLDFECEACGAYFPVVEKL---REEYGDRVTFVARYFPMPGHRNGELAART 117

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                  G +    + LF  Q +W  S+ +  D     A+  G     FD  L D     
Sbjct: 118 AEAAARQGKFEEMYTKLFTTQKEWGESQEWKEDVFRGYAEGLGLDMKKFDADLADPETAG 177

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            ++  ++       +  TP FF+ G       S   F  +ID  + D
Sbjct: 178 RVQEDQRDGL-GLEVQGTPTFFLDGRKIPNPGSYEQFKALIDERLSD 223


>gi|85703950|ref|ZP_01035053.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseovarius sp. 217]
 gi|85671270|gb|EAQ26128.1| thiol:disulfide interchange protein, DsbA family protein
           [Roseovarius sp. 217]
          Length = 202

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 52/188 (27%), Positives = 79/188 (42%), Gaps = 2/188 (1%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                   A   S + ++++G +DA VT++EYAS TC HCA FH    K L+  YI T K
Sbjct: 17  GAAMAQEAAPDTSQIVEMTMGPEDAKVTIIEYASFTCPHCANFHKGPLKQLKADYIDTDK 76

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
           + ++ R+   D     A M+ARC       G    +     +           D L  + 
Sbjct: 77  VHFVYRDVYFDRFGLWASMVARCGGAEKFFGISDMIYEQQAE-WTKGEPAEIADNLRRIG 135

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
           K AG   +  + CLND      + A  +  +E   + STP   I    Y  +M+      
Sbjct: 136 KVAGLEPDALEACLNDNEKAKTLVAWYQENAEAHEVTSTPTLVINEQKYA-NMAYDELRA 194

Query: 221 IIDSMIQD 228
           IID  + +
Sbjct: 195 IIDEKLAE 202


>gi|161528337|ref|YP_001582163.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339638|gb|ABX12725.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 236

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 85/224 (37%), Gaps = 8/224 (3%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP-STMKDVSIGQKDAPVTM 69
           +  +VL+ +   F      S L   P P    +  A +            +G  +AP+T+
Sbjct: 13  ISAVVLVIVFLGFDGISNESELVMQPTPTIQPEGPARVTMETFLANGSPILGDSNAPITL 72

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           VE+    C  C  F + T   + + Y++TGK+R I +++ +    +              
Sbjct: 73  VEFGDYQCHFCNVFFHSTEGDILENYVETGKVRMIFKDYNIIGPDS-INASHGAHCANDQ 131

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
           G +W +  +L+N      N     + LL  A+  G   + +  C+ D+     I A  + 
Sbjct: 132 GMFWEYHDILYNNWTGENNGWASSENLLRFAQEIGLDVDTWSECMIDRIHSKTIVASNED 191

Query: 190 ASEDFAIDSTPVFFI---GGNL--YLGDMSEGVFSKIIDSMIQD 228
           A     +  TP FF+    G +    G      F    DS ++ 
Sbjct: 192 A-RSLELTGTPAFFVIGPDGEVTSLFGAKPYSTFQMTFDSELEK 234


>gi|220927385|ref|YP_002502687.1| DsbA oxidoreductase [Methylobacterium nodulans ORS 2060]
 gi|219951992|gb|ACL62384.1| DsbA oxidoreductase [Methylobacterium nodulans ORS 2060]
          Length = 214

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 75/222 (33%), Positives = 109/222 (49%), Gaps = 11/222 (4%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR   L        A+         +L + P  D ++         P  + DV +G  D
Sbjct: 2   ITRRDALTLTGSALGAAVLLPGLSLRSLAQSPSVDALL--------QPGPLGDVWLGPAD 53

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A  T++EYASMTC HCA FH  T+  L++++I T K+R+ LREFPLD    +A      A
Sbjct: 54  AKCTIIEYASMTCSHCAAFHKTTWPALKERWIDTNKVRFTLREFPLD---PLATAAFMLA 110

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                  Y+    LLF++Q  W   +   DAL  M + AGFS+  F+  L DQ + D I 
Sbjct: 111 RADNSARYYPITDLLFDQQPAWAFVQKPLDALEQMMRQAGFSREKFEATLKDQKLYDGIN 170

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           A K+R    F + +TP FFI G  + G++S     K+I  ++
Sbjct: 171 AVKERGMNVFKVSATPTFFINGQKFQGELSIEGMEKVIKPIV 212


>gi|320450878|ref|YP_004202974.1| thiol:disulfide interchange protein DsbA [Thermus scotoductus
           SA-01]
 gi|320151047|gb|ADW22425.1| thiol:disulfide interchange protein DsbA [Thermus scotoductus
           SA-01]
          Length = 203

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 82/220 (37%), Gaps = 19/220 (8%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEY 72
            + L  +   +                            P+     ++G  +APV +V++
Sbjct: 1   MVALALLGLGWILWGPKGKAG----------------LDPAQGARFALGDPNAPVVVVDF 44

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGY 132
           ++  C HC          L+ +YI TGK+RY+ R+FP    + V       A     G Y
Sbjct: 45  SNYLCPHCQNHALNVLPRLKAEYIDTGKVRYLFRDFPFPGQANVIRASEAAACAADQGRY 104

Query: 133 WGFVS--LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
           + +       +     +        L+++A   G  +N F  CL+     + + A +K A
Sbjct: 105 YEYHEVLFRASSSWANLQGSVLDRYLVDLAGQMGLDENTFSQCLSSNKHREGVLADQKLA 164

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           S+   +  TP FFI G    G +    +  ++D  + +  
Sbjct: 165 SD-LGLTGTPTFFIAGEKRTGFLPYEEWKTLLDKALAEKK 203


>gi|162451230|ref|YP_001613597.1| putative secreted protein [Sorangium cellulosum 'So ce 56']
 gi|161161812|emb|CAN93117.1| putative secreted protein [Sorangium cellulosum 'So ce 56']
          Length = 675

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 63/209 (30%), Gaps = 6/209 (2%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
            Y     +  A                           + G   A VT+VE++   C  C
Sbjct: 238 VYAKLAAENKAKAPPQKDRERPQEDDKTVWKVPVGDAPAKGPATALVTIVEWSDFQCPFC 297

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
           ++      + L     K   +               A +      ++ + G+W    LL+
Sbjct: 298 SKVVPTIDEILTTYGDKVRFVWKNNPLPFHQRAEPAAELAMEARAQKGEKGFWDAYYLLW 357

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
             Q          + LL  AK  G         +  +     I A ++ A +D     TP
Sbjct: 358 KNQQKLN-----DEDLLGYAKELGLDVEKVKAAIATKKFGASIAADQELA-DDLQASGTP 411

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            FFI G   +G      F  IID  I+ S
Sbjct: 412 HFFINGRRLVGAQPIDKFKTIIDEEIKKS 440



 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 60/210 (28%), Gaps = 3/210 (1%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
           A             E+               S         G + A V M  ++   C  
Sbjct: 442 ALLAKGVAAKDLYAEIIKDGKEPPPPERKEVSAPAPNSPWKGGERAKVVMQVFSDFECPF 501

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           C    +   +  +    K   +          +    +        ++ + G+W +  +L
Sbjct: 502 CKRVEDTVSQISKTYGDKLKIVWRHRPLPMHKNAPLASEAAQEAYTQKGNAGFWAYHEVL 561

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F  Q         R +L   A+  G     F   L+       + +    A +   I  T
Sbjct: 562 FKNQGQPD--AFSRASLEKYAEEQGLDMTKFKKALDANTHKAFVDSENSVADKA-GISGT 618

Query: 200 PVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           P F + G    G      F K+ID  ++++
Sbjct: 619 PAFVVNGYFISGAQPFSKFKKLIDKAMKEA 648



 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 71/223 (31%), Gaps = 12/223 (5%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNE-----LPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
           + G +L FIA          +          + +    +    AA P + KD   G + A
Sbjct: 7   IVGFLLCFIAGMGLMWSIDRSAGSRGHEISAVHEDGQPWTDEDAAVPVSSKDPMWGTRAA 66

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD-SVSTVAVMLARCA 124
           PVTMV ++   C  C +      +  +    +  ++ +     P   +    A+      
Sbjct: 67  PVTMVVFSDFECPFCTKVETTINQLKDKYGPEKLRIIWKNNPLPFHKNARPAALAAETVF 126

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                  +W F  L F  Q          +     A  AG  +  F    + Q  +  I 
Sbjct: 127 RLGGSKAFWKFHELAFQNQKSLTP-----ENFEKWAGDAGVDRAKFKAAFDRQEYMAKID 181

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           A      +   +  TP   I G    G      F+ +ID  ++
Sbjct: 182 ADMAVG-KSSGVTGTPASIINGVFLSGAQPIDKFTSVIDEQLK 223


>gi|57239468|ref|YP_180604.1| hypothetical protein Erum7420 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579446|ref|YP_197658.1| hypothetical protein ERWE_CDS_07820 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161547|emb|CAH58474.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418072|emb|CAI27276.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 241

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 63/228 (27%), Positives = 106/228 (46%), Gaps = 10/228 (4%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDG--------VVDFRALLAASPSTMKDV 58
           +  ++G ++ + IA + F +   +  ++   P          + D  +          D 
Sbjct: 2   KFFIIGNLLCIMIAVFSFNSAFCTNASDQQNPHQFYSDTLVKISDDISAKELLTLLPNDR 61

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
            +G   APV ++EYAS +C HCA F    F  LE KYIK GKL YI R FPLD +     
Sbjct: 62  YLGNTKAPVVIIEYASFSCMHCAHFALNVFPVLEHKYIKEGKLLYIFRNFPLDYI--SLK 119

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                        ++ +   +F+  +  + +      L N+AK +  S+  F+ C+ND++
Sbjct: 120 AAMLGTCYDTANSFFTYNKAVFSSIEALVTNYRDLGVLSNIAKISNISEERFNKCVNDED 179

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           I++ I   K  A++   +++TPVFFI G  Y        FS+ I+ +I
Sbjct: 180 IMNYIIQEKFIANKKLQVNATPVFFINGKKYDKAHDVESFSEAINELI 227


>gi|163794972|ref|ZP_02188941.1| hypothetical protein BAL199_08853 [alpha proteobacterium BAL199]
 gi|159179791|gb|EDP64318.1| hypothetical protein BAL199_08853 [alpha proteobacterium BAL199]
          Length = 176

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 87/174 (50%), Gaps = 3/174 (1%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           + +K    G  +A +TM+EY+S+TC HCA FH +T   + + YI TGKL+  +R+FPLD 
Sbjct: 5   AALKPRVEGDPNAKLTMIEYSSLTCPHCATFHKETLPQIRETYINTGKLKLEMRDFPLDQ 64

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            +  A      A    D  Y+  + +LF +Q  W  + +   A+  + + AG S    D 
Sbjct: 65  YALRAAA---MARCAPDSRYFPLMDMLFAQQSKWTRATDPVGAIKQIGRLAGISAEQADA 121

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           C+ D+ ++D I   +     D  + STP F IG    +G      F K ID  +
Sbjct: 122 CMTDEKLMDGILQFRLAGQTDHDVSSTPTFVIGDQKVVGAQPFEAFQKAIDPQL 175


>gi|58617500|ref|YP_196699.1| hypothetical protein ERGA_CDS_07730 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417112|emb|CAI28225.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 241

 Score =  105 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 63/228 (27%), Positives = 106/228 (46%), Gaps = 10/228 (4%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDG--------VVDFRALLAASPSTMKDV 58
           +  ++G ++ + IA + F +   +  ++   P          + D  +          D 
Sbjct: 2   KFFIIGNLLCIMIAVFSFNSAFCTNASDQQNPHQFYSDTLVKISDDISAKELLTLLPNDR 61

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
            +G   APV ++EYAS +C HCA F    F  LE KYIK GKL YI R FPLD +     
Sbjct: 62  YLGNTKAPVVIIEYASFSCMHCAHFALNVFPVLEHKYIKEGKLLYIFRNFPLDYI--SLK 119

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                        ++ +   +F+  +  + +      L N+AK +  S+  F+ C+ND++
Sbjct: 120 AAMLGTCYDTASSFFTYNKAVFSSIEALVTNYRDLGVLSNIAKISNISEERFNKCVNDED 179

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           I++ I   K  A++   +++TPVFFI G  Y        FS+ I+ +I
Sbjct: 180 IMNYIIQEKFIANKKLQVNATPVFFINGKKYDKAHDVESFSEAINELI 227


>gi|295687794|ref|YP_003591487.1| DSBA oxidoreductase [Caulobacter segnis ATCC 21756]
 gi|295429697|gb|ADG08869.1| DSBA oxidoreductase [Caulobacter segnis ATCC 21756]
          Length = 205

 Score =  105 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/182 (25%), Positives = 80/182 (43%), Gaps = 5/182 (2%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
             +   T  D++ G  +A VT+VEYAS +C HCA+++ + +   + KYI TGK+ Y+ RE
Sbjct: 23  PKSETVTADDMTQGNPNAKVTVVEYASASCSHCAQWNEEVYPAFKAKYIDTGKVNYVYRE 82

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
                    A              Y+  V  ++  Q     +  +R+ LL +A+ AG S+
Sbjct: 83  ILTPPNEVAAAAFLMARC-AGKDKYFQVVDSVYRAQHQMFQTGQFREGLLTVAQSAGMSE 141

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY----LGDMSEGVFSKIID 223
             F+ C+ D+  L  +    ++ S++  I  TP F + G        G  +       I 
Sbjct: 142 EQFNACVTDEKGLKALNDRVQKYSKEAKIQGTPTFVVNGKKVGPEEGGARTLAELDAAIA 201

Query: 224 SM 225
             
Sbjct: 202 EA 203


>gi|120406500|ref|YP_956329.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
 gi|119959318|gb|ABM16323.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
          Length = 248

 Score =  105 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 80/233 (34%), Gaps = 16/233 (6%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS-------- 59
           +  +GG+++L +A   +       +++           A  + +P    D          
Sbjct: 13  LVFIGGLLILAVALIVYLVMGSEEVSDAASQPMSPQVSAPESNAPGGQVDAVTALSVERR 72

Query: 60  -------IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
                   G   APV MV +A   C  CA+F   T   L ++++  G LR   R+ P+  
Sbjct: 73  TTGDPLAQGDPAAPVVMVMFADYRCPFCAKFSRDTEPDLVERFVDQGVLRLEWRDMPIFG 132

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             +              G +W F   +F    D  ++    DAL+  A+ AG    D   
Sbjct: 133 EQS-MRAARAGRAAAEQGKFWEFNHEVFAMSPDRGHADLNEDALVGFAEKAGVPDIDKFA 191

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
                N  D              + STP F I G   LG      F ++ID  
Sbjct: 192 ASMRGNEFDAAIDADLAQGSSIGVPSTPAFVINGEPVLGAQPTEEFVRVIDEA 244


>gi|120555923|ref|YP_960274.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
 gi|120325772|gb|ABM20087.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
          Length = 242

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 41/222 (18%), Positives = 80/222 (36%), Gaps = 5/222 (2%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I VL  ++ + + +  ++  K  A +   +P    +     A        VS+G +DAPV
Sbjct: 25  IIVLSLVIGVAVIAGLYFVTKPPAPSSEALPVAAPNADEFPA--IVDQYGVSVGNEDAPV 82

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            + E+A   C  CA F   + +  ++      K+R++  + PL                 
Sbjct: 83  VVREFADYQCPACARFAEASQRLKKEYVESG-KVRFVYFDLPLRQHQNAMPAALAARCAG 141

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
               YW     L+  Q DW  S +        A   G  +  F  C+  +   + ++   
Sbjct: 142 DQDQYWAMHDKLYGSQLDWSGSNDPTATFTRYANDLGLEERRFRRCMETELHREAVEQSL 201

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           + A +   + STP   +           G  S +++  +  +
Sbjct: 202 QVAVQ-LRVASTPTVMVDNIQLTRP-GWGQLSAVVERELAKA 241


>gi|157826464|ref|YP_001495528.1| protein-disulfide isomerase [Rickettsia bellii OSU 85-389]
 gi|157801768|gb|ABV78491.1| Protein-disulfide isomerase [Rickettsia bellii OSU 85-389]
          Length = 254

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 3/202 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                   +   + +           D+ +G KD+ + +VEY S TC HCA +H+  F  
Sbjct: 53  TPAVQEQIEQKPEVKTFKVTFKIDENDMVLGNKDSKIVVVEYFSPTCPHCAYYHSTIFPE 112

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           L+ KYI T K+ Y+ REF                 K     +  F  ++  +QD W  S 
Sbjct: 113 LKQKYIDTNKIAYVTREFIATKQDL--DASILARCKGDINSFMLFHDIILKQQDKWSVSN 170

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
            YR+ L ++ +  G +  ++  CL+D  I + + A     ++      TP FF+ G +  
Sbjct: 171 KYRELLTDIGQLGGVTPEEYKKCLSDDKITETLIANTNFITKAPKFIGTPSFFVNG-VQT 229

Query: 211 GDMSEGVFSKIIDSMIQDSTRR 232
            + S    S  ID  I++S  +
Sbjct: 230 ENYSINSISAAIDKAIEESKNK 251


>gi|229821995|ref|YP_002883521.1| Na+/H+ antiporter NhaA [Beutenbergia cavernae DSM 12333]
 gi|229567908|gb|ACQ81759.1| Na+/H+ antiporter NhaA [Beutenbergia cavernae DSM 12333]
          Length = 630

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 72/221 (32%), Gaps = 15/221 (6%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           V +  R+GVL G VL F+ +   +      +++   P G    R      P   +D   G
Sbjct: 411 VQNEARVGVLSGSVLAFVIATVIF-----RVSDRIRPPGESARRLARPIDP--ERDHIFG 463

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             DAP T+VEY    C  C +      +   +   +   +            +  A   +
Sbjct: 464 ALDAPFTIVEYGDFQCGFCLKASGSIQEVHRELGDRLRYVWRHAPLTRYHPNALAAAEAS 523

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
             A ++     +        +    ++     + L       G     F+  L    +  
Sbjct: 524 EAAARQGKFFEFERSLFADQEHQLPVDIIRRAEEL-------GLDVEQFEADLTSPEVTA 576

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            ++     A E   I + P  F+ G L++G        + +
Sbjct: 577 RVQDDMLDA-EAMDITAVPTLFVNGRLHVGPYDAQSLIREL 616


>gi|310817208|ref|YP_003965172.1| periplasmic thiol-disulfide interchange protein [Ketogulonicigenium
           vulgare Y25]
 gi|308755943|gb|ADO43872.1| periplasmic thiol-disulfide interchange protein [Ketogulonicigenium
           vulgare Y25]
          Length = 215

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 87/177 (49%), Gaps = 6/177 (3%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           ++++G +DAP+T +EYAS TC HCA FHN  ++ L++ YI TGK+R++ RE   D     
Sbjct: 42  EMAVGAEDAPITFIEYASFTCPHCANFHNNQYQQLKENYIDTGKVRFVFREVYFDRFGLW 101

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDW---INSKNYRDALLNMAKFAGFSKNDFDTC 173
                       +  ++G   LL+  Q  W    +     + L  + + AG S    D C
Sbjct: 102 --ASMIARCGDNNTRFFGINDLLYENQQGWIGSGDPAEIANNLRAIGREAGMSDAAIDAC 159

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           + DQ + + +       +E   + +TP  FI G  Y G+MS    + I+D+ +  + 
Sbjct: 160 MADQALAEGLVGWFTENAERDNVTATPTLFINGQQY-GNMSYENLAAILDAELAKAQ 215


>gi|167044022|gb|ABZ08708.1| putative DSBA-like thioredoxin domain protein [uncultured marine
           crenarchaeote HF4000_APKG3K8]
          Length = 224

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 93/233 (39%), Gaps = 20/233 (8%)

Query: 5   TTRIGVLG----GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
             R  ++     GIV++ IA +  Y         +P+           +         ++
Sbjct: 1   MNRNIIVAAAFFGIVIIVIAGFSSYYFSLLEAQNMPM-------IKPTSMINLENGSPAL 53

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G + AP+T+VE+    C  C  + + T   L D YI+TGK + +  + P     +     
Sbjct: 54  GSESAPITIVEFGDYQCESCYYWFHNTRSTLIDNYIETGKAKLVFVDLPFLGRDS-ITAA 112

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY--RDALLNMAKFAGFSKNDFDTCLNDQN 178
                      YW + ++L+  Q+       +  RD+L + A     + ++F+ C++   
Sbjct: 113 QASYCAEDQEKYWEYHTILYTFQEIEGYDSGWAGRDSLNSFASTLDMNMDEFNDCMDSSK 172

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFI---GG--NLYLGDMSEGVFSKIIDSMI 226
               +KA    A ++  + STP F I    G    + G     VF+  I+SM+
Sbjct: 173 YKIRVKANYNEAVKN-GVQSTPTFIIISSDGTTKKFAGAQPYSVFAATIESML 224


>gi|149922960|ref|ZP_01911380.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149816211|gb|EDM75718.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 545

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 77/227 (33%), Gaps = 19/227 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +  + G V   IA Y+          + P PDG   +R  L        +   G  DA V
Sbjct: 94  LVFVLGFVATLIAGYYVGQWARLKFGDKPQPDGGDRYRVELRGD-----EPQKGPDDALV 148

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T++E+A   C +C                  G +R I + +PL      A          
Sbjct: 149 TIIEFADFQCPYC---EQSVEPLAAAMDSYEGDVRLIFKHYPLPGHRLAAPAAYTSWAAH 205

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
             G +W F   LF  +    ++ ++   L       G     F   +   +    +    
Sbjct: 206 QQGEFWIFHDRLFAAKSAIDDTPDWIKEL-------GLDAEKFGRDMESLDARSAVDEDM 258

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI---QDSTR 231
               +   +  TP F + G++Y G   E  + KII + +   ++  +
Sbjct: 259 AAGGK-VGVTGTPAFLVNGHMYRGKRDELGWKKIIAAELDYAEEIKK 304



 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 66/205 (32%), Gaps = 10/205 (4%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
                     P      +   +   +       + G  DA VT+VE+A   C +C     
Sbjct: 325 QVGAPERKAAPKKRRPGEPDDVSVYAVPITGAPAKGPADALVTVVEFADYHCPYCVRVKT 384

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
              K  E        +R + R+ PL                   G +W     LF  Q  
Sbjct: 385 AVDKLAETY---PNDVRVVYRQRPLAMHPNARDASRAALAAHQQGKFWEMHDKLFLHQAQ 441

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            +      D    +A   G     F T  + + +   +++  + A + F I  TP FF+ 
Sbjct: 442 TL------DEFEKLAAELGLDVEKFVTDYDGEAVAAALQSDLEVA-QRFGISGTPAFFVN 494

Query: 206 GNLYLGDMSEGVFSKIIDSMIQDST 230
           G    G  S  VF ++ +    ++ 
Sbjct: 495 GRYLSGAQSFAVFEQVFEERRAEAK 519


>gi|328555055|gb|AEB25547.1| BdbD [Bacillus amyloliquefaciens TA208]
          Length = 223

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 77/230 (33%), Gaps = 15/230 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S+ +  V+  ++++ + +        S                 +A  PS      +G+ 
Sbjct: 6   SSAKFAVILTLIVVVLFAAIVIINNQSEKA-----------GETVAEQPSIKGQPVLGKD 54

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            APVT+VE+    C  C  F++  F  ++  +I  G +++           +    LA  
Sbjct: 55  SAPVTVVEFGDYKCPSCKVFNSDIFPKIKKDFIDKGDVKFSFVNVMFHGSGSRLAALASE 114

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND---QNIL 180
              + D   +        +Q      +    ALL     +   K D D    +   +   
Sbjct: 115 EVWKEDPASFWAFHEKLFEQQPSSEQEWVTPALLEKTVKSTAKKVDPDKLKENLDKETFS 174

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            ++KA      +   I +TP  ++   L          SK I   +++  
Sbjct: 175 KELKADTDLN-DKLNITATPTIYVNDKLIKNFSDYKEISKTIKKELKNEK 223


>gi|163867896|ref|YP_001609100.1| hypothetical protein Btr_0671 [Bartonella tribocorum CIP 105476]
 gi|161017547|emb|CAK01105.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 218

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 104/204 (50%), Gaps = 6/204 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                  AL     P   VD   LL      +KD   G+ DAPV +VEYAS+TC HCA F
Sbjct: 20  VQNSVAVALARGIKPVATVDMAELL--QSGKVKDRVEGEADAPVIIVEYASLTCTHCAHF 77

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
           +N     +  KYIKTGK++ I R++  D     A      A    +  Y+  + +LF KQ
Sbjct: 78  YNDILPQIRKKYIKTGKVKMIFRDYAFD---PRATAGFMLARCAPEDRYFPLIEVLFQKQ 134

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
           ++W+  K+    L  ++  AGF+   F  CL +Q ILD++ A  +R  ++  + +TP FF
Sbjct: 135 NEWVWGKDALTPLKKISLMAGFTDESFTACLKNQTILDEVNASFERG-KELGVSATPTFF 193

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQ 227
           I G+ Y G M    F  +IDS ++
Sbjct: 194 INGDKYEGAMKVEEFFSLIDSYLK 217


>gi|91206103|ref|YP_538458.1| protein-disulfide isomerase [Rickettsia bellii RML369-C]
 gi|117940092|sp|Q1RGZ5|DSB_RICBR RecName: Full=Putative protein-disulfide oxidoreductase RBE_1288;
           Flags: Precursor
 gi|91069647|gb|ABE05369.1| Protein-disulfide isomerase [Rickettsia bellii RML369-C]
          Length = 259

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 3/202 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                   +   + +           D+ +G KD+ + +VEY S TC HCA +H+  F  
Sbjct: 58  TPAVQEQIEQKPEVKTFKVTFKIDENDMVLGNKDSKIVVVEYFSPTCPHCAYYHSTIFPE 117

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           L+ KYI T K+ Y+ REF                 K     +  F  ++  +QD W  S 
Sbjct: 118 LKQKYIDTNKIAYVTREFIATKQDL--DASILARCKGDINSFMLFHDIILKQQDKWSVSN 175

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
            YR+ L ++ +  G +  ++  CL+D  I + + A     ++      TP FF+ G +  
Sbjct: 176 KYRELLTDIGQLGGVTPEEYKKCLSDDKITETLIANTNFITKAPKFIGTPSFFVNG-VQT 234

Query: 211 GDMSEGVFSKIIDSMIQDSTRR 232
            + S    S  ID  I++S  +
Sbjct: 235 ENYSINSISAAIDKAIEESKNK 256


>gi|167043690|gb|ABZ08383.1| putative DSBA-like thioredoxin domain protein [uncultured marine
           crenarchaeote HF4000_APKG2O16]
          Length = 284

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 89/230 (38%), Gaps = 11/230 (4%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS----TMKDVSIGQ 62
            +G+  GI +  I          +  +   + +  ++                    +G 
Sbjct: 57  SLGIGAGIAIACIFCGVLLVNMINTESTQVLDEITINEIITTKKPTIASFYDNASPILGD 116

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            +AP+TM+E+    C  C +F ++T + +   Y++TGK++ + ++F + +  +V    + 
Sbjct: 117 LNAPLTMIEFGDYQCTFCKKFFDETEESILTNYVETGKVKMLFKDFIVVNEDSV-NAASA 175

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                    +W + S L+N  D         + L   A   G   + F  C++     + 
Sbjct: 176 AHCANDQKMFWQYHSTLYNNWDGEGTGWASSEQLHQFASTLGLDMDKFSECMSKSKWKEL 235

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGN-----LYLGDMSEGVFSKIIDSMIQ 227
           + +          +D+TP FFI          +G     VF ++ DS+++
Sbjct: 236 VDSSHADG-RTLGVDATPTFFIIDQNNNVLKIIGAQRYDVFQEVFDSLLE 284


>gi|326333325|ref|ZP_08199572.1| DSBA thioredoxin domain protein [Nocardioidaceae bacterium Broad-1]
 gi|325948969|gb|EGD41062.1| DSBA thioredoxin domain protein [Nocardioidaceae bacterium Broad-1]
          Length = 249

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/204 (19%), Positives = 71/204 (34%), Gaps = 2/204 (0%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
               G+           +D              +++G  DAPV M+ Y+   C  C ++ 
Sbjct: 42  AAESGTGAAGAQAEGHALDDAWAQLVRGEEGDPMALGDVDAPVVMISYSEFQCPFCGKYA 101

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             T   L +KY+ +G +  I                         G +W F  L+++ Q 
Sbjct: 102 RDTEPILVEKYVDSG-VLRIEWRDFPYLGPESTTAAQAGRAAAAQGKFWEFSKLMYDNQL 160

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
              + K   D L+++A       N+F   +  +   D IK       +   +  TP F I
Sbjct: 161 PPNSGKLTEDYLVSIADDLDLDTNEFRKDMVARGTKDAIKQDLAEG-QAIGVTGTPAFII 219

Query: 205 GGNLYLGDMSEGVFSKIIDSMIQD 228
            G   +G     VF + I+   ++
Sbjct: 220 NGVPVIGAQPTEVFEQAIEKAAEE 243


>gi|209963843|ref|YP_002296758.1| protein-disulfide isomerase, putative [Rhodospirillum centenum SW]
 gi|209957309|gb|ACI97945.1| protein-disulfide isomerase, putative [Rhodospirillum centenum SW]
          Length = 227

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 57/229 (24%), Positives = 98/229 (42%), Gaps = 16/229 (6%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
           TR G LG + L             SAL + P      D             D  IG   A
Sbjct: 10  TRRGFLGALALAAGIVALPLLAGPSALAQQPASLPGFDLARATE-------DKVIGDPKA 62

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+T++EYAS+TC HCA  H      ++ ++I TG+ + I R+FP+D V+  A M    + 
Sbjct: 63  PITIIEYASLTCSHCAHMHTDILPRIKAEFIDTGQAKLIFRDFPMDQVALTASM---FSR 119

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
                 Y+  +S LF  Q  W  +K+    +   A+ AG +    + CL+++ +   I  
Sbjct: 120 CVAPERYFSMLSALFKSQKAWFAAKDPLAEVGKTARMAGLTPEQQEACLSNKQLETHILQ 179

Query: 186 GKKRASEDFAIDSTPVFFIGG--NLYLGDMSEGVFSKIIDSMIQDSTRR 232
            +    + + I  TP   +     +  G        ++I+++++   +R
Sbjct: 180 TRLDGIKKYNISGTPTLILNDGAVVIDGARE----EELINALVKLGAKR 224


>gi|254440062|ref|ZP_05053556.1| hypothetical protein OA307_4932 [Octadecabacter antarcticus 307]
 gi|198255508|gb|EDY79822.1| hypothetical protein OA307_4932 [Octadecabacter antarcticus 307]
          Length = 222

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 1/195 (0%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
            P           L A+   + ++  G  DA V ++EYAS TC HCA FH   +  ++  
Sbjct: 27  TPASAQSSGAAETLEAAQFDVVEMIQGNPDAAVQVLEYASFTCPHCASFHADQYPQIKAN 86

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           YI TG + +  RE   D+    A M+ARC  +    G    +           + ++   
Sbjct: 87  YIDTGLIGFTYREVYFDAPGLWASMIARCGGEMRFFGISNLLYENQQDWARGESGEDIIT 146

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           +L N+ K AG +  + D CL D+    ++    +  ++   +  TP F I G  Y  +M+
Sbjct: 147 SLRNIGKVAGLTDAELDVCLTDEAKAQELTGWYRFNADADDVQGTPTFLINGEKYS-NMN 205

Query: 215 EGVFSKIIDSMIQDS 229
              F+++++  + ++
Sbjct: 206 YADFAEVLEEKMAEA 220


>gi|313902960|ref|ZP_07836355.1| DSBA oxidoreductase [Thermaerobacter subterraneus DSM 13965]
 gi|313466684|gb|EFR62203.1| DSBA oxidoreductase [Thermaerobacter subterraneus DSM 13965]
          Length = 302

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/213 (18%), Positives = 74/213 (34%), Gaps = 5/213 (2%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
            +         A+          D +A  A      +  ++G   APVT+VE+A   C +
Sbjct: 67  LTLGTAAMIVLAVALAVAATRQADRQAAPADLFQLERQPALGSASAPVTVVEFADFKCPY 126

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML-ARCAEKRMDGGYWGFVSL 138
           C EF    F   ++ YI TGK+R+    +P     +            +   G W F+  
Sbjct: 127 CREFTLNEFPRFKEAYIDTGKVRFYFINYPFIGPDSDTAAQAMEAVYAQSPEGVWAFIDR 186

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD--TCLNDQNILDDIKAGKKRASEDFAI 196
           +   Q          + L+++A+ A    +       L       ++ A +  A     +
Sbjct: 187 VMQLQGPEDQQWATPEFLVDVARQAVPGIDAQRLLDDLRSGRYAGEVDADRAIAVRA-GV 245

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             TP  F+ G     + S       +D  + ++
Sbjct: 246 RGTPSVFVNGKFVE-NWSFEGLKAAVDQALAEA 277


>gi|226228008|ref|YP_002762114.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
 gi|226091199|dbj|BAH39644.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
          Length = 242

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 79/226 (34%), Gaps = 13/226 (5%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S T    +  +VL+   +  +   K S    + +  G    +A              G  
Sbjct: 10  SNTAFLAVILVVLVAGGAGIWTAMKNSKPTPIELAPGTPLPQAQ---------GYLYGDP 60

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLAR 122
           +AP+T++E+A   C  C +F       L  +    G   +   +FP              
Sbjct: 61  NAPITIIEFADFECPGCGQFATVQEPDLRKRVFDAGLANFRFYDFPLTSIHRNTLAAHLA 120

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINS--KNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
            +     G +W +  LLF  Q DW +    N R          G     F  C + Q  L
Sbjct: 121 ASCANEQGKFWEYHDLLFEGQYDWNSQAASNPRKIFDGYVTKLGLDAAKFGECYDSQRNL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             I+A     SE   ++STP   IG  +Y    +     +I+DS+ 
Sbjct: 181 AQIQANAAAGSER-GVNSTPTIIIGNKVYSPAPTADQLKQIVDSIR 225


>gi|145221502|ref|YP_001132180.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
 gi|145213988|gb|ABP43392.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
          Length = 234

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/230 (16%), Positives = 72/230 (31%), Gaps = 8/230 (3%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFR-ALLAASPSTMKDVSI 60
           +++ TR+ +   +++        +       +E  I            A          +
Sbjct: 9   ILTNTRVLLTAFVIVAATIGTAVFLSVRDTGSEPAIKGSEPPIELDGSAGQAVRENSHRL 68

Query: 61  GQ-KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
               D+PV  VE+    C  C   + +  +    +     ++ ++LR FPL         
Sbjct: 69  NAVLDSPVYFVEFLDFECEGCRAVYPEIEQL---RAEYGDRVNFVLRYFPLPGHFNAERA 125

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQN 178
                     G        +++ Q +W   +    D     A+  G   + FD   ND  
Sbjct: 126 ARAVEAAAQQGQLEAMYRKMYDTQAEWGEQQVPADDVFRGFAQQLGLDMSAFDATYNDPA 185

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            L+ I+      +    +  TP FF+ G       S    S  +D  +  
Sbjct: 186 TLERIQLDIADGT-ALGVQGTPTFFLNGERIQ-PRSYEDLSTALDQALAR 233


>gi|317124198|ref|YP_004098310.1| DSBA oxidoreductase [Intrasporangium calvum DSM 43043]
 gi|315588286|gb|ADU47583.1| DSBA oxidoreductase [Intrasporangium calvum DSM 43043]
          Length = 255

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/197 (23%), Positives = 76/197 (38%), Gaps = 3/197 (1%)

Query: 27  RKGSALNELPIPDGVVDFRALLAASPSTMKDVS-IGQKDAPVTMVEYASMTCFHCAEFHN 85
             G++       +      AL + +  T  D   +G++DAPV +V Y+   C  C +F  
Sbjct: 50  STGTSDTTAGSSEQDEQIAALASLARRTPGDPVALGKEDAPVVLVNYSEFQCPFCGKFAR 109

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
            T   L  +Y+  G LR   R+FP     +     A  A     G +W F   +F  Q  
Sbjct: 110 DTKPTLVKEYVDKGILRIEWRDFPYLGPESGTAAHAGRAAAEQ-GKFWEFHDAMFADQQP 168

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
             + K   D L  +A   G     F   L D  +   +        ++  +  TP F + 
Sbjct: 169 PNSGKLTEDYLAGVAARIGLDVAKFRKDLADPKLQAKVDQDFTEG-QNIGVTGTPAFLVN 227

Query: 206 GNLYLGDMSEGVFSKII 222
           GN  +G      F+++I
Sbjct: 228 GNPVIGAQPTETFTRLI 244


>gi|296330406|ref|ZP_06872886.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305675953|ref|YP_003867625.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296152409|gb|EFG93278.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305414197|gb|ADM39316.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 222

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 65/188 (34%), Gaps = 1/188 (0%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                  ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G 
Sbjct: 33  TEQGNEAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGD 92

Query: 101 LRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +++           +      +    K     +W F   LF KQ D          L ++
Sbjct: 93  VKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWAFHEKLFEKQPDTEQEWVTPAVLGDL 152

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           AK     K +      D+             ++   I +TP  ++   +    M      
Sbjct: 153 AKSTTKIKPETLKDNLDKETFASQVEKDSELNQKMNIQATPTIYVNDKVINKFMDYDEIK 212

Query: 220 KIIDSMIQ 227
           + I+  ++
Sbjct: 213 ETIEKELK 220


>gi|269956488|ref|YP_003326277.1| Na+/H+ antiporter NhaA [Xylanimonas cellulosilytica DSM 15894]
 gi|269305169|gb|ACZ30719.1| Na+/H+ antiporter NhaA [Xylanimonas cellulosilytica DSM 15894]
          Length = 600

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/218 (21%), Positives = 74/218 (33%), Gaps = 14/218 (6%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +GVL  +V+  +     +      L +             L+      +D   G  DA V
Sbjct: 385 VGVLLSVVIASVLGRVAFALAARYLGQRDA-----ALPTTLSRPVDPERDHLRGPADAEV 439

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T+VEY    C  CA     T    + +     +LRY++R  PLD      +         
Sbjct: 440 TLVEYLDFECPFCARA---TGAARQVREHFGDRLRYVVRNLPLDVHPHAELAALAAEAAG 496

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
               YW     LF   D+        + L   A   G     F   L + ++ D +   K
Sbjct: 497 RQDRYWEMHDTLFAHHDELEL-----EDLAGYAATLGLDVEQFLRDLQEDDLADHVAQDK 551

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + A E     STP FF+G   + G          +++ 
Sbjct: 552 ESAGES-GARSTPTFFVGERRHEGPWDAATLIAALEAE 588


>gi|294675785|ref|YP_003576400.1| DSBA family oxidoreductase [Rhodobacter capsulatus SB 1003]
 gi|294474605|gb|ADE83993.1| oxidoreductase, DSBA family [Rhodobacter capsulatus SB 1003]
          Length = 220

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 90/191 (47%), Gaps = 1/191 (0%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
              + ++   A  A   + + DV++G+ DAPVT++EYAS TC HCA FH   F  L+  Y
Sbjct: 29  APAETLIATPAEAAPGGTILPDVALGRADAPVTLIEYASFTCSHCARFHETVFGALKRDY 88

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           I TGK+R+ILRE   D     A  +A+C       G  G +                 + 
Sbjct: 89  IDTGKVRFILREVYFDKFGLWAGQVAQCGGDLKYYGIAGMLFSEQKSWIGDGTEPVIAEN 148

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           L  +   AG +K+  +TCLND    + +    ++ +   AI+ TP   I G  +  +M  
Sbjct: 149 LRKIGIKAGLTKDQIETCLNDTARAEAMVMTYQKNASADAIEGTPTLVINGEKHD-NMGY 207

Query: 216 GVFSKIIDSMI 226
               KI+D+ +
Sbjct: 208 AELKKILDAKL 218


>gi|25026869|ref|NP_736923.1| hypothetical protein CE0313 [Corynebacterium efficiens YS-314]
 gi|259506068|ref|ZP_05748970.1| protein-disulfide isomerase [Corynebacterium efficiens YS-314]
 gi|23492149|dbj|BAC17123.1| hypothetical protein [Corynebacterium efficiens YS-314]
 gi|259166356|gb|EEW50910.1| protein-disulfide isomerase [Corynebacterium efficiens YS-314]
          Length = 253

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 71/233 (30%), Gaps = 15/233 (6%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDV---------- 58
            V+  + +L I +     R   +        G     +    +     +           
Sbjct: 19  AVVITVAVLLIGTVLIINRGAGSAGSTESATGTPAVISGQEPTVYDPTEPDFTVVETRDE 78

Query: 59  ----SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
               ++G  DAPV +V ++   C +CA++  +T   + +                    S
Sbjct: 79  ADPLAVGPVDAPVGLVIFSDYQCPYCAKWSAETLPLMLEHAEAGDLRIEWRDLNLFGPAS 138

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
             A   A  A  +    Y  +   LF       +++   D L+ +A   G     F    
Sbjct: 139 ERASRAAYAAALQGGDAYLDYHHALFKDGTSRSDNELDDDQLIALAHTLGLDTEAFTADF 198

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                   + A  +       + STP F +GG   +G     VF    ++ + 
Sbjct: 199 TSPETAGTVAAHAQLGI-TLGVYSTPAFILGGQPIMGAQPSEVFVDAFETALA 250


>gi|319654019|ref|ZP_08008112.1| hypothetical protein HMPREF1013_04731 [Bacillus sp. 2_A_57_CT2]
 gi|317394341|gb|EFV75086.1| hypothetical protein HMPREF1013_04731 [Bacillus sp. 2_A_57_CT2]
          Length = 226

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 80/226 (35%), Gaps = 15/226 (6%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I ++  IV   IA+        S  N  P  +            PS      +G+ DAPV
Sbjct: 12  IMIITLIVFAMIAALVVINNMKSEQNVSPSFEEG----------PSIEGQPVLGKSDAPV 61

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV-AVMLARCAEK 126
           T+VE+    C  C  +    F  L + Y+ TGK+++           +    + A    K
Sbjct: 62  TVVEFGDFKCPACKAWGQNIFPKLVEDYVDTGKVKFSYINVLFHGDESKLGSVAAEAVYK 121

Query: 127 RMDGGYWGFVSLLFNKQDDWIN---SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           +    YW F   LF+ Q D  +              +   G   N  +  +  Q I+D++
Sbjct: 122 QNPDSYWDFNKALFDAQPDEDHDSLWITMEKIKEVASAIPGIDTNQLEKDIQSQEIIDEV 181

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                   E++ I  TP   + G +            +ID  ++D 
Sbjct: 182 NNDSAL-VEEYKIQQTPSIMVNGTMLEDPFDYEKIKSLIDQALEDK 226


>gi|254487515|ref|ZP_05100720.1| dsba oxidoreductase:tat pathway signal [Roseobacter sp. GAI101]
 gi|214044384|gb|EEB85022.1| dsba oxidoreductase:tat pathway signal [Roseobacter sp. GAI101]
          Length = 227

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 52/212 (24%), Positives = 85/212 (40%), Gaps = 4/212 (1%)

Query: 20  ASYFFYTRK---GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMT 76
             ++ ++      SA                     ST+K++ +G  ++ V ++EYAS T
Sbjct: 17  GGWYVFSGPDAVNSAQINPLASAANAQTTETADVDTSTIKEMKLGNAESAVQIIEYASFT 76

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C HCA F    +K L+ +YI T K+ +  RE   D     A M+ARC  +    G    +
Sbjct: 77  CPHCAAFDQGPYKQLKAEYIDTDKIGFTYREVFFDRYGLWASMVARCGGEEKFFGISDLI 136

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
               ++             L  + + AG   +  + CL D      + A  +   +   I
Sbjct: 137 YKGQSEWVRAGEPAAIVGELRKIGRLAGIDGDTLEACLQDSTKAQTLVAWWEENQKADDI 196

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            STP F I G  Y  +M      +IID+ + D
Sbjct: 197 TSTPSFIINGTKYS-NMPYAEMKEIIDAALAD 227


>gi|55980792|ref|YP_144089.1| hypothetical protein TTHA0823 [Thermus thermophilus HB8]
 gi|55772205|dbj|BAD70646.1| hypothetical membrane protein [Thermus thermophilus HB8]
          Length = 211

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/181 (23%), Positives = 81/181 (44%), Gaps = 3/181 (1%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P+     ++G++DAPV +V++++  C HC          L+ +YI TGK+RY+ R+FP 
Sbjct: 31  DPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPRLKAEYIDTGKVRYLFRDFPF 90

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVS--LLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
              + V       A     G Y+ +             +  +     L+++A   G  + 
Sbjct: 91  PGQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVDLAGQIGLEEG 150

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            F  CL      +++ A +K A++   +  TP FFI G  + G +    + +++D  +  
Sbjct: 151 AFAACLASGRHREEVLADQKLATD-LGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAK 209

Query: 229 S 229
           +
Sbjct: 210 A 210


>gi|197104046|ref|YP_002129423.1| probable disulfide isomerase [Phenylobacterium zucineum HLK1]
 gi|196477466|gb|ACG76994.1| probable disulfide isomerase [Phenylobacterium zucineum HLK1]
          Length = 205

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/178 (30%), Positives = 85/178 (47%), Gaps = 2/178 (1%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           A   ++ +D+++G  +APV +VEYAS+TC HCA F+  TF   + KYI TGK+ Y  +EF
Sbjct: 27  AGPTASAEDMTLGDANAPVKVVEYASVTCSHCAAFNETTFPQFKAKYIDTGKVHYTFKEF 86

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
                   A      A       Y+  +  LF  Q +   S + R  LL +A+ AG ++ 
Sbjct: 87  LTPPEQVAA-AGFLVARCAGKDKYFTVIDALFRSQQEMFQSGDMRGGLLRVAQSAGMTEA 145

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY-LGDMSEGVFSKIIDSM 225
            F+ C+ D+  L  +    ++A     I +TP F + G     GD++       I   
Sbjct: 146 QFNACIQDEAALKALNDRVEKAIRQDGISATPTFVVNGKKVKEGDITLAELDAAIAEA 203


>gi|46198779|ref|YP_004446.1| thiol:disulfide interchange protein dsbA [Thermus thermophilus
           HB27]
 gi|46196402|gb|AAS80819.1| thiol:disulfide interchange protein dsbA [Thermus thermophilus
           HB27]
          Length = 211

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/181 (23%), Positives = 81/181 (44%), Gaps = 3/181 (1%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P+     ++G++DAPV +V++++  C HC          L+ +YI TGK+RY+ R+FP 
Sbjct: 31  DPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPRLKAEYIDTGKVRYLFRDFPF 90

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVS--LLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
              + V       A     G Y+ +             +  +     L+++A   G  + 
Sbjct: 91  PGQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVDLAGQIGLDEG 150

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            F  CL      +++ A +K A++   +  TP FFI G  + G +    + +++D  +  
Sbjct: 151 AFAACLASGRHREEVLADQKLATD-LGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAK 209

Query: 229 S 229
           +
Sbjct: 210 A 210


>gi|126724764|ref|ZP_01740607.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Rhodobacterales bacterium HTCC2150]
 gi|126705928|gb|EBA05018.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family) [Rhodobacterales bacterium HTCC2150]
          Length = 220

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 55/198 (27%), Positives = 88/198 (44%), Gaps = 2/198 (1%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
           +            + ++      S ++D  +G  DAP+T++EYAS TC HC  FH   F+
Sbjct: 24  NQGQTELPGINAANAQSDTEIDTSIVEDKFLGDPDAPITVIEYASFTCPHCRRFHVDVFE 83

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            L+  YI+TGK+++I RE   D     A M+     K    G    +           + 
Sbjct: 84  KLKTNYIETGKVKFIYREVYFDRYGLWAGMV-ARCAKENYFGVADLIYQNQPTWTKGASE 142

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
                 L+N+ K AG  + +   CLND      + A  ++ ++   I STP F I G  Y
Sbjct: 143 TEIAGNLVNLGKVAGLGEEEISACLNDGTKAQAMVAVFQKNADVDEITSTPSFLIDGEKY 202

Query: 210 LGDMSEGVFSKIIDSMIQ 227
             +M+   FS I+D  ++
Sbjct: 203 S-NMNYADFSAILDKKLE 219


>gi|227487230|ref|ZP_03917546.1| dsba oxidoreductase [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227092888|gb|EEI28200.1| dsba oxidoreductase [Corynebacterium glucuronolyticum ATCC 51867]
          Length = 264

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/258 (15%), Positives = 80/258 (31%), Gaps = 38/258 (14%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS---------------- 53
           VLG I L+      +         + P         ++  ++ +                
Sbjct: 8   VLGAIALVAAVLIGYALGGSGKDKDAPPAPNPTTVSSVAPSTQAQAAVKIEPSGETGAFL 67

Query: 54  --------------------TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
                                    + G+ DAPV + E++   C  CA++ N+T+  +  
Sbjct: 68  WGPGKTIATSEDITHVHRRMANDPFATGKVDAPVVISEFSDFECPFCAKYANETYPQVLK 127

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY- 152
            Y+  G +R    +  ++    V    A  A       +    +L    +D   + +N  
Sbjct: 128 DYVDKGLVRVEWNDMAVNGPDAVKAAEAGRAAAAQGKFHEFHNALYTASKDVQGHPENDI 187

Query: 153 RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
            D +    +      + F + +        + +  K  +    I  TP F IG     G 
Sbjct: 188 EDFVRFATEAGVPDLDRFRSEVESGTYTQAVTSATKYGAS-IGISGTPSFIIGDQFVSGA 246

Query: 213 MSEGVFSKIIDSMIQDST 230
               VF K I+  +Q + 
Sbjct: 247 QPYEVFQKAIEEQLQKNK 264


>gi|296531857|ref|ZP_06894662.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
 gi|296267827|gb|EFH13647.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
          Length = 233

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 89/202 (44%), Gaps = 3/202 (1%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
                +A  + P P                  +  IG+ DAPV ++EY S+TC +CA FH
Sbjct: 27  SVPASAAFAQAPGPQAFEPTAPGPDTPRPLPGERIIGRADAPVAVIEYHSLTCGNCANFH 86

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
              F  +   +I+ G +R+++R+FPLD V+  A              Y   +S L+  ++
Sbjct: 87  TTIFPRIRTTFIEPGLVRFVMRDFPLDRVALDAAA---MVHCGGPERYEALISTLYANKE 143

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W +S + R  L      AG      D C+ D+   D I   + +   +  +++TP F I
Sbjct: 144 AWAHSPDARTWLRRAGTLAGIPAARIDACMTDRGFTDPIILMRLQGERESGVNATPSFVI 203

Query: 205 GGNLYLGDMSEGVFSKIIDSMI 226
            G L+ G  S   FS ++  ++
Sbjct: 204 NGQLHRGVQSFERFSALVRPLL 225


>gi|156743266|ref|YP_001433395.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
 gi|156234594|gb|ABU59377.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
          Length = 255

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 49/225 (21%), Positives = 76/225 (33%), Gaps = 9/225 (4%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           +  G  +L + +        +                 +            G   APV +
Sbjct: 29  IAMGAAVLLVIAIAATVALQNRQTAATPGREPARPATNVPMGRDENGFFFKGSAGAPVVV 88

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST--VAVMLARCAEKR 127
            EY+   C  CA +        E +YI TGK++++  E+PL        A   ARCA ++
Sbjct: 89  TEYSDFQCPGCAYYATALSSQFEQEYIATGKVKFVYHEYPLSGHVNGAPAAQAARCAGEQ 148

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
               YW     LF  Q  W    + R   +  A+  G     F+ C       D I    
Sbjct: 149 GADKYWAMHDYLFTNQRQWSGQADPRAQFVAYARQIGLDTAAFEQCYAGNRFRDAINQA- 207

Query: 188 KRASEDFAIDSTPVFFIGGNLY--LGDMSEGV----FSKIIDSMI 226
           K A +   I  TP F + G L    G  S         + +D+ +
Sbjct: 208 KAAGDALRIPGTPSFAVNGRLVDTTGATSVEEIYTRMRQAVDAAL 252


>gi|328913412|gb|AEB65008.1| Disulfide bond formation protein D [Bacillus amyloliquefaciens LL3]
          Length = 223

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 77/230 (33%), Gaps = 15/230 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S+ +  V+  ++++ + +        S                 +A  PS      +G+ 
Sbjct: 6   SSVKFAVILTLIVVVLFAAIVIINNQSEKA-----------GETVAEQPSIKGQPVLGKD 54

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            APVT+VE+    C  C  F++  F  ++  +I  G +++           +    LA  
Sbjct: 55  SAPVTVVEFGDYKCPSCKVFNSDIFPKIKKDFIDKGDVKFSFVNVMFHGSGSRLAALASE 114

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND---QNIL 180
              + D   +        +Q      +    ALL     +   K D D    +   +   
Sbjct: 115 EVWKEDPASFWAFHEKLFEQQPSSEQEWVTPALLEKTVKSTAKKVDPDKLKENLDKETFS 174

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            ++KA      +   I +TP  ++   L          SK I   +++  
Sbjct: 175 KELKADTDLN-DKLNITATPTIYVNDKLIKNFSDYKEISKTIKKELKNEK 223


>gi|229097665|ref|ZP_04228623.1| hypothetical protein bcere0020_29060 [Bacillus cereus Rock3-29]
 gi|229116669|ref|ZP_04246055.1| hypothetical protein bcere0017_29540 [Bacillus cereus Rock1-3]
 gi|228666841|gb|EEL22297.1| hypothetical protein bcere0017_29540 [Bacillus cereus Rock1-3]
 gi|228685804|gb|EEL39724.1| hypothetical protein bcere0020_29060 [Bacillus cereus Rock3-29]
          Length = 238

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/227 (15%), Positives = 78/227 (34%), Gaps = 13/227 (5%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           ++  +  +++    + F    K   +              ++   P   K  ++G++DAP
Sbjct: 22  KLLFVATLIIFAAVTAFVVLNKEDKVATN----------KVIKDLPPIGKQPTLGKEDAP 71

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM-LARCAE 125
           V+++E+    C  C  +  + F  L+  YI TGK+++           +      A    
Sbjct: 72  VSIIEFGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLFHGTESKLSALAAESVY 131

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKN--YRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           K+    YW F   LFN Q    +         L     +              +    + 
Sbjct: 132 KQDPQAYWSFHKELFNAQPANHDDPWITPEKLLEIAKTYTPSINTVQLEEDLKKQTAQEE 191

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               ++ ++D+ ++ TP   I G +            +I+  ++D  
Sbjct: 192 VNKDEKLTQDYGVEQTPSIVINGTMLSDPYDYEQIKNLIEKALKDKK 238


>gi|260906412|ref|ZP_05914734.1| protein-disulfide isomerase [Brevibacterium linens BL2]
          Length = 250

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 80/237 (33%), Gaps = 21/237 (8%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPI------------------PDGVVDFRALLAASP 52
           L  IVL  +        +G + +                        G  +         
Sbjct: 15  LAVIVLAAVLIGVVIVNQGPSEDNANAHSQSESGAGGESGAGGESDSGTEEVDLSFVEHR 74

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
                 ++G+ DAPVT+V ++   C +CA ++ +T   + D   K      I        
Sbjct: 75  VEGDSHALGEVDAPVTLVMFSDYQCPYCASWNEETLPAMMDYVDKGDL--RIEMRDLAVF 132

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
                          + G YW F + +F+  +    S+   D+L++ A+  G     F  
Sbjct: 133 GEESERAARAAYAAGLQGKYWEFHNAMFDGGEHPPKSELDDDSLVSAAEDLGLDPTKFKG 192

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            +N  +  ++  A  +       + STP F IGG   +G      F   +D  + ++
Sbjct: 193 DMNSVDAHEEFDATAQEGYS-LGVASTPTFVIGGKPLVGAQPTKAFVGSVDDALAEA 248


>gi|115372964|ref|ZP_01460268.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310818669|ref|YP_003951027.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|115370042|gb|EAU68973.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309391741|gb|ADO69200.1| DSBA oxidoreductase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 424

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 53/178 (29%), Gaps = 9/178 (5%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
                  + G  DA VT+VE+    C  C+       + LED   +   +          
Sbjct: 47  VPLDDSPTKGPADALVTLVEFTDFQCPFCSRASASVKQVLEDYDGQLRVVIKQHPLAFHP 106

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
                A+           G +W +   LF  Q           +L   AK  G     + 
Sbjct: 107 RARPAALASLAAH---EQGKFWEYHDKLFANQKALD-----DASLETYAKEVGLDIKRWK 158

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             +    +   +      A        TP FF+ G  + G     VF  +I+  +  +
Sbjct: 159 KDMAAAKLAQAVDRDTALAVS-LGAGGTPGFFVNGRFFSGAQPIEVFRAVIEEELGKA 215



 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 60/192 (31%), Gaps = 9/192 (4%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
                      A         + G  DAPVT+V ++   C  C+   N   +    +   
Sbjct: 237 ASAPPPPPEPPAQKVDLGSAPAKGPSDAPVTLVAFSDFECPFCSRAANTVKQL---EGEY 293

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
            GKLR   +  PL   +   +           G +W +   LF  Q            L 
Sbjct: 294 QGKLRVAFKHQPLPRHTNAKLAATASLAAHEQGKFWEYHDKLFANQTALDRPA-----LE 348

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
             A+        F   L+       I A   +  +      TP FF+ G   +G      
Sbjct: 349 RYAEELKLDMGKFKAALDSNKFDAQISADSAQG-QQIGAAGTPTFFVNGRPIVGAKPIEN 407

Query: 218 FSKIIDSMIQDS 229
           F ++ID  ++ +
Sbjct: 408 FRRVIDDELRKA 419


>gi|157964090|ref|YP_001498914.1| protein-disulfide isomerase [Rickettsia massiliae MTU5]
 gi|157843866|gb|ABV84367.1| Protein-disulfide isomerase [Rickettsia massiliae MTU5]
          Length = 282

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/216 (24%), Positives = 88/216 (40%), Gaps = 9/216 (4%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPS------TMKDVSIGQKDAPVTMVEYASMT 76
                  +  +E+  P          A  P          D+ +G K + V +VEY S T
Sbjct: 63  IVPANDNNQTDEVSTPASQEQEPKNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPT 122

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C HCA +H   F  L+ KYI T K+ Y++REF                 K     +    
Sbjct: 123 CPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDTNSFTQLH 180

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
           +++  +QD W  S  YR+ L ++ +  G S  ++  CLN+  I + + A     ++    
Sbjct: 181 NIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITEILIANTNFVAKAPQF 240

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
             TP FF+ G +  G  S    S  +D  +++   +
Sbjct: 241 IGTPSFFVNG-VQTGSYSIDTISTAVDKALEEQKEK 275


>gi|67458424|ref|YP_246048.1| protein-disulfide isomerase [Rickettsia felis URRWXCal2]
 gi|75537101|sp|Q4UNH3|DSB_RICFE RecName: Full=Putative protein-disulfide oxidoreductase RF_0032;
           Flags: Precursor
 gi|67003957|gb|AAY60883.1| Protein-disulfide isomerase [Rickettsia felis URRWXCal2]
          Length = 278

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 51/215 (23%), Positives = 84/215 (39%), Gaps = 6/215 (2%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPS---TMKDVSIGQKDAPVTMVEYASMTC 77
           S                P        +     +      D+ +G K + V +VEY S TC
Sbjct: 60  SIVPANDNNQTDEVSTPPSQEQKNPEIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPTC 119

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS 137
            HCA +H   F  L+ KYI T K+ Y++REF                 K     +  F +
Sbjct: 120 PHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDINSFVQFHN 177

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
           ++  +QD W  S  YR+ L ++ +  G    ++  CLN   I + + A     +      
Sbjct: 178 IILQQQDKWAYSNKYRELLTDIGQLGGVPPEEYKQCLNSDKITETLIANTNFVANAPKFI 237

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
            TP FF+ G +  G+ S    S  +D  +++   +
Sbjct: 238 GTPSFFVNG-VQTGNYSIDSISTAVDKALEEQKEK 271


>gi|154687467|ref|YP_001422628.1| BdbD [Bacillus amyloliquefaciens FZB42]
 gi|154353318|gb|ABS75397.1| BdbD [Bacillus amyloliquefaciens FZB42]
          Length = 223

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 77/230 (33%), Gaps = 15/230 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S+ +  V+  ++++ + +        +                 +A  PS      +G+ 
Sbjct: 6   SSAKFAVILTLIVVVLFAAIVIINNQTEKA-----------GETVAEQPSIKGQPVLGKD 54

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            APVT+VE+    C  C  F++  F  ++  +I  G +++           +    LA  
Sbjct: 55  SAPVTVVEFGDYKCPSCKVFNSDIFPKIKKDFIDKGDVKFSFVNVMYHGSGSRLAALASE 114

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND---QNIL 180
              + D   +        +Q      +    ALL     +   K D D    +   +   
Sbjct: 115 EVWKEDPASFWAFHEKLFEQQPSSEQEWVTPALLEKTVKSTAKKVDPDKLKENLDKETFA 174

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            ++KA      +   I +TP  ++   +          SK I   +++  
Sbjct: 175 KELKADTDLN-DKLNITATPTIYVNDKVINDFSKYDEISKTIKKELKNEK 223


>gi|227541601|ref|ZP_03971650.1| dsba oxidoreductase [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227182569|gb|EEI63541.1| dsba oxidoreductase [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 264

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/258 (15%), Positives = 80/258 (31%), Gaps = 38/258 (14%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS---------------- 53
           VLG I L+      +         + P         ++  ++ +                
Sbjct: 8   VLGAIALVAAVLIGYALGGSGKDKDAPPAPDPTTVSSVAPSTQAQAAVKIEPSGETGAFL 67

Query: 54  --------------------TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
                                    + G+ DAPV + E++   C  CA++ N+T+  +  
Sbjct: 68  WGPGKTIATSEDITHVHRRMANDPFATGKVDAPVVISEFSDFECPFCAKYANETYPQVLK 127

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY- 152
            Y+  G +R    +  ++    V    A  A       +    +L    +D   + +N  
Sbjct: 128 DYVDKGLVRVEWNDMAVNGPDAVKAAEAGRAAAAQGKFHEFHNALYTASKDIQGHPENDI 187

Query: 153 RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
            D +    +      + F + +        + +  K  +    I  TP F IG     G 
Sbjct: 188 EDFVRFATEAGVPDLDRFRSEVESGTYTQAVTSATKYGAS-IGISGTPSFIIGDQFVSGA 246

Query: 213 MSEGVFSKIIDSMIQDST 230
               VF K I+  +Q + 
Sbjct: 247 QPYEVFQKAIEEQLQKNK 264


>gi|186683252|ref|YP_001866448.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
 gi|186465704|gb|ACC81505.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
          Length = 180

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 56/176 (31%), Gaps = 8/176 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P + +D   G K+APVT+VEY+   C +C   H    +  +        +        + 
Sbjct: 12  PVSDRDHIRGPKNAPVTLVEYSDYECPYCGRAHFIVKELQQLTGDLMRFVYRHFPLTSVH 71

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             +               G +W   + L   Q         R  L+  A   G     F 
Sbjct: 72  PHA--EQAAEAAEAAGAQGKFWEMHNHLLEHQQALD-----RKHLIEYAANLGLDVPRFS 124

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             L +   +  I+       +   ++ TP FFI G  + G          I +  +
Sbjct: 125 HELAEHAHVARIREDLLSGIQS-GVNGTPTFFINGVRHDGSYDLRSLLAAIQNAAE 179


>gi|46204118|ref|ZP_00209268.1| COG1651: Protein-disulfide isomerase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 166

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 68/160 (42%), Positives = 95/160 (59%), Gaps = 3/160 (1%)

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+VEYAS+TC HCA FH +T+  L+ +YI TGK+R+ILREFPLD    +A      A  
Sbjct: 8   VTIVEYASLTCGHCAAFHRETYPELKRRYIDTGKVRFILREFPLD---PLATAGFMLARC 64

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
           +    Y+    LLF+ Q DW  +    D L  + + AGF +  F++CL DQ +   + A 
Sbjct: 65  KGHASYYPVTDLLFDHQKDWAFTAKPLDDLQAILRQAGFQQEKFESCLKDQKLYASVSAV 124

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           ++RA+E F + STP FFI G  Y G++S     KII  M+
Sbjct: 125 RRRATETFKVSSTPTFFINGQRYAGNLSMEDIEKIIAPML 164


>gi|269968758|ref|ZP_06182749.1| hypothetical protein VMC_41790 [Vibrio alginolyticus 40B]
 gi|269826630|gb|EEZ80973.1| hypothetical protein VMC_41790 [Vibrio alginolyticus 40B]
          Length = 262

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/214 (21%), Positives = 81/214 (37%), Gaps = 17/214 (7%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD--VSIGQKDAPVTMVEYASMTCFHC 80
                +   + +L       +   L      +       +G K+A + +VE++   C +C
Sbjct: 48  GVIQNEVKEIKDLAFNPPKKEPPTLPNQLNFSEGGRLPILGNKEAKIAIVEFSDFQCPYC 107

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
             F +  FK +++ YI  GK++YI R+FPL   +         A       YW    +LF
Sbjct: 108 KRFTDNAFKQIKENYIDNGKVQYIARDFPLSFHAKAKGAAIAAACSLKQNSYWTMREMLF 167

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
           N   D       + A+         +  +F+ C+ DQ++ D I+       +   I  TP
Sbjct: 168 NNAKDLGEEFYQKAAIDL-----SLNIEEFNKCMEDQSVADKIEQDMTLG-KSLGIRGTP 221

Query: 201 VFFI----GGNL-----YLGDMSEGVFSKIIDSM 225
            F I       L      +G     VF  +++ +
Sbjct: 222 TFLIGRVENDQLVEPQIVVGAQGYAVFESLLEGL 255


>gi|159896786|ref|YP_001543033.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159889825|gb|ABX02905.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 241

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 71/202 (35%), Gaps = 3/202 (1%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
              +       + P+            A        S+G  +APVT+VEY+   C  C  
Sbjct: 34  IVPSTPAPPATQDPLGIASEFIPLAKPAQIPADDQRSMGDPNAPVTIVEYSDFQCPFCQR 93

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
            H   F  L+ KYI TG +RY+ R +  ++S ++                +W    +LF 
Sbjct: 94  HHVSVFPELKAKYIDTGMVRYVFRNYIAVESHTSAPAAGVASFCAMDQNKFWEMYDMLFV 153

Query: 142 KQDDWINSKN-YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
           +  +W    N     +L  A+        F  C  D  +L  + A    A        TP
Sbjct: 154 RASEWGVDPNLAPTVMLKYAEELDLDTAAFAKCQADPEVLAKVNAETAEAV-AAQATGTP 212

Query: 201 VFFIGGNLYLGDMSEGVFSKII 222
            FFIG  +  G      F   I
Sbjct: 213 AFFIGNYIIPGAYPLAGFDAAI 234


>gi|84502796|ref|ZP_01000909.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family protein) [Oceanicola batsensis HTCC2597]
 gi|84388779|gb|EAQ01649.1| putative periplasmic thiol-disulphide interchange protein (DsbA
           family protein) [Oceanicola batsensis HTCC2597]
          Length = 219

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 50/197 (25%), Positives = 80/197 (40%), Gaps = 2/197 (1%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
           A          V   +      S + ++++G  DA VT+ EYAS TC HCA FH   FK 
Sbjct: 24  ASRPGTTSISTVTPVSAEGVDTSGVTEMTLGSDDAGVTLTEYASFTCPHCANFHQAVFKD 83

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           L+  YI TGK++++ R+   D        +    E     G    +           +  
Sbjct: 84  LKRDYIDTGKVKFVYRDVYFDQFGLW-AAMIARCEPTRFFGIADMLYAQQKDWIGNGDPA 142

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
              D L  +   AG      D CL D++    + A  ++ +E   I  TP   I G  + 
Sbjct: 143 GIADRLRKIGLVAGLEAEAIDACLADEDKARSLVAWYQQNAEADEITGTPTLLIDGEKHS 202

Query: 211 GDMSEGVFSKIIDSMIQ 227
            +MS     +I+D+ ++
Sbjct: 203 -NMSYPDLREILDARLE 218


>gi|253574877|ref|ZP_04852217.1| disulfide dehydrogenase D [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251845923|gb|EES73931.1| disulfide dehydrogenase D [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 237

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 71/188 (37%), Gaps = 5/188 (2%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
                           +GQ DAPV +VE+    C  C   +      L   YI  GK+ +
Sbjct: 49  QPKPKPVEFDYAALPVLGQADAPVKIVEFGDYQCPSCKHVNELIKPELVKDYIDQGKVAF 108

Query: 104 ILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
                P     +      A+    + +  +W +   +F +Q +  N     + L+N+AK 
Sbjct: 109 YFMNLPFIGSDSFTAALAAQSVYHQSNDAFWKYFDAIFERQGEENNGWASPEFLVNLAKE 168

Query: 163 AGFSKNDF--DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM-SEGVFS 219
                +       + +    D+++A   R  +   +DSTP FFI G  Y G++       
Sbjct: 169 LELPIDYDLLQKDIAEATYQDEVQAQLARG-DKLGVDSTPTFFINGIEYAGNLGDYETLK 227

Query: 220 KIIDSMIQ 227
           K ID+ + 
Sbjct: 228 KTIDNELA 235


>gi|161528389|ref|YP_001582215.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339690|gb|ABX12777.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 214

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
           P+   +   L  ++        +G  +AP+T++E+    C  C +FH  T   + + +IK
Sbjct: 25  PEPEKNPTKLTPSTLIENGSPILGNSNAPITILEWGDYQCTFCYKFHKDTLNVINEDFIK 84

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           TGK++ + ++FPL+   +V +        R  G YW +   L+            R++L 
Sbjct: 85  TGKVKLVFKDFPLNGPDSV-LAGEASFCARDQGKYWEYHDELYKNWGGERTGWVTRESLD 143

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI-GGN---LYLGDM 213
             A   G     F+ CL++    + + A  +   E   ID+TP F +          G+ 
Sbjct: 144 IFASTVGLDLQTFNECLDEHKYQNKVNALYEFGRE-IGIDATPSFLVFNDEKIIKIRGNQ 202

Query: 214 SEGVFSKIIDSM 225
              VF K ID +
Sbjct: 203 PLEVFLKTIDEL 214


>gi|255003917|ref|ZP_05278718.1| hypothetical protein AmarV_00438 [Anaplasma marginale str.
           Virginia]
          Length = 253

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 91/231 (39%), Gaps = 8/231 (3%)

Query: 2   VMSTTR----IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS--TM 55
           +M   R    I V+  +  + + S+                   VD   + A        
Sbjct: 6   IMGFLRYCAGISVVACLCSVLLLSFSVAADTKKVDLPSNHEASTVDTADVTAEKLLGLMP 65

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
            D  +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YI           
Sbjct: 66  GDRFLGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYI--LRDFPLDKL 123

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
                      + +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  
Sbjct: 124 SLSAAMLGTCYKDNKTFFAYAKAVFNSFDALIATHKDLGLLANIAKISNISDEEFKKCTT 183

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D+ ++D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 184 DEALMDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 234


>gi|255002783|ref|ZP_05277747.1| hypothetical protein AmarPR_00418 [Anaplasma marginale str. Puerto
           Rico]
          Length = 255

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 91/231 (39%), Gaps = 8/231 (3%)

Query: 2   VMSTTR----IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS--TM 55
           +M   R    I V+  +  + + S+                   VD   + A        
Sbjct: 8   IMGFLRYCAGISVVACLCSVLLLSFSVAADTKKVDLPSNHEASTVDTADVTAEKLLGLMP 67

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
            D  +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YI           
Sbjct: 68  GDRFLGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYI--LRDFPLDKL 125

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
                      + +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  
Sbjct: 126 SLSAAMLGTCYKDNKTFFAYAKAVFNSFDALIATHKDLGLLANIAKISNISDEEFKKCTT 185

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D+ ++D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 186 DEALMDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 236


>gi|239948444|ref|ZP_04700197.1| protein-disulfide oxidoreductase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922720|gb|EER22744.1| protein-disulfide oxidoreductase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 278

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 51/215 (23%), Positives = 84/215 (39%), Gaps = 6/215 (2%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPS---TMKDVSIGQKDAPVTMVEYASMTC 77
           S                         +     +      D+ +G K + V +VEY S TC
Sbjct: 60  SIVPANDNNQTDEVSTPASQEQKNPEIKPVKVTFKIDNNDMVLGNKKSNVIVVEYFSPTC 119

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS 137
            HCA +H   F  L+ KYI T K+ Y+ REF                 K     +  F +
Sbjct: 120 PHCAYYHQTIFPELKKKYIDTNKIAYVAREFIATKQDL--DAAILARCKGDIDSFVQFHN 177

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
           ++  +QD W  S  YR+ L ++ +  G S  ++  CLN   I + + A     ++     
Sbjct: 178 IILKQQDKWAYSNKYRELLTDIGQLGGVSPEEYKQCLNSDKITETLIANTNFVAKAPKFI 237

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
            TP FF+ G +  G+ S    S  +D  +++   +
Sbjct: 238 GTPSFFVNG-VQTGNYSIDNISTAVDKALEEQKEK 271


>gi|222474813|ref|YP_002563228.1| hypothetical protein AMF_083 [Anaplasma marginale str. Florida]
 gi|222418949|gb|ACM48972.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 272

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 57/231 (24%), Positives = 91/231 (39%), Gaps = 8/231 (3%)

Query: 2   VMSTTR----IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS--TM 55
           +M   R    I V+  +  + + S+                   VD   + A        
Sbjct: 25  IMGFLRYCAGISVVACLCSVLLLSFSVAADTKKVDLPSNHEASTVDTADVTAEKLLGLMP 84

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
            D  +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YI           
Sbjct: 85  GDRFLGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYI--LRDFPLDKL 142

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
                      + +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  
Sbjct: 143 SLSAAMLGTCYKDNKTFFAYAKAVFNSFDALIATHKDLGLLANIAKISNISDEEFKKCTT 202

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D+ ++D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 203 DEALMDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 253


>gi|145223415|ref|YP_001134093.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
 gi|145215901|gb|ABP45305.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
          Length = 219

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 65/226 (28%), Gaps = 10/226 (4%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TRI +    V+  I     Y                 D   L+  +   +  V   
Sbjct: 1   MAPLTRILLTVFAVITMIIGVGVYLSAQDKDAPTSAQGQGEDVGQLVRDNSRRLTTV--- 57

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             ++ VT VE+    C  C        +    +     ++ +++R FP+ S         
Sbjct: 58  -PNSDVTFVEFLDFECEACRAAFPMVEQL---RAEYGDRVNFVIRYFPIQSHFNAERAAR 113

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD-ALLNMAKFAGFSKNDFDTCLNDQNIL 180
                     +      ++  Q +W   +   D      A   G     FD   ND   L
Sbjct: 114 AVEAAAQQDKFEPMYKKMYETQSEWGEQQTPADSRFRGFAAELGLDMAAFDAAYNDPATL 173

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D +        +   +  TP FFI G       S       ++  +
Sbjct: 174 DRVNVDVADG-KALGVKGTPTFFIDGTEVE-FRSYDDLKAAVEQAL 217


>gi|329764757|ref|ZP_08256352.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329138807|gb|EGG43048.1| DSBA oxidoreductase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 230

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 73/181 (40%), Gaps = 8/181 (4%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           +T     +G+  AP+T++E+    C  C +++  T   ++  YI TGK++ I  +FP+  
Sbjct: 52  TTKGSPVLGESSAPITIIEFGDYQCPFCQKWNQNTKPLIDRDYISTGKVKLIYVDFPIVG 111

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             +     A        G YW +   L+  Q    +     + L N+         +  +
Sbjct: 112 PDS-INAHAGSYCADEQGLYWQYHDFLYKNQGHENSGWVSMNNLKNIVSGMEGIDVNLFS 170

Query: 173 -CLNDQNILDDIKAGKKRASEDFAIDSTPVFFI-----GGNLYLGDMSEGVFSKIIDSMI 226
            C++     D +K  K  A ++    STP F +      G    G     VF + ID M+
Sbjct: 171 NCIDSGKYNDRVKENKNIAVKN-GAKSTPSFIVIGPNGHGVAISGAQPYSVFKQTIDEMM 229

Query: 227 Q 227
            
Sbjct: 230 S 230


>gi|149922962|ref|ZP_01911382.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149816213|gb|EDM75720.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 480

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 63/199 (31%), Gaps = 9/199 (4%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
                 P           A P+       G  DAPV +VE+    C +C + H +    L
Sbjct: 247 AEAAKAPQTEGPKHDQRYAIPTGAPGY--GPADAPVVLVEFIDYQCPYCRKAHEEIVPAL 304

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
            ++Y    ++        + + +  A      A ++     +                  
Sbjct: 305 IERYGDDLRVELRHLPLEIHAGAAPAARAVITASRQGKATEF------HEALWKLDGGGL 358

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
                + +A   G  K  F+     + + D + A    A     +  TP FF+ G    G
Sbjct: 359 GFSTFVRLADELGLDKEAFERDFQTREVSDALVADLLLA-RRLGVRGTPGFFVNGRFVDG 417

Query: 212 DMSEGVFSKIIDSMIQDST 230
             S G F  +ID  ++ + 
Sbjct: 418 ARSVGTFEGLIDEELERAK 436



 Score = 65.8 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 63/202 (31%), Gaps = 9/202 (4%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
            A  +       +D R          ++ ++G +   VT+V +    C  C         
Sbjct: 5   PAKPDPLQAGTNIDLRRYYVELDERDREYALGGEQPLVTIVLWTDYACPPCGRTWQVMKH 64

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            +ED       +R + R   +                   G +W     LF         
Sbjct: 65  LVEDY---GDDVRVVFRAGTVPGFQHGERATEAALAAGAQGKFWEMHWRLFEN-----PE 116

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
              R  L   A+  G   N F   L+      D    ++RA+E   + + P  F+ G   
Sbjct: 117 DFSRPVLRKHAEVIGLDVNQFMDDLDTGAYSGDRVRDRRRATE-LGLSALPAGFVNGLFV 175

Query: 210 LGDMSEGVFSKIIDSMIQDSTR 231
           LG   E  +  +ID  +  + R
Sbjct: 176 LGFKEEAGWHALIDRELASARR 197


>gi|254994674|ref|ZP_05276864.1| hypothetical protein AmarM_00455 [Anaplasma marginale str.
           Mississippi]
          Length = 253

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 58/231 (25%), Positives = 92/231 (39%), Gaps = 8/231 (3%)

Query: 2   VMSTTR----IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS--TM 55
           +M   R    I V+  +  + + S+                   VD   + A        
Sbjct: 6   IMGFLRYCAGISVVACLCSVLLLSFSVAADTKKVDLPSNHEASTVDTADVTAEKLLGLMP 65

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
            D  +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YI           
Sbjct: 66  GDRFLGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYI--LRDFPLDKL 123

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
                   A  + +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  
Sbjct: 124 SLSAAMLGACYKDNKTFFAYAKAVFNSFDALIATHKDLGLLANIAKISNISDEEFKKCTT 183

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D+ ++D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 184 DEALMDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 234


>gi|240104401|pdb|3EU3|A Chain A, Crystal Structure Of Bdbd From Bacillus Subtilis (Reduced)
 gi|240104402|pdb|3EU4|A Chain A, Crystal Structure Of Bdbd From Bacillus Subtilis
           (Oxidised)
 gi|240104456|pdb|3GH9|A Chain A, Crystal Structure Of Edta-Treated Bdbd (Oxidised)
 gi|240104457|pdb|3GHA|A Chain A, Crystal Structure Of Etda-Treated Bdbd (Reduced)
          Length = 202

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 64/188 (34%), Gaps = 1/188 (0%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                  ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G 
Sbjct: 5   TEQGNDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGD 64

Query: 101 LRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +++           +      +    K     +W F   LF KQ D          L ++
Sbjct: 65  VKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDL 124

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           AK     K +      D+             ++   I +TP  ++   +           
Sbjct: 125 AKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIK 184

Query: 220 KIIDSMIQ 227
           + I+  ++
Sbjct: 185 ETIEKELK 192


>gi|157825169|ref|YP_001492889.1| protein-disulfide isomerase [Rickettsia akari str. Hartford]
 gi|157799127|gb|ABV74381.1| Protein-disulfide isomerase [Rickettsia akari str. Hartford]
          Length = 312

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 85/201 (42%), Gaps = 3/201 (1%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
                      + + +       + D+ +G K + V +VEY S TC HCA +H   F  L
Sbjct: 108 STPASQAQKNPEIKPVKVTFEVDVNDMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPEL 167

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
           + KYI T K+ Y++REF                 K     +  F +++  +QD W  S  
Sbjct: 168 KKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDINSFVQFHNIILQQQDKWAYSNK 225

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
           YR+ L ++ +  G    ++  CLN   I + + A     ++      TP FF+ G +  G
Sbjct: 226 YRELLTDIGQLGGVPPEEYKQCLNSDKITETLIANTNFVAKAPKFIGTPSFFVNG-VQTG 284

Query: 212 DMSEGVFSKIIDSMIQDSTRR 232
           + S    S  +D  +++   +
Sbjct: 285 NYSIDSISTAVDKALEEQKEK 305


>gi|300857683|ref|YP_003782666.1| hypothetical protein cpfrc_00266 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685137|gb|ADK28059.1| putative secreted protein [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302329978|gb|ADL20172.1| Putative secreted protein with DSBA-like thioredoxin domain
           [Corynebacterium pseudotuberculosis 1002]
 gi|308275662|gb|ADO25561.1| Putative secreted protein with DSBA-like thioredoxin domain
           [Corynebacterium pseudotuberculosis I19]
          Length = 293

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 71/207 (34%)

Query: 22  YFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCA 81
                    A+   P  +       L     +     ++G  DAPV + E++   C  CA
Sbjct: 76  VALANGSYDAMIYGPGKELKSAEDILNVHRRNAKDPFALGALDAPVVISEFSDFECPFCA 135

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
           ++ N+T   +  +Y++ G +R    + P++    V+   A  A            +L   
Sbjct: 136 KWSNETEPTIIKEYVEKGFVRIEWNDLPINGPDAVSAAKAGRAAAAQGKFNEFRSALFQA 195

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
            +    + +N        A+ AG       +        D +    +  +    I+ TP 
Sbjct: 196 SKTIKGHPENKLTNFEEFAREAGVKDMARFSREASDATYDSVVDKAREYAGSLGINGTPG 255

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F +G     G     VF + I++ +  
Sbjct: 256 FVVGTQYVSGAQPTEVFIRAIEAELAK 282


>gi|269959141|ref|YP_003328930.1| putative isomerase [Anaplasma centrale str. Israel]
 gi|269848972|gb|ACZ49616.1| putative isomerase [Anaplasma centrale str. Israel]
          Length = 251

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 58/229 (25%), Positives = 90/229 (39%), Gaps = 6/229 (2%)

Query: 2   VMSTTR--IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTM--KD 57
           +M   R  +GV   I L  +   F                  V+   + A     +   D
Sbjct: 4   IMRFLRCYLGVSFAICLCSVLVGFSAAADAKVDAPSNSEVDAVNTADITAEKLLGLIPGD 63

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
             +G   APV MVEYAS +C HCA+F  K    L+ +YI  GKL YI             
Sbjct: 64  RFLGNTSAPVVMVEYASFSCSHCADFATKVLPRLKSEYIDKGKLLYI--LRDFPLDKLSL 121

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                    + +  ++ +   +FN  D  I +      L N+AK +  S  +F  C  ++
Sbjct: 122 SAAMLGTCYKDNKTFFAYAKAVFNSFDALIATHKDLGLLSNIAKISNISDEEFKKCTTNE 181

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            ++D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 182 ALMDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSVSAEIEKLI 230


>gi|16080401|ref|NP_391228.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221311298|ref|ZP_03593145.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221315625|ref|ZP_03597430.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221320541|ref|ZP_03601835.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221324825|ref|ZP_03606119.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|34921363|sp|O32218|BDBD_BACSU RecName: Full=Disulfide bond formation protein D; AltName:
           Full=Disulfide oxidoreductase D; AltName:
           Full=Thiol-disulfide oxidoreductase D; Flags: Precursor
 gi|2635861|emb|CAB15353.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291485845|dbj|BAI86920.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 222

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 64/188 (34%), Gaps = 1/188 (0%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                  ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G 
Sbjct: 33  TEQGNDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGD 92

Query: 101 LRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +++           +      +    K     +W F   LF KQ D          L ++
Sbjct: 93  VKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDL 152

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           AK     K +      D+             ++   I +TP  ++   +           
Sbjct: 153 AKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIK 212

Query: 220 KIIDSMIQ 227
           + I+  ++
Sbjct: 213 ETIEKELK 220


>gi|116620575|ref|YP_822731.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116223737|gb|ABJ82446.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 318

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 59/171 (34%), Gaps = 2/171 (1%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-V 116
            ++G   APV +V ++ + C HC        + L   Y K  +L +              
Sbjct: 113 PALGTPGAPVQIVAFSDLQCPHCKTEAQMLRENLIKNYPKEVRLYFKDFPLEGLHPWAKA 172

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A M  RC  ++    +W +   +F+KQ+           L                C++ 
Sbjct: 173 AAMAGRCVFQQNADAFWDYHDFVFSKQESLTPENLKDQILAWAKDNKSLDSVKLGACIDS 232

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           +    +++   +       I STP  FI G      +       IIDS I+
Sbjct: 233 KATQAEVEKEMEDG-RALDISSTPTLFINGRRIGQSIDWANLKTIIDSEIE 282


>gi|297560677|ref|YP_003679651.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296845125|gb|ADH67145.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 226

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/224 (14%), Positives = 71/224 (31%), Gaps = 7/224 (3%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAAS----PSTMKDVSIGQK 63
           +G+  G++++ +                  PDG  D +A   A                +
Sbjct: 5   LGITLGLIMVAVIGLGLLVALDDRGGAPAAPDGSADPQAAPTAPAGLLVREDSRHLDRVE 64

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +APVT+VE+    C  C        +  ED   +   +          +    A  +   
Sbjct: 65  EAPVTVVEFLDFECEACRAQFPVMERIREDYDGRINTVIRYFPMPGHTNAEPAAAAVEAA 124

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           A++      +  +     +  +     +  +  +  A+  G    +F   + D   L+ +
Sbjct: 125 AQQGALEQMYVRMYETQAEWGES--QDSKAEVFVGFAEDLGLDTEEFVRAVEDPATLERV 182

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           ++  +       +  TP  F+ G            S +ID  ++
Sbjct: 183 RSDFRDGV-ALGVRGTPTIFVNGRPTPSMPGYETLSAMIDRELE 225


>gi|167045299|gb|ABZ09957.1| putative DSBA-like thioredoxin domain protein [uncultured marine
           crenarchaeote HF4000_APKG9P22]
          Length = 223

 Score =  101 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 87/231 (37%), Gaps = 17/231 (7%)

Query: 5   TTRIGVLG----GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
             R  ++     GIV++ IA +  Y         +P+           +         ++
Sbjct: 1   MNRNIIVAAAFFGIVIIVIAGFSSYYFSLLEAQNMPM-------IKPTSMINLENGSPAL 53

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G + AP+T+VE+    C  C  + + T   L D YI+TGK + +  + P     ++    
Sbjct: 54  GSESAPITIVEFGDYQCESCYYWFHNTRSTLIDNYIETGKAKLVFVDLPFLGRDSITAAQ 113

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A    +     +     L   +     +    +D L + A     + ++F+ C++     
Sbjct: 114 ASYCAEDQGKYWEYHTILYTFQDGAPDSGWANQDRLNSFAFTLEMNMDEFNDCMDSSKYK 173

Query: 181 DDIKAGKKRASEDFAIDSTPVFFI---GG--NLYLGDMSEGVFSKIIDSMI 226
             +KA    A +     +TP F I    G    + G     VF+  I+SM+
Sbjct: 174 IRVKANYNEAVKQ-GAQATPTFIIISSDGTTKKFAGAQPYSVFAATIESML 223


>gi|308175087|ref|YP_003921792.1| thiol-disulfide oxidoreductase [Bacillus amyloliquefaciens DSM 7]
 gi|307607951|emb|CBI44322.1| thiol-disulfide oxidoreductase [Bacillus amyloliquefaciens DSM 7]
          Length = 223

 Score =  101 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 76/230 (33%), Gaps = 15/230 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           S+ +  V+  ++++ + +        +                 +A  PS      +G+ 
Sbjct: 6   SSAKFAVILTLIVVVLFAAIVIINNQTEKA-----------GETVAEQPSIKGQPVLGKD 54

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM-LAR 122
            APVT+VE+    C  C  F++  F  ++  +I  G +++           +      + 
Sbjct: 55  SAPVTVVEFGDYKCPSCKVFNSDIFPKIKKDFIDKGDVKFSFVNVMFHGTGSRLAALASE 114

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNIL 180
              K     +W F   LF +Q            L    K        +     L+ +   
Sbjct: 115 EVWKEDPASFWAFHEKLFEEQPSSEQEWVTPALLEKTVKSTAKKVDPDKLKENLDKETFA 174

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            ++KA      +   I +TP  ++   +     +    SK I   +++  
Sbjct: 175 TELKADTDLN-DKLNITATPTIYVNDKVIKDFANYEEISKTIKKELKNEK 223


>gi|219847461|ref|YP_002461894.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
 gi|219541720|gb|ACL23458.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
          Length = 251

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 50/251 (19%), Positives = 96/251 (38%), Gaps = 26/251 (10%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNE--------------LPIPDGVVDFRAL 47
           +M  + + ++  +VL              +  E               P P  +    ++
Sbjct: 1   MMRISPLWIVVLVVLFVGCGSAAPPAPTRSPVEIRQTQVALQGLPTVPPAPTELTQPTSI 60

Query: 48  LAASPS--------TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG 99
              +P              ++G  +APV M+E+    C  CA F ++T   L  ++++ G
Sbjct: 61  PRPTPDVVALLNLTPDDPRALGDPNAPVLMIEFTDYECPFCARFVSETRSRLISEFVEAG 120

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN---SKNYRDAL 156
            +R ++R+FPL S+   AV+ A  A        +  V  +  +  +       +  R  L
Sbjct: 121 IVRLVVRDFPLTSIHASAVLAASVAHCAAAQDRFWPVYEMLFQTHNVEWGGVPRRDRPVL 180

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
           + +A   G       TCL+D      +      A++   I+STP F I G +  G +   
Sbjct: 181 VELAGKLGVDTAQLATCLDDPATEAAVLNEVALATQ-LGINSTPNFLINGQIVRGALPFE 239

Query: 217 VFSKIIDSMIQ 227
            F+ +I  + +
Sbjct: 240 NFASLIRQLAK 250


>gi|144900304|emb|CAM77168.1| Protein-disulfide isomerase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 200

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 60/182 (32%), Positives = 88/182 (48%), Gaps = 1/182 (0%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                +      S   D  +G+ DAP+T++EYAS TC HCA FH  T   ++  +I TGK
Sbjct: 15  SAPAVSAAGKDDSFPIDRVLGKADAPITIIEYASTTCGHCATFHKGTLPEVKKNWIDTGK 74

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
            + + R+FP                      Y+G + L+  +QD W+ SK+  DAL    
Sbjct: 75  AKLVYRDFPTGPAGLSIGASMIAHC-AGPERYFGVLGLIMEQQDKWLGSKDPLDALKKTV 133

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
           + AG +  D D CL  Q++   I+   +   E F IDSTP F + G L +G  S   F+K
Sbjct: 134 RLAGLTGEDVDACLQRQDLFQGIQVRAEHGHEQFKIDSTPSFVVNGKLVVGAKSYEDFNK 193

Query: 221 II 222
           I+
Sbjct: 194 IL 195


>gi|118576169|ref|YP_875912.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
 gi|118194690|gb|ABK77608.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
          Length = 226

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 85/221 (38%), Gaps = 7/221 (3%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
            GI     A+          + + P  +          A  +      +G   A VT+VE
Sbjct: 8   VGIGAGVTAAVIVAAFFALDIGQGPEAELRTVQPQTQLALYTENGSPPLGDPGAAVTLVE 67

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           +    CF+C +F + T + + D+Y+ TGK+R I ++F +    +V             G 
Sbjct: 68  FGDYQCFYCNQFFHDTEQAILDEYVSTGKVRMIFKDFTIIGPDSV-AAAHGARCADEQGS 126

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           +W +  +L+++           + LL+MA  AG   N +  C+++      + A    A 
Sbjct: 127 FWEYHDILYSRWAGENTGWASAENLLDMAGTAGLDVNAWGICMDEGRHEGALSASNNDA- 185

Query: 192 EDFAIDSTPVFFI---GG--NLYLGDMSEGVFSKIIDSMIQ 227
               +  TP FF+    G      G      F  ++DS + 
Sbjct: 186 RSLGLTGTPAFFVIDTDGGVTKIEGARPYADFKAVLDSALA 226


>gi|156741642|ref|YP_001431771.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
 gi|156232970|gb|ABU57753.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
          Length = 251

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/208 (22%), Positives = 79/208 (37%), Gaps = 2/208 (0%)

Query: 18  FIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTC 77
            +++    T+  +               A L    +      +G  DAPVT++E++   C
Sbjct: 46  IVSTAPSATQVSAVATPASDTPAATTEAAGLERGRTPEGYHYLGNADAPVTILEFSDFLC 105

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS 137
             CA    +T   + D Y+ TGK R + R        +              G +W    
Sbjct: 106 TACAFHVEETEPAIIDAYVATGKARIVYRHLLQLGEES-LRAAEAAECAGDQGKFWEMRD 164

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
            ++  Q     + +   AL  +A+      N+++ C+  +     I+A   RA++D  I 
Sbjct: 165 AIYRNQAALYTTGDVGAALTYLAQTIDLDMNEYNVCVQSRKHRARIEADF-RAAQDAGIR 223

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           S PVF IGG   +G      F  I+D  
Sbjct: 224 SRPVFDIGGTRLVGARPFEDFQAILDQQ 251


>gi|302205424|gb|ADL09766.1| Putative secreted protein with DSBA-like thioredoxin domain
           [Corynebacterium pseudotuberculosis C231]
          Length = 309

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 72/207 (34%)

Query: 22  YFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCA 81
                    A+   P  +       L     +T    ++G  DAPV + E++   C  CA
Sbjct: 92  VALANGSYDAMIYGPGKELKSAEDILNVHRRNTKDPFALGALDAPVVISEFSDFECPFCA 151

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
           ++ N+T   +  +Y++ G +R    + P++    V+   A  A            +L   
Sbjct: 152 KWSNETEPTIIKEYVEKGFVRIEWNDLPINGPDAVSAAKAGRAAAAQGKFNEFRSALFQA 211

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
            +    + +N        A+ AG       +        D +    +  +    I+ TP 
Sbjct: 212 SKTIKGHPENKLTNFEEFAREAGVKDMARFSREASDATYDSVVDKAREYAGSLGINGTPG 271

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F +G     G     VF + I++ +  
Sbjct: 272 FVVGTQYVSGAQPTEVFIRAIEAELAK 298


>gi|56416443|ref|YP_153517.1| hypothetical protein AM116 [Anaplasma marginale str. St. Maries]
 gi|56387675|gb|AAV86262.1| hypothetical protein AM116 [Anaplasma marginale str. St. Maries]
          Length = 272

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/231 (24%), Positives = 91/231 (39%), Gaps = 8/231 (3%)

Query: 2   VMSTTR----IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS--TM 55
           +M   R    I V+  +  + + S+                   VD   + A        
Sbjct: 25  IMGFLRYCAGISVVACLCSVLLLSFSVAADTKKVDLPSNHEASTVDTADVTAEKLLGLMP 84

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
            D  +G   APV M+EYAS +C HCA+F  K    L+++YI  GKL YI           
Sbjct: 85  GDRFLGNTSAPVVMLEYASFSCSHCADFATKVLPRLKNEYIDKGKLLYI--LRDFPLDKL 142

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
                      + +  ++ +   +FN  D  I +      + N+AK +  S  +F  C  
Sbjct: 143 SLSAAMLGTCYKDNKTFFAYAKAVFNSFDALIATHKDLGLVANIAKISNISDEEFKKCTT 202

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D+ ++D +   K  A     +++TP FF+ G  Y G       S  I+ +I
Sbjct: 203 DEALMDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSISAEIEKLI 253


>gi|254451654|ref|ZP_05065091.1| thiol-disulfide oxidoreductase D, Putative [Octadecabacter
           antarcticus 238]
 gi|198266060|gb|EDY90330.1| thiol-disulfide oxidoreductase D, Putative [Octadecabacter
           antarcticus 238]
          Length = 221

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 1/195 (0%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
                        + A+   + +++ G  DA V ++EYAS TC HCA FH   ++ +++ 
Sbjct: 27  TAASAQSSGATETMEAAQFDIIEMTQGNPDASVQVLEYASYTCPHCASFHADQYQQIKEN 86

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           YI TG + +  RE   D+    A M+ARC  +    G    +           + +    
Sbjct: 87  YIDTGLIGFTYREVYFDAPGLWASMVARCGGEMRFFGISSLLYENQQDWARGESGEEIIT 146

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
           +L N+ K AG S  + D CL D+    ++    +  ++   +  TP F I G  Y  +M+
Sbjct: 147 SLRNIGKVAGLSDAELDVCLTDEAKAQELTGWYRSNADADDVQGTPTFLINGEKYS-NMN 205

Query: 215 EGVFSKIIDSMIQDS 229
              F++++   + +S
Sbjct: 206 YADFAEVLGEKLAES 220


>gi|289705291|ref|ZP_06501690.1| Na+/H+ antiporter NhaA [Micrococcus luteus SK58]
 gi|289558041|gb|EFD51333.1| Na+/H+ antiporter NhaA [Micrococcus luteus SK58]
          Length = 614

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 73/225 (32%), Gaps = 16/225 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +GVL  +VL     +  +        E        D   +L        D   G +DA
Sbjct: 400 ATVGVLVAMVLATALGWLIFRVAAKRWGE-----ETADLPMVLTPPVDPEVDHIRGPEDA 454

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            +T+VEY    C +CA                   +   L   P        +       
Sbjct: 455 QLTLVEYIDFECPYCAHATGSWEDLRSRFGDDLRYVVRQLPHHPHGP-----IAARASEA 509

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
               G +W ++  +F +QD        R+ L+  A+  G     F   L+   +   ++ 
Sbjct: 510 ASNQGMFWPWLDFVFTRQDALE-----REDLIRYAEELGLDVAQFTADLDSAAVRARVER 564

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
             + A +     +TP FF+ G   LG       +  +++  + + 
Sbjct: 565 DLESA-DASGAHATPTFFVDGRRLLGSYDARTLTSTLEASRRGTR 608


>gi|228907645|ref|ZP_04071502.1| hypothetical protein bthur0013_18120 [Bacillus thuringiensis IBL
           200]
 gi|228852137|gb|EEM96934.1| hypothetical protein bthur0013_18120 [Bacillus thuringiensis IBL
           200]
          Length = 226

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/227 (15%), Positives = 83/227 (36%), Gaps = 13/227 (5%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           ++ ++  +++  + + F    K          +  V    ++   P   K  ++G++DAP
Sbjct: 10  KLLLITTLIIFAVVTAFVVLNK----------EEKVATNKVIKDLPPIGKQPTLGKEDAP 59

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM-LARCAE 125
           V+++E+    C  C  +  + F  L+  YI TGK+++           +      A    
Sbjct: 60  VSIIEFGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLFHGTESKLSALAAESVY 119

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKN--YRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           K+    YW F   LFN Q +  +         L     +              +    + 
Sbjct: 120 KQDPQAYWSFHKELFNAQPENHDDPWITPEKLLEIAKTYTPSINTTQLEEDLKKQTEQEE 179

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               ++ ++D++++ TP   + G +            +I+  +++  
Sbjct: 180 VNRDEKLTQDYSVEQTPSIVVNGTMLSDPYDYEQIKNLIEKALKEKK 226


>gi|119855073|ref|YP_935678.1| DSBA oxidoreductase [Mycobacterium sp. KMS]
 gi|120404653|ref|YP_954482.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
 gi|145225923|ref|YP_001136577.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
 gi|119697791|gb|ABL94863.1| DSBA oxidoreductase [Mycobacterium sp. KMS]
 gi|119957471|gb|ABM14476.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
 gi|145218386|gb|ABP47789.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
          Length = 219

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 66/226 (29%), Gaps = 10/226 (4%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TRI +    V+  I     Y                 D   L+  +   + +V   
Sbjct: 1   MAPLTRILLTVFAVITMIIGVGVYLSAQDKDTPGSAQAQGGDVGQLVRENSRRLTNV--- 57

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             ++ VT VE+    C  C        +    +     ++ +++R FP+ S         
Sbjct: 58  -PNSDVTFVEFLDFECEACRAAFPMVEQL---RAEYGDRVNFVIRYFPIQSHFNAERAAR 113

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD-ALLNMAKFAGFSKNDFDTCLNDQNIL 180
                     +      ++  Q +W   +   D      A   G     FD   ND   L
Sbjct: 114 AVEAAAQQDKFEPMYKKMYETQSEWGEQQTPADSRFRGFAAELGLDMAAFDAAYNDPATL 173

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D +        +   +  TP FF+ G       S       ++  +
Sbjct: 174 DRVNVDVADG-KALGVQGTPTFFLDGTEVE-FRSYDDLKTAVEQAL 217


>gi|302562652|ref|ZP_07314994.1| DSBA oxidoreductase [Streptomyces griseoflavus Tu4000]
 gi|302480270|gb|EFL43363.1| DSBA oxidoreductase [Streptomyces griseoflavus Tu4000]
          Length = 258

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 61/201 (30%), Gaps = 1/201 (0%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
                      G         A       +++G  DAPV M+EY+   C  C  F  +T 
Sbjct: 54  SRPEATAEPVPGDSAPAGPDLARRDAADPLAVGPVDAPVVMIEYSDFQCPFCGRFARETK 113

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN 148
           + L   +++ G LR   R FP+    +     A  A  R    +     L    ++    
Sbjct: 114 QELLRTHVEKGVLRIEWRNFPIFGEESERAARAAWAAGRQGAFWEFHDRLYAEPRERNTG 173

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
                + + +           F   +        +   +        + STP F + G  
Sbjct: 174 EFTQTELVAHAKAAGVADLTRFREDMESDQARQAVDRDRAEGY-TLGVTSTPAFLVNGTP 232

Query: 209 YLGDMSEGVFSKIIDSMIQDS 229
            LG      F K I   +  S
Sbjct: 233 ILGAQPTDAFDKAIRDALTRS 253


>gi|157827899|ref|YP_001494141.1| hypothetical protein A1G_00185 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932587|ref|YP_001649376.1| thiol:disulfide interchange protein [Rickettsia rickettsii str.
           Iowa]
 gi|157800380|gb|ABV75633.1| hypothetical protein A1G_00185 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907674|gb|ABY71970.1| thiol:disulfide interchange protein [Rickettsia rickettsii str.
           Iowa]
          Length = 277

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 52/214 (24%), Positives = 87/214 (40%), Gaps = 7/214 (3%)

Query: 23  FFYTRKGSALNELPIPDG----VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
                  +  +E+  P          + +         D+ +G K + V +VEY S TC 
Sbjct: 60  IVPANDNNQTDEVSTPASHKQKNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPTCP 119

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
           HCA +H   F  L+ KYI T K+ Y++REF                 K     +    ++
Sbjct: 120 HCAYYHKTIFPELKKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDTNSFTQLHNI 177

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           +  +QD W  S  YR+ L ++ +  G S  ++  CLN+  I   + A     ++      
Sbjct: 178 ILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIG 237

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           TP FF+ G +  G  S    S  ID  +++   +
Sbjct: 238 TPSFFVNG-VQTGSYSIDTISTAIDKALEEQKEK 270


>gi|162457325|ref|YP_001619692.1| hypothetical protein sce9040 [Sorangium cellulosum 'So ce 56']
 gi|161167907|emb|CAN99212.1| hypothetical protein sce9040 [Sorangium cellulosum 'So ce 56']
          Length = 665

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/241 (15%), Positives = 66/241 (27%), Gaps = 26/241 (10%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTM------- 55
           MS   I  +  + LLF+ +                  G    +   AA P          
Sbjct: 1   MSRRAIAAVAWLSLLFVLACSSALPPPPPDASQAKSSGAPARQPGPAADPGATLDDEVMV 60

Query: 56  ------------KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT-GKLR 102
                        D + G + APVT+V ++   C  C        +  +    +    + 
Sbjct: 61  ADGDPGPVPVTRADPARGSRLAPVTIVVFSDFECPFCKHLGGTLRQLEQRYGAERLRVVW 120

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
                         A              +W F   +F       + +   +      + 
Sbjct: 121 KNFPLAFHKQARPTAEAAMAVFAHAGPRAFWAFHDAIF-----TADERLSPEVQATALRR 175

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           AG +       +        + A    A     ++ TP  FI G L +G      F++II
Sbjct: 176 AGVTPGQIPQLVQQSGAAQKVAADMALAG-RLGVNGTPASFINGVLLVGAQPAERFAEII 234

Query: 223 D 223
           D
Sbjct: 235 D 235



 Score = 98.9 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 49/178 (27%), Gaps = 6/178 (3%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
                    G   A VTMV ++   C  C        K       K   +          
Sbjct: 286 VPVGDSPVRGADTALVTMVLFSDYQCPFCRRVTPTVEKLRAQYGDKLRVVWKDHPLPFHP 345

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
                A +      ++ +  +W     L   +    ++         +A     + N   
Sbjct: 346 RAEPAAELAREARAQKGNDAFWQANDRLLASEAALDDAAL-----EAVAADLRLNVNAVK 400

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             +        I+A    A +D     TP FFI G   +G      F  IID  I  +
Sbjct: 401 RAVASHKHAAKIEADVDLA-DDLGAQGTPHFFINGRSLVGAQPIEKFQAIIDEEIAKA 457



 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 59/210 (28%), Gaps = 4/210 (1%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
           A     T +      +            ++  P+     S G     V +  ++   C  
Sbjct: 459 AMVVAGTPRAKVYEAIQKQAVPPAPPPKVSVPPAPKGHPSKGAAAGKVVIQAFSDFQCPF 518

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           CA       + ++    K   +   L           A        ++   G+W    LL
Sbjct: 519 CARAAATMDELIKAFPGKVRVVYRHLPLPFHPEAQLAAEAAMEALAQKGPAGFWKMHDLL 578

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F       ++ N   A L     +            D++          +A+    I  T
Sbjct: 579 FK----VSDASNLDRAALEQHAASLGLDAARFAKALDEHTHRAAVEADAQAARSAGITGT 634

Query: 200 PVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           P F I G L  G      F K++   + ++
Sbjct: 635 PGFVINGYLVSGAQPLAKFKKVVRRALNEA 664


>gi|145592739|ref|YP_001157036.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
 gi|145302076|gb|ABP52658.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
          Length = 219

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 79/227 (34%), Gaps = 10/227 (4%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TR+ +   + L+ +        +  A+       G V+   L+      +      
Sbjct: 1   MTRNTRLTLAAVVALILVMVGVLAMNRRDAIPSAKTTGGAVEPAVLVREDSHRLTS---- 56

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             D  VT+VE+    C  CA  +    +         G++ +++R FP+ S     +   
Sbjct: 57  APDGRVTLVEFLDFECGPCAAAYPTVKEI---LADYEGQITFVVRYFPISSHPNAELAAR 113

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNIL 180
                     +     LLF  Q+ W      + +  L  A+  G   + F   L+D    
Sbjct: 114 AAESAANQDRFAEMYQLLFENQNAWSRQDEPQTEVFLGYARTLGLDIDRFQRDLDDPATA 173

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             +   +    E   +  TP FF+ G     D+ +   + +ID+ + 
Sbjct: 174 ARVAKDRTDG-EAVGVQGTPTFFLNGEPLS-DLRKDDLTTMIDAALA 218


>gi|88813278|ref|ZP_01128517.1| hypothetical protein NB231_07262 [Nitrococcus mobilis Nb-231]
 gi|88789450|gb|EAR20578.1| hypothetical protein NB231_07262 [Nitrococcus mobilis Nb-231]
          Length = 324

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/195 (18%), Positives = 70/195 (35%), Gaps = 7/195 (3%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
              +A     P    D  +G + AP+T++EY+   C +C  FH    + +E    K   +
Sbjct: 120 AKQQARQEVKPIQPDDHVLGDRSAPITLIEYSDYACPYCKRFHATAHRIVEHYQGKVNWV 179

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
                    +  +  A   A CA +      +   S    +++           L ++A 
Sbjct: 180 YRHFPLSSHNPGAERAAAGAECAAELGGNAAFWAFSDRIFQRERSTEGAFSAGELASLAA 239

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG------NLYLGDMSE 215
             G  +  F  CL+ +     ++A      E   I  TP  F+           +G    
Sbjct: 240 ELGLVRGQFKRCLDSERTRAAVRADVD-GGEQAGITGTPANFVYDNSSGATIAMVGARPY 298

Query: 216 GVFSKIIDSMIQDST 230
             F+++ID ++  S+
Sbjct: 299 EQFTRVIDQLLARSS 313


>gi|321312898|ref|YP_004205185.1| thiol-disulfide oxidoreductase [Bacillus subtilis BSn5]
 gi|320019172|gb|ADV94158.1| thiol-disulfide oxidoreductase [Bacillus subtilis BSn5]
          Length = 222

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 64/188 (34%), Gaps = 1/188 (0%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                  ++  PS      +G+ DAPVT+VE+    C  C  F++  F  ++  +I  G 
Sbjct: 33  TEQGNDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGD 92

Query: 101 LRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           +++           +      +    K     +W F   LF KQ D          L ++
Sbjct: 93  VKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDL 152

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           AK     K +      D+             ++   I +TP  ++   +           
Sbjct: 153 AKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIK 212

Query: 220 KIIDSMIQ 227
           + I+  ++
Sbjct: 213 ETIEKELK 220


>gi|73667389|ref|YP_303405.1| hypothetical protein Ecaj_0776 [Ehrlichia canis str. Jake]
 gi|72394530|gb|AAZ68807.1| conserved hypothetical protein [Ehrlichia canis str. Jake]
          Length = 239

 Score =  100 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 62/227 (27%), Positives = 95/227 (41%), Gaps = 9/227 (3%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPST-------MKDVS 59
           +  +LG +  L     FF     S   E        D    L+   +          D  
Sbjct: 2   KFLILGKLFCLLAMVSFFGVAFCSDSQEEITEKFYSDTLVKLSDDITAKKLLSLLPNDRF 61

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G   APV ++EYAS +C HCA F    F  LE KYIKTGK+ YI R             
Sbjct: 62  VGNTKAPVVIIEYASFSCMHCAHFTLNVFPELERKYIKTGKVLYIFR--NFPLDYVSLKA 119

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                       ++ +   +F+  +  + +      L N+AK +  S   F+ C+ND++I
Sbjct: 120 AMLGTCYNTASRFFTYTRAVFSSIEALVTNYKDLGVLSNIAKISNISDERFEKCINDEDI 179

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           ++ +   K  A+    +++TPVFFI G  Y        FS+ ID +I
Sbjct: 180 MNYVIQEKFVANRKLQVNATPVFFINGKKYDKSHDIESFSETIDELI 226


>gi|15891952|ref|NP_359666.1| hypothetical protein RC0029 [Rickettsia conorii str. Malish 7]
 gi|81854135|sp|Q92JN8|DSB_RICCN RecName: Full=Putative protein-disulfide oxidoreductase RC0029;
           Flags: Precursor
 gi|15619063|gb|AAL02567.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 277

 Score =  100 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 52/214 (24%), Positives = 89/214 (41%), Gaps = 7/214 (3%)

Query: 23  FFYTRKGSALNELPIPDGV----VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
                  +  +E+  P          +A+         D+ +G K + V +VEY S TC 
Sbjct: 60  IVPANDNNQTDEVSTPASQKQKNPAIKAVKVTFKVDDNDMVLGNKKSNVIVVEYFSPTCP 119

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
           HCA +H   F  L+ KYI T K+ Y++REF                 K     +    ++
Sbjct: 120 HCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDTNSFTQLHNI 177

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           +  +QD W  S  YR+ L ++ +  G S  ++  CLN+  I   + A     ++      
Sbjct: 178 ILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIG 237

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           TP FF+ G +  G+ S    S  +D  +++   +
Sbjct: 238 TPSFFVNG-VQTGNYSIDTISTAVDKALEEQKEK 270


>gi|119867539|ref|YP_937491.1| DSBA oxidoreductase [Mycobacterium sp. KMS]
 gi|119693628|gb|ABL90701.1| DSBA oxidoreductase [Mycobacterium sp. KMS]
          Length = 227

 Score =  100 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/229 (15%), Positives = 69/229 (30%), Gaps = 12/229 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +++ TR+ +   ++ +   +   +     +          V     LA          + 
Sbjct: 9   ILANTRVLLTIFVIAVATVATAVFLSVRDSG-----SAAEVALDGSLAGQTVRDNSHRLN 63

Query: 62  Q-KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
              D+ V  VE+    C  C   +    +    +     ++ ++LR FPL S        
Sbjct: 64  SVPDSDVYFVEFLDFECEGCRALYPVVEQL---RAEYGDRVNFVLRYFPLRSHFNAERAA 120

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNI 179
                    G        ++  Q  W   +    D     A+  G   + FD   ND   
Sbjct: 121 RAVEAAAQQGQLEAMYKKMYETQAQWGEQQVPADDVFRGFAQQLGLDMSTFDATYNDPAT 180

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           L+ I+      +    +  TP FFI         S    +  +D  +  
Sbjct: 181 LERIQLDISDGT-ALGVQGTPTFFINDERIQ-PRSYEDLTTALDQALAR 227


>gi|262195136|ref|YP_003266345.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
 gi|262078483|gb|ACY14452.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
          Length = 296

 Score =  100 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 57/210 (27%), Gaps = 9/210 (4%)

Query: 22  YFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCA 81
                  G AL     P        + A         S G  DA VT+V+     C  C 
Sbjct: 71  LALLEAFGDALGGAEPPSDEPGPETVFAVPVD--GSPSEGPADAKVTIVKAFEFACPFCE 128

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
                     E    +   +          +               M G +      +++
Sbjct: 129 RTRGTLSSIRERYGDEVRIVYKHFIVHQGQAEVPAQA----VCAASMQGKFTAMKDAIWD 184

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
           +  +     +  + L    +              +    + ++   + A     +  TP 
Sbjct: 185 RGFNQGGDLSEDNMLRQAKRLKLNM--KRFKSDMNGPCRERVQRDHQ-AMAQVGVSGTPY 241

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           FFI G L  G      F+ +ID+ +  + +
Sbjct: 242 FFINGRLLRGAQPLPAFTALIDAELAKAKQ 271


>gi|284167494|ref|YP_003405772.1| DSBA oxidoreductase [Haloterrigena turkmenica DSM 5511]
 gi|284017149|gb|ADB63099.1| DSBA oxidoreductase [Haloterrigena turkmenica DSM 5511]
          Length = 241

 Score = 99.7 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 79/234 (33%), Gaps = 16/234 (6%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
           +R   L G V+   A   +Y  +        +           A          +G  +A
Sbjct: 7   SRRAFLAGSVVTVGAGGAYYLSRSDDAA-HDLSPSFHSSDETSAFGVDLAGKPIMGSPEA 65

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+ +  +    C  C  F  +T   L   Y+  G +R +L   P     ++   +A    
Sbjct: 66  PIEIYYWTDFQCPFCERFERETLPELVRNYVGPGDVRIVLIALPYFGADSMTAAVASKCV 125

Query: 126 KRMDG-----GYWGFVSLLFNKQDDWIN-SKNYRDALLNMAKFAGFSKNDFDTCLND--Q 177
                      YW + + +F++Q +  +   +  + L           +  ++CL D   
Sbjct: 126 WEQVRNDDSSAYWDWHAAVFDQQGEKNSGWASTENLLEYTRSVDAVDADALESCLEDRRS 185

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIIDSM 225
            + D +++   RA+E   +  TP F +           +G      F + I+ +
Sbjct: 186 ELEDAVESDADRATE-LGVSGTPTFVVFDPESEAAGSLVGAQPLERFEEAIERI 238


>gi|184199898|ref|YP_001854105.1| Na(+)/H(+) antiporter [Kocuria rhizophila DC2201]
 gi|183580128|dbj|BAG28599.1| Na(+)/H(+) antiporter [Kocuria rhizophila DC2201]
          Length = 617

 Score = 99.7 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/225 (21%), Positives = 86/225 (38%), Gaps = 16/225 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +GVL  +VL     +  +        E        D   +L  +     D   G +DA
Sbjct: 403 ATLGVLVSMVLAVALGWLIFKIAAKRWGE-----ETADLPMVLDPTVDPEVDHIRGPEDA 457

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            +T+VEY    C +CA     T  + +        LRY++R  P      +A   +  A 
Sbjct: 458 KLTLVEYVDFECEYCAHA---TGSWEDLSAQFGEDLRYVVRHLPHHPHGPLAAKASEAAA 514

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            +    +W ++ L+F  QD        R  L+  A+  G + + F   ++ + + + +  
Sbjct: 515 IQG--EFWRWLDLVFTHQDALE-----RKHLIGYAEELGLNVDHFIHDIDSEAVAERVNR 567

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               A E     +TP FF+ G   LGD      +  ++S  + + 
Sbjct: 568 DVVSA-EASGAHATPTFFVEGRRLLGDYDARTLAAALESSRRGTR 611


>gi|238650342|ref|YP_002916194.1| Periplasmic thiol:disulfide interchange protein DsbA [Rickettsia
           peacockii str. Rustic]
 gi|238624440|gb|ACR47146.1| Periplasmic thiol:disulfide interchange protein DsbA [Rickettsia
           peacockii str. Rustic]
          Length = 277

 Score = 99.7 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/214 (23%), Positives = 87/214 (40%), Gaps = 7/214 (3%)

Query: 23  FFYTRKGSALNELPIPDGV----VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
                  +  +E+  P          + +         D+ +G K + V +VEY S TC 
Sbjct: 60  IVPANDNNQTDEVSTPASQKQKNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPTCP 119

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
           HCA +H   F  L+ KYI T K+ Y++REF                 K     +    ++
Sbjct: 120 HCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDTNSFTQLHNI 177

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           +  +QD W  S  YR+ L ++ +  G S  ++  CLN+  I   + A     ++      
Sbjct: 178 ILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIG 237

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           TP FF+ G +  G  S    S  +D  +++   +
Sbjct: 238 TPSFFVNG-VQTGSYSIDTISTAVDKALEEQKEK 270


>gi|297560312|ref|YP_003679286.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296844760|gb|ADH66780.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 281

 Score = 99.7 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 68/209 (32%), Gaps = 6/209 (2%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
              +   SA  +   PD       L    P      ++G+ DAPV MV Y+   C +C  
Sbjct: 75  AADSAPHSAGADDQTPDQREFGALLARRDP--EDPAAMGEVDAPVVMVAYSDYNCPYCGR 132

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
           +  +T   L     +      I          +   +        M GG+W F    F  
Sbjct: 133 WARETQPELMHYVERGDL--RIEWRDFPIITGSSETVSHAARAAGMQGGFWEFHEAYFTH 190

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
            + +       + L  +    G     F+   +   +   +      A +   + STP F
Sbjct: 191 GEKFEGEAL-EEVLDGIVAELGMDPERFEEDRHGDEVASMVSRDFAEA-QGIGVTSTPAF 248

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + G   +G     VF   I+  + D+ R
Sbjct: 249 LVNGQPLMGAQPLSVFVSAIEDALADAGR 277


>gi|170744954|ref|YP_001773609.1| DSBA oxidoreductase [Methylobacterium sp. 4-46]
 gi|168199228|gb|ACA21175.1| DSBA oxidoreductase [Methylobacterium sp. 4-46]
          Length = 214

 Score = 99.7 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 68/190 (35%), Positives = 98/190 (51%), Gaps = 3/190 (1%)

Query: 37  IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
           +P             P  + DV +G  +A  T++EYASMTC HCA FH  T+  L++++I
Sbjct: 26  LPALAQAASPDALMQPGPLGDVWLGPAEAKCTIIEYASMTCSHCAAFHKTTWPALKERWI 85

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
            TGK+R+ LREFPLD    +A      A       Y+    LLF++Q  W       DAL
Sbjct: 86  DTGKVRFTLREFPLD---PLATAAFMLARADDSARYYPITDLLFDQQPTWAFVPKPLDAL 142

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
             M + AGFS+  F+  L DQ + D I   K+R    F + +TP FFI G  + G++S  
Sbjct: 143 EQMMRQAGFSREKFEATLKDQKLYDAINTVKERGMAVFKVTATPTFFINGQKFQGEVSIE 202

Query: 217 VFSKIIDSMI 226
              K+I  ++
Sbjct: 203 GLEKVIKPIV 212


>gi|239932926|ref|ZP_04689879.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
 gi|291441276|ref|ZP_06580666.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
 gi|291344171|gb|EFE71127.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
          Length = 607

 Score = 99.7 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 73/220 (33%), Gaps = 13/220 (5%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           +   +GVL   +L  +  +  +        E        D    L        D   G  
Sbjct: 392 TRATVGVLLAALLSALLGWVVFHLAAVLRGETEA-----DLPRFLDRPVDPATDHVTGPP 446

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           DAP+T+VEY    C  CA       +  +    +   +   L    +   S +A   A  
Sbjct: 447 DAPLTLVEYGDFECPFCARATGVAQELRQRFGDRLRYVFRHLPLLDVHPHSELAARAAVA 506

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           A+ +    +W    LLF  QD         + +L  A   G     F   L+ +     +
Sbjct: 507 ADAQG--RFWQMHDLLFAHQDQLEF-----EDILGYAGQIGLDVERFLEDLDSERTAARV 559

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           +A    A E      TP FF+G   + G       ++ ++
Sbjct: 560 RADVASA-EASGARGTPTFFLGSRRHTGPYDAQTLARELE 598


>gi|149919899|ref|ZP_01908374.1| thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149819172|gb|EDM78606.1| thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 481

 Score = 99.7 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 70/218 (32%), Gaps = 12/218 (5%)

Query: 18  FIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTC 77
             A   +          +   D   +                 G  DAP+T+V ++   C
Sbjct: 257 VAAGELYDYATQWGYTAIEYTDARPELDEDSVYPVPIGSSRVRGPADAPITIVAFSDFQC 316

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS 137
             CA  H            +   +R++ + FPL      A+          D  +W F  
Sbjct: 317 PFCARGHATMEALRARYGDE---VRFVFKHFPLPGHPLGALASRASFAATSDEQFWAFHD 373

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
            +F        ++     LL + +  G  +   +  +  +     I+A  +   E   + 
Sbjct: 374 AVFA-----TGARYEAQDLLRIGRELGMDQVALEEAMLGEQNDATIEADLELG-EALGLT 427

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSMI---QDSTRR 232
            TP +FI G   +G +    F  +I   +   +++  +
Sbjct: 428 GTPAYFINGRPIVGAVPLLDFRMLIAEELARVEEAKAQ 465



 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/191 (20%), Positives = 70/191 (36%), Gaps = 10/191 (5%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
           P P+ +      L          S G  DAPVT+V ++   C +C             + 
Sbjct: 66  PDPEQIAAGVPYLRFRIDVSDSPSRGPADAPVTIVMFSDFECPYC---DEALATVASVEA 122

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
              G++R++ +  PL++              R  G +W +          +         
Sbjct: 123 EYAGQIRFVYKAMPLNTHPNALTAALIGHSARAQGKFWEWHD------RVFSGRGIDELT 176

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           L          +      L++      ++A   RA++   + STPVFFI G +  G  S+
Sbjct: 177 LDRYIAELELDRERVTRELDELAYAPAVRADL-RAAKRLRLRSTPVFFINGRMLAGARSK 235

Query: 216 GVFSKIIDSMI 226
           GVFS +++  +
Sbjct: 236 GVFSHMVEQEL 246


>gi|83594579|ref|YP_428331.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
 gi|83577493|gb|ABC24044.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
          Length = 217

 Score = 99.7 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 89/171 (52%), Gaps = 4/171 (2%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           + ++G  DA VT+VEY+S+ C HCA+FH +    L+ +YI TGK+R + ++  L     V
Sbjct: 48  ERALGSPDAKVTIVEYSSLLCPHCADFHTQILPELKKEYIDTGKVRLVFKDHSLGQPLAV 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
              +        +  ++  ++ LF  Q  W  +K+   AL   A  AG  K   + CL++
Sbjct: 108 GASVIARCAPEQN--FFPLITTLFANQRTWATAKDPLAALQGYAALAGMDKAAVEACLDN 165

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY-LGDMSEGVFSKIIDSMI 226
           Q++ + ++AG+  A     ++STP F I G    +G      F K++D ++
Sbjct: 166 QDVFNGVQAGEAEAG-RIGVESTPSFVIDGKPVLVGAQPIEAFRKVLDPLV 215


>gi|229586255|ref|YP_002844756.1| Protein-disulfide isomerase [Rickettsia africae ESF-5]
 gi|228021305|gb|ACP53013.1| Protein-disulfide isomerase [Rickettsia africae ESF-5]
          Length = 277

 Score = 99.3 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/214 (23%), Positives = 87/214 (40%), Gaps = 7/214 (3%)

Query: 23  FFYTRKGSALNELPIPDGV----VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
                  +  +E+  P          + +         D+ +G K + V +VEY S TC 
Sbjct: 60  IVPANDNNQTDEVSTPASQKQKNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPTCP 119

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
           HCA +H   F  L+ KYI T K+ Y++REF                 K     +    ++
Sbjct: 120 HCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDTNSFTQLHNI 177

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           +  +QD W  S  YR+ L ++ +  G S  ++  CLN+  I   + A     ++      
Sbjct: 178 ILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIG 237

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           TP FF+ G +  G  S    S  +D  +++   +
Sbjct: 238 TPSFFVNG-VQTGSYSIDTISTAVDKALEEQKEK 270


>gi|120404214|ref|YP_954043.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
 gi|119957032|gb|ABM14037.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
          Length = 228

 Score = 99.3 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 70/228 (30%), Gaps = 10/228 (4%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +++ TR+ +   ++ + +     +       +   I          +  +   +  V   
Sbjct: 9   ILANTRVLLTVFVIAVAMVGTVVFLSVRDKDSAPDIALDGSPAGQTVRENSHRLNSV--- 65

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             D+ V  VE+    C  C   +    +    +     ++ ++LR FPL S         
Sbjct: 66  -PDSEVYFVEFLDFECEGCRALYPAVEQL---RAEYGDRVNFVLRYFPLRSHFNAERAAR 121

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                   G        ++  Q  W   +    D     A+  G     FD   ND   L
Sbjct: 122 AVEAAAQQGQLEAMYRKMYETQAQWGEKQIPADDVFRGFAQQLGLDMEAFDATYNDPATL 181

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + I+      +    +  TP FFI         S    +  +D  ++ 
Sbjct: 182 ERIQLDIADGT-ALGVQGTPTFFINDERIQ-PRSYDDLTTALDQALER 227


>gi|289768468|ref|ZP_06527846.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gi|289698667|gb|EFD66096.1| conserved hypothetical protein [Streptomyces lividans TK24]
          Length = 270

 Score = 99.3 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 66/181 (36%), Gaps = 1/181 (0%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D   L  A       ++IG+ DAPV ++EY+   C  C  F  +T   L   Y+  G LR
Sbjct: 74  DEGLLALARRDASDPLAIGRADAPVVLIEYSDFQCPFCGRFARETKPELLRSYVDKGTLR 133

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
              R FP+    +    LA  A  R +  +          ++    + +  + +    + 
Sbjct: 134 IEWRNFPIFGEESEQAALAGWAAGRQNKFWEFHDVAYGKPRERNTGAFDAENLVAMAREA 193

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
                  F   +        ++A ++       + STP F + G   LG      F + +
Sbjct: 194 GIADIERFQADMASDEARGAVRADQEEGY-TLGVTSTPAFLVNGRPILGAQPTDTFEEAV 252

Query: 223 D 223
           +
Sbjct: 253 E 253


>gi|94967189|ref|YP_589237.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
 gi|94549239|gb|ABF39163.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
          Length = 313

 Score = 99.3 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/217 (18%), Positives = 71/217 (32%), Gaps = 12/217 (5%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
           F  ++ G  L  L   D   D      A          G KDA VT+V Y    C  CA 
Sbjct: 88  FLLSKDGKTLARLSKIDLSKDPYEENMAKIDIANRPVRGNKDAKVTIVNYDDFECPFCAR 147

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
            H++    L+    K   +        +   +  A + + C   +    YW F   + + 
Sbjct: 148 MHSELVNVLKQYGDKVRIIYKDYPLTEIHPWADRAAVDSNCIASQNTDAYWDFADYVHSN 207

Query: 143 QDDWI-----------NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           Q                 +      L++ +    + +    C+ +Q+    +K     A 
Sbjct: 208 QPAITGKKEEHRSVAAMQEAVDKVTLDIGRKHSLNVDQLQACIKNQSESAALKKSVSEA- 266

Query: 192 EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               + +TP  F+ G    G + E     +I   +Q+
Sbjct: 267 NGLDVSATPTMFVNGEKLEGAIEEDALIDVIKKHLQE 303


>gi|240169146|ref|ZP_04747805.1| DSBA oxidoreductase [Mycobacterium kansasii ATCC 12478]
          Length = 260

 Score = 99.3 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 70/181 (38%), Gaps = 2/181 (1%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
           A  PS    ++ G   APV + E+    C  C  F   +   L   Y++TGK+R+   + 
Sbjct: 81  AHQPSEGDALARGSVSAPVVVAEWGDFQCPFCRAFDLDSQPVLIGDYVQTGKVRFEWHDL 140

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
                 +V +           G +W F    +  Q    +      +L+ MA+ AG   +
Sbjct: 141 AKLGPESV-LAARGARAAARQGAFWAFHDAFYRDQAPENSGAVTEQSLMAMARNAGLDVD 199

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            F   L D  I D ++  +  A +   I   P F +   L +G  S     ++ID+    
Sbjct: 200 RFVADLADPAIADAVERDRSDARQ-LGITHVPSFLVNDELLIGAQSLDTLRRVIDAAAVK 258

Query: 229 S 229
           +
Sbjct: 259 A 259


>gi|162448783|ref|YP_001611150.1| disulfide bond formation protein D precursor [Sorangium cellulosum
           'So ce 56']
 gi|161159365|emb|CAN90670.1| possible Disulfide bond formation protein D precursor [Sorangium
           cellulosum 'So ce 56']
          Length = 853

 Score = 99.3 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 56/211 (26%), Gaps = 8/211 (3%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
            Y   + +  A    P P                      G   APVT+V ++   C  C
Sbjct: 248 VYAALSEQNKAPAPAPKPPSPPAPEDTTVWKVPVDGSPIRGNPGAPVTLVMFSDFECPFC 307

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
            +         +    +   +               A +      ++ D  +W    LL 
Sbjct: 308 RKVAPTVDGLEKKYGAQLRVVFKHNPLPFHRRAEPAAELALEAKAQKGDAAFWKAYELLK 367

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
               +  +   +  +L      A  +                     +R ++D     TP
Sbjct: 368 TGPLEDADLAAHAKSLGLDVARAQRAIAARRHAAR--------IERDQRLADDLQARGTP 419

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            FFI G    G      F  +ID  I  + +
Sbjct: 420 HFFINGRRLAGAQPAEKFEALIDEQIARAAK 450



 Score = 98.1 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/200 (15%), Positives = 52/200 (26%), Gaps = 7/200 (3%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                 +            A P T  +   G+  APVT+V +    C   +       + 
Sbjct: 42  PAPSPTVAVAAEPEPEPGTAVPVTRAEPWWGEPLAPVTLVVWGDFECPFTSRHMATLEQL 101

Query: 91  LEDKYIKT-GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            +         +          +     +             +W F  L F  Q      
Sbjct: 102 KQAYGPDRLRIVWRHFPLAFHKNARPAHLAAETVFRLGGAEAFWKFHRLAFANQRALTP- 160

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
                +    A  AG  +  F    + Q     I      A +   I  TP  F+ G   
Sbjct: 161 ----ASFEAWAAEAGVDRAAFRAAFDGQRHAPKIDRDL-EAGQSVGIHGTPATFVNGVFV 215

Query: 210 LGDMSEGVFSKIIDSMIQDS 229
            G      F  ++D  ++ +
Sbjct: 216 SGAWPVDKFRTLVDEQLRAA 235



 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/204 (19%), Positives = 61/204 (29%), Gaps = 5/204 (2%)

Query: 22  YFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG-QKDAPVTMVEYASMTCFHC 80
               T      + L       D    + A   T  +   G +  A VT+  +A   C  C
Sbjct: 452 VAAGTPAAKVYDALQKDARAGDPPERILAPAPTRDNPGKGAKPGAKVTIQMFADFECPFC 511

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
                     +     K   +   L           A        ++ + G+W     L+
Sbjct: 512 MRVQATIDGIIAAYPGKVRVVFRHLPLPSHSRAPLAAEASIEAFRQKGEAGFWAMAQRLW 571

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
             Q +       R+AL   A   G     F   L+       ++A +K A E   I  TP
Sbjct: 572 QDQSENG---LGREALERHAAAIGLDVAKFGAALDSGAHRAAVEADRKLA-ERLHITGTP 627

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDS 224
            F I      G  S   F +++D 
Sbjct: 628 SFAINDYFLGGAQSTRHFKRLVDQ 651


>gi|34581010|ref|ZP_00142490.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262395|gb|EAA25899.1| unknown [Rickettsia sibirica 246]
          Length = 277

 Score = 99.3 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 51/214 (23%), Positives = 87/214 (40%), Gaps = 7/214 (3%)

Query: 23  FFYTRKGSALNELPIPDGV----VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
                  +  +E+  P          + +         D+ +G K + V +VEY S TC 
Sbjct: 60  IVPANDNNQTDEVSTPASQKQKNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPTCP 119

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
           HCA +H   F  L+ KYI T K+ Y++REF                 K     +    ++
Sbjct: 120 HCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDTNSFTQLHNI 177

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           +  +QD W  S  YR+ L ++ +  G S  ++  CLN+  I   + A     ++      
Sbjct: 178 ILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIG 237

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           TP FF+ G +  G  S    S  +D  +++   +
Sbjct: 238 TPSFFVNG-VQTGSYSIDTISTAVDKALEEQKEK 270


>gi|260901471|ref|ZP_05909866.1| dsba oxidoreductase [Vibrio parahaemolyticus AQ4037]
 gi|308107699|gb|EFO45239.1| dsba oxidoreductase [Vibrio parahaemolyticus AQ4037]
          Length = 262

 Score = 98.9 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 75/199 (37%), Gaps = 15/199 (7%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
             P                     +G KDA + ++E++   C +C  F +  FK +++ Y
Sbjct: 63  NPPKKEPPTLPNQPNFTEDGTLPLLGSKDAKIAIIEFSDFQCPYCKRFTDSAFKQIKENY 122

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           I TGK++YI R+FPL   +                 YW    +LF+   D  +    +  
Sbjct: 123 IDTGKVQYIARDFPLSFHAKAMGAAIAATCSLQQNSYWPMRDMLFSNVKDLGDELYQKA- 181

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI----GGNL--- 208
               A     +  +F+ C+ DQ+I + ++       +   I  TP F I       L   
Sbjct: 182 ----ATDLSLNLEEFNKCMKDQSIANKVEQDLTLG-KSLGIRGTPSFLIGRVENDQLVEP 236

Query: 209 --YLGDMSEGVFSKIIDSM 225
              +G     VF  +++ +
Sbjct: 237 QIVVGAQRYAVFESLLEQL 255


>gi|167624423|ref|YP_001674717.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
 gi|167354445|gb|ABZ77058.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
          Length = 266

 Score = 98.9 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 73/183 (39%), Gaps = 15/183 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
              G   A + ++E++   C +C  F ++TF  L+  YI TGK++Y+ R+FPL+      
Sbjct: 85  PLQGDATAQLAIIEFSDYQCPYCKRFIDQTFTKLKSNYIDTGKVQYLTRDFPLNFHPKAK 144

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                         YW     LF         +   +    +A         F+ CL D+
Sbjct: 145 GAAIAANCSLQQDAYWPMRDSLFKN-----MKQLDDELYQQIASNLSLDMTKFNACLADE 199

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFI----GG-----NLYLGDMSEGVFSKIIDSMIQD 228
            +L+ ++      S    I  TP F I     G      L +G  S   F++++D ++ +
Sbjct: 200 QMLNKVQQDVAYGSS-LGIRGTPSFVIGRVENGQLISPKLIVGAQSYQTFARLLDELLAN 258

Query: 229 STR 231
             +
Sbjct: 259 PKK 261


>gi|322434882|ref|YP_004217094.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
 gi|321162609|gb|ADW68314.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
          Length = 174

 Score = 98.9 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 60/175 (34%), Gaps = 6/175 (3%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P   KD + G  DAP+T+VEY    C  C   +    K       +   +        + 
Sbjct: 6   PVGPKDHTQGPTDAPITLVEYGDFQCPSCGSAYTVVKKLQRHFGKRLRFVFRHFPLTDMH 65

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            ++  A   A  A    +  +W    LLF  Q          D   ++A+         +
Sbjct: 66  PMAEPAAEAAEYAATESEEKFWAMHDLLFENQQTLST-----DLFADLAEELELDATKLE 120

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             ++       I A  +   +   +  TP F+I G+ +         S+ I++ +
Sbjct: 121 KAVHTHKFKSRIAADLESG-DASGLTGTPTFYINGHQHKTAYDYTTLSEAIETAL 174


>gi|218295130|ref|ZP_03495966.1| DSBA oxidoreductase [Thermus aquaticus Y51MC23]
 gi|218244333|gb|EED10858.1| DSBA oxidoreductase [Thermus aquaticus Y51MC23]
          Length = 208

 Score = 98.9 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 77/186 (41%), Gaps = 3/186 (1%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
                  P+     ++G++DAP+ +V++++  C  C +        L+ +Y+ TGK+RY+
Sbjct: 24  PKGKNLDPAQGARFALGREDAPIVVVDFSNYLCGFCQQHALNVLPRLKAEYVDTGKVRYL 83

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS--LLFNKQDDWINSKNYRDALLNMAKF 162
            R+FP      V       A     G Y+ +        +    +  +     L+++A  
Sbjct: 84  FRDFPFPGQDQVIRAGEAAACAHEQGRYYEYHEVLFRAAQAWGNLRGQALDRYLVDLAGQ 143

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G     F +CL    +   + A ++ A +D  +  TP FFI G    G M    +  ++
Sbjct: 144 LGLDTGAFQSCLASGRMRQGVLADQQLA-QDLGLTGTPTFFIAGEKRTGFMPYEEWKALL 202

Query: 223 DSMIQD 228
           D  +  
Sbjct: 203 DKALAK 208


>gi|167933057|ref|ZP_02520144.1| Na+/H+ antiporter, NhaA family protein [candidate division TM7
           single-cell isolate TM7b]
          Length = 229

 Score = 98.9 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 73/232 (31%), Gaps = 7/232 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M+     + G   +  +A   F +++ S           +  +       S + D + G 
Sbjct: 1   MNAKTWIIFGAASIAILAGLIFLSKQNSLDVSNVDKFKTIISQQDADNVKSGIPDRTNGN 60

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           KDA + ++EY   +C  C        K L+D   +   +                +  A 
Sbjct: 61  KDAKIVLIEYGDYSCPGCTTLEGNIKKVLKDYGKEISVVFRHF--PITSIHPNSKIAAAY 118

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWI--NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                + G +W     LF+ + DW   ++          AK  G   +     ++   + 
Sbjct: 119 AEAAGLQGKFWEMHDKLFSNRTDWSGVSADKRDKIFDEYAKQLGLDMDKLKKDISSNKVA 178

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD--MSEGVFSKIIDSMIQDST 230
             I   +    +   +  TP  F+ G     +   +E      I   I+ + 
Sbjct: 179 QKIAFDQAIG-KASGVSGTPSVFLNGRSLKQNEFSNETELRNTIKQAIESTK 229


>gi|326331477|ref|ZP_08197767.1| putative thioredoxin domain protein (DSBA) [Nocardioidaceae
           bacterium Broad-1]
 gi|325950733|gb|EGD42783.1| putative thioredoxin domain protein (DSBA) [Nocardioidaceae
           bacterium Broad-1]
          Length = 223

 Score = 98.9 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 67/224 (29%), Gaps = 8/224 (3%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK-DA 65
           ++ ++  +V   + +              P   G     +  +          IG++  +
Sbjct: 6   KVSLIVAVVFAVLTAVMLVVAGRDDGEANPADPGDPSAASETSRLV-RDDSRIIGKRGTS 64

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            V +VE+    C  C   +         +     ++ ++ R FPL               
Sbjct: 65  DVVLVEFLDFECEACGAAYPIVEDL---REKYGDQVTFVARYFPLPGHFNSERAARSVES 121

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSK-NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
               G +    S ++ KQ  W   +    D     A+  G     +D     + +   ++
Sbjct: 122 AARQGKFDEMYSKMYEKQGSWGEKQVPMDDLFRQYAEEIGLDMAKYDADYASEEVAARVR 181

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
              +  +    +  TP FF+ G       S   F   I   + +
Sbjct: 182 RDVEDGT-AVGVQGTPTFFLNGEPLEPA-SVEDFEAAIVEALAE 223


>gi|256784583|ref|ZP_05523014.1| hypothetical protein SlivT_08843 [Streptomyces lividans TK24]
          Length = 231

 Score = 98.9 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 66/181 (36%), Gaps = 1/181 (0%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D   L  A       ++IG+ DAPV ++EY+   C  C  F  +T   L   Y+  G LR
Sbjct: 35  DEGLLALARRDASDPLAIGRADAPVVLIEYSDFQCPFCGRFARETKPELLRSYVDKGTLR 94

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
              R FP+    +    LA  A  R +  +          ++    + +  + +    + 
Sbjct: 95  IEWRNFPIFGEESEQAALAGWAAGRQNKFWEFHDVAYGKPRERNTGAFDAENLVAMAREA 154

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
                  F   +        ++A ++       + STP F + G   LG      F + +
Sbjct: 155 GIADIERFQADMASDEARGAVRADQEEGY-TLGVTSTPAFLVNGRPILGAQPTDTFEEAV 213

Query: 223 D 223
           +
Sbjct: 214 E 214


>gi|229918259|ref|YP_002886905.1| thiol-disulfide oxidoreductase [Exiguobacterium sp. AT1b]
 gi|229469688|gb|ACQ71460.1| thiol-disulfide oxidoreductase [Exiguobacterium sp. AT1b]
          Length = 218

 Score = 98.9 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 24/229 (10%), Positives = 65/229 (28%), Gaps = 16/229 (6%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M   ++ V+  IV + + +  F              D             S     ++G 
Sbjct: 1   MKKNQLLVILTIVAVALIALVFVLLNQDESTTAERGD-----------HVSIEGQPTLGN 49

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-----VA 117
            DA +++VE+    C  C ++    +  L+  Y+    + +           +      +
Sbjct: 50  PDAKISVVEFGDYKCPSCKQWGETIYPQLKADYLDKEDVSFSYINVLFHGQESILASLAS 109

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             +     +     +          Q                ++        F+  L ++
Sbjct: 110 ESVYEQDPESFWKFHKALYDAQPESQQHDNAWVTVEKLKEIASETTSVDLAKFEQDLGEE 169

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           + + +  +      ++  +  TP   I G +           ++I+  +
Sbjct: 170 STVLEKVSTDDGLVKENGVQFTPSIMINGVMLEDPFDYEKIQELIEQDL 218


>gi|209523914|ref|ZP_03272466.1| DSBA oxidoreductase [Arthrospira maxima CS-328]
 gi|209495586|gb|EDZ95889.1| DSBA oxidoreductase [Arthrospira maxima CS-328]
          Length = 251

 Score = 98.9 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 58/186 (31%), Gaps = 8/186 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
            +             ++G  DA + +VE++   C  C   H    +++     +   +  
Sbjct: 74  QQMKTQPRAIIGDSPTLGAADAEIVLVEFSDFQCPFCRRAHGTIREFMNRHQDQVTLVFK 133

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
            L    + S              +  G +W + + LF  QDD   +     A+       
Sbjct: 134 HLPLSQIHSE--ALPAAKASWAAQQQGKFWEYQNALFEGQDDLGEALYEAIAISLGLDL- 190

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
                 F+   N    +  I+   + AS    I  TP F + G    G +      + + 
Sbjct: 191 ----EQFNRDRNSDGAIAAIEQDLQLAS-VLGISGTPFFIMNGETLSGAVDLSTLEETLA 245

Query: 224 SMIQDS 229
            +I   
Sbjct: 246 EVIARE 251


>gi|297568436|ref|YP_003689780.1| DSBA oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
 gi|296924351|gb|ADH85161.1| DSBA oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
          Length = 286

 Score = 98.9 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/212 (16%), Positives = 70/212 (33%), Gaps = 12/212 (5%)

Query: 19  IASYFFYTRKGSALNELPIPDGVVDFRALL--AASPSTMKDVSIGQKDAPVTMVEYASMT 76
           I++             +      V     L  A   +T     +G+ DAPV +VE++   
Sbjct: 85  ISAVGLQRAGIPEKIVVTGSASGVVQELSLRFALQINTEGAPFLGRADAPVEIVEFSDFQ 144

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C HCA       + +        +++ + + FPL                +  G +W F 
Sbjct: 145 CPHCARVKPLIEQIM---LQFPDQVKVVFKHFPLSFHEYAKPAALATMAAQNQGKFWEFH 201

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
             LF  Q +          +  +A+        F+  L  + +   ++   +   +   +
Sbjct: 202 DKLFAAQSEISP-----QRIRAIARELELDMERFNRDLQSRELHSRLEQDIQDGQQA-GV 255

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             TP  F+ G L     S     ++++  +  
Sbjct: 256 RGTPTIFVNGMLLE-QRSPENLRQMVEEALAR 286


>gi|28900849|ref|NP_800504.1| hypothetical protein VPA0994 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836907|ref|ZP_01989574.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260362538|ref|ZP_05775458.1| dsba oxidoreductase [Vibrio parahaemolyticus K5030]
 gi|260879217|ref|ZP_05891572.1| dsba oxidoreductase [Vibrio parahaemolyticus AN-5034]
 gi|260896752|ref|ZP_05905248.1| dsba oxidoreductase [Vibrio parahaemolyticus Peru-466]
 gi|28809295|dbj|BAC62337.1| putative membrane protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749865|gb|EDM60610.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308087287|gb|EFO36982.1| dsba oxidoreductase [Vibrio parahaemolyticus Peru-466]
 gi|308094101|gb|EFO43796.1| dsba oxidoreductase [Vibrio parahaemolyticus AN-5034]
 gi|308115242|gb|EFO52782.1| dsba oxidoreductase [Vibrio parahaemolyticus K5030]
          Length = 262

 Score = 98.5 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 74/199 (37%), Gaps = 15/199 (7%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
             P                     +G KDA + ++E++   C +C  F +  FK +++ Y
Sbjct: 63  NPPKKEPPTLPNQPNFTEDGTLPLLGSKDAKIAIIEFSDFQCPYCKRFTDSAFKQIKENY 122

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           I TGK++YI R+FPL   +                 YW    +LF+   D        + 
Sbjct: 123 IDTGKVQYIARDFPLSFHAKAMGAAIAATCSLHQNSYWPMRDMLFSNVKDLG-----EEL 177

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI----GGNLY-- 209
               A     +  +F+ C+ D++I + ++       +   I  TP F I       L   
Sbjct: 178 YQKAATDLSLNLEEFNKCMKDKSIANKVEQDLTLG-KSLGIRGTPSFLIGRVENDQLIEP 236

Query: 210 ---LGDMSEGVFSKIIDSM 225
              +G     VF  +++ +
Sbjct: 237 QIVVGAQRYAVFESLLEQL 255


>gi|328470754|gb|EGF41665.1| hypothetical protein VP10329_08137 [Vibrio parahaemolyticus 10329]
          Length = 262

 Score = 98.5 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 79/199 (39%), Gaps = 18/199 (9%)

Query: 39  DGVVDFRALLAASPSTMKD---VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
           +        L   P+  +D     +G KDA + ++E++   C +C  F +  FK +++ Y
Sbjct: 63  NQPKKEPPTLPNQPNFTEDGTLPLLGSKDAKIAIIEFSDFQCPYCKRFTDSAFKQIKENY 122

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           I TGK++YI R+FPL   +                 YW    +LF+   D        + 
Sbjct: 123 IDTGKVQYIARDFPLSFHAKAMGAAIAATCSLHQNSYWPMRDMLFSNVKDLG-----EEL 177

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI----GGNL--- 208
               A     +  +F+ C+ D++I + ++       +   I  TP F I       L   
Sbjct: 178 YQKAAADLSLNLEEFNKCMKDKSIANKVEQDLTLG-KSLGIRGTPSFLIGRVENDQLVEP 236

Query: 209 --YLGDMSEGVFSKIIDSM 225
              +G     VF  +++ +
Sbjct: 237 QIVVGAQRYAVFESLLEQL 255


>gi|289642294|ref|ZP_06474443.1| Na+/H+ antiporter NhaA [Frankia symbiont of Datisca glomerata]
 gi|289507929|gb|EFD28879.1| Na+/H+ antiporter NhaA [Frankia symbiont of Datisca glomerata]
          Length = 627

 Score = 98.5 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 48/228 (21%), Positives = 78/228 (34%), Gaps = 11/228 (4%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKG--SALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
            +IG+L   +   + S+  +   G   A        GV +    LA      +D   G  
Sbjct: 409 AKIGILAAALAASVLSWIVFQVAGMLPARMRARAERGVSEIIIDLAEPVDPERDRIRGPL 468

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           DAPVT+VEY    C +C        + L   +     +   L    +   +  A +    
Sbjct: 469 DAPVTLVEYGDFECPYCGRAEAVVRELL-ADFGDLRYVWRHLPLTKVHPHAEYAAIAVEA 527

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           A ++    +W    LLF++Q            LL  A   G     F   L  +   D +
Sbjct: 528 AAEQG--AFWEMHDLLFDRQSALTVRD-----LLRYAGELGLDLERFRADLRARAGADRV 580

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +     A +   +  TP FFI G  + G       +  I +  Q   +
Sbjct: 581 ERDIASA-DVSDVSGTPTFFINGRRHHGAYDAATLTLAITAARQTVRQ 627


>gi|229134023|ref|ZP_04262843.1| hypothetical protein bcere0014_29380 [Bacillus cereus BDRD-ST196]
 gi|228649358|gb|EEL05373.1| hypothetical protein bcere0014_29380 [Bacillus cereus BDRD-ST196]
          Length = 226

 Score = 98.5 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 88/228 (38%), Gaps = 15/228 (6%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           ++ ++  +++    + F    K   +              ++   P   K  ++G++DAP
Sbjct: 10  KLLLITTLIIFAAVTAFVVLNKEDKVATN----------KVIKNLPPIGKQPTLGKEDAP 59

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY--ILREFPLDSVSTVAVMLARCA 124
           V+++E+    C  C  +  + F  L+  YI TGK+++  +   F        A+      
Sbjct: 60  VSVIEFGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLFHGTESKLSALAAESVY 119

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDD 182
           ++     +     L   + ++  +     + LL +AK    S N    +  L  Q   ++
Sbjct: 120 KQDPQAYWSFHKELFNAQPENHDDPWITPEKLLEIAKTYTPSINTLQLEEDLKKQTTQEE 179

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           +    +  ++D+ ++ TP   + G +            +I+  ++D  
Sbjct: 180 VNKD-ENLTQDYGVEQTPSIVLNGTMLSDPYDYEQIKNLIEKTLKDKK 226


>gi|289583411|ref|YP_003481821.1| DSBA oxidoreductase [Natrialba magadii ATCC 43099]
 gi|289532909|gb|ADD07259.1| DSBA oxidoreductase [Natrialba magadii ATCC 43099]
          Length = 242

 Score = 98.5 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 83/237 (35%), Gaps = 15/237 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           + +R  VL G VL       +Y  +        +   +       A         ++G  
Sbjct: 5   TPSRRAVLAGSVLALGGGSTYYLFQSRTDATHDLSPTLHASEDTSALGVDLAGKPTMGSP 64

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            AP+ +  +    C +C +F  +T   L   Y  +G +R +    PL    ++   +A  
Sbjct: 65  AAPLEIYYWTDFQCPYCEQFERETLPDLVADYTDSGDVRIVFIMLPLFGSDSMTAAVASR 124

Query: 124 AEKRMDGG-----YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                        YW + + +F+ QD+  +     D LL + +       D      +Q+
Sbjct: 125 CVWEQIRESDPDSYWDWHAAVFDAQDERNSGWAGTDNLLEITESVPAVDADALATCLEQD 184

Query: 179 ---ILDDIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIIDSMI 226
              I D ++A   +A + F I STP F +           +G      F   I+ + 
Sbjct: 185 RSRIEDAVEADAAQA-QSFGIHSTPTFVVFDPETEAAGTLVGAQPNERFDDAIEQIR 240


>gi|108798439|ref|YP_638636.1| DSBA oxidoreductase [Mycobacterium sp. MCS]
 gi|108768858|gb|ABG07580.1| DSBA oxidoreductase [Mycobacterium sp. MCS]
          Length = 313

 Score = 98.5 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/229 (15%), Positives = 69/229 (30%), Gaps = 12/229 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +++ TR+ +   ++ +   +   +     +          V     LA          + 
Sbjct: 95  ILANTRVLLTIFVIAVATVATAVFLSVRDSG-----SAAEVALDGSLAGQTVRDNSHRLN 149

Query: 62  Q-KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
              D+ V  VE+    C  C   +    +    +     ++ ++LR FPL S        
Sbjct: 150 SVPDSDVYFVEFLDFECEGCRALYPVVEQL---RAEYGDRVNFVLRYFPLRSHFNAERAA 206

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNI 179
                    G        ++  Q  W   +    D     A+  G   + FD   ND   
Sbjct: 207 RAVEAAAQQGQLEAMYKKMYETQAQWGEQQVPADDVFRGFAQQLGLDMSTFDATYNDPAT 266

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           L+ I+      +    +  TP FFI         S    +  +D  +  
Sbjct: 267 LERIQLDISDGT-ALGVQGTPTFFINDERIQ-PRSYEDLTTALDQALAR 313


>gi|260906414|ref|ZP_05914736.1| DSBA oxidoreductase [Brevibacterium linens BL2]
          Length = 247

 Score = 98.5 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 76/233 (32%), Gaps = 11/233 (4%)

Query: 5   TTRIGVLGGIVLLFIA--------SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMK 56
            T I V   +VL+ +         S      K    N +       + + L         
Sbjct: 17  LTVIAVALALVLMILLMDREQNNESAQTTAGKQKEPNVVVTEVEDPEQKDLSDFDTDDDD 76

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
            ++ G  DAPVT+V ++   C +CA +   T   + D          I         S  
Sbjct: 77  PLADGPVDAPVTLVVFSDYQCPYCAAWSQDTLPTMLDYVDSGDL--RIEWREVNVFGSAS 134

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
                      +   +W F   LF         +   +AL ++A   G   + F+  +N 
Sbjct: 135 EQAAEAAYAAALQDKHWEFHEKLFAGGKPRSPEELSPEALTSVAADIGLDMDQFEEDMNS 194

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
               + +       +E     STP F +    Y+G     VF   I++ ++ +
Sbjct: 195 SETAEAVDKNAAMGTE-LGAFSTPTFILDSQPYVGAQPTSVFVDAIEAKLEGA 246


>gi|120603965|ref|YP_968365.1| DSBA oxidoreductase [Desulfovibrio vulgaris DP4]
 gi|120564194|gb|ABM29938.1| DSBA oxidoreductase [Desulfovibrio vulgaris DP4]
          Length = 288

 Score = 98.1 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 63/184 (34%), Gaps = 4/184 (2%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
               +       G+ +APVT+V Y+  TC +C +                GK+RY+ ++ 
Sbjct: 108 PKKVNLADRPVRGEANAPVTVVAYSDFTCPYCQQAAGTVEML---LANYKGKVRYVFKQM 164

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           PL++               +      +        D           L  +A+ AG    
Sbjct: 165 PLETHENARTASNYYVAASLQDPAKAWKLYEAVFADRDRLVTEGEPFLKKVAQEAGLDMQ 224

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
              T +  + +   I+     A +   +  TP F +   +  G +   +FS  +D  ++ 
Sbjct: 225 RLATDIKGRKVKALIEEDMAEARK-LGVQGTPYFLVNDLVVRGALPLDLFSDAVDMALEK 283

Query: 229 STRR 232
           +  +
Sbjct: 284 AGAK 287


>gi|225873724|ref|YP_002755183.1| putative lipoprotein [Acidobacterium capsulatum ATCC 51196]
 gi|225794080|gb|ACO34170.1| putative lipoprotein [Acidobacterium capsulatum ATCC 51196]
          Length = 317

 Score = 98.1 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 60/206 (29%), Gaps = 7/206 (3%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
           S   +        D                 G   A VT+V +  + C  CA  H++ F 
Sbjct: 90  STDGDTLARLSKFDISQDPDFVLPIQGRPVRGNPKAKVTIVNFDDLECPFCARMHSELFP 149

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA-EKRMDGGYWGFVSLLFNKQDDWIN 148
            + D Y    K+ Y+           +   +            YW FV  +    +D   
Sbjct: 150 DIYDHYKGLIKVIYVDFPLTELHPWAMHAAVDANCLADESRTAYWNFVDYVHTHGEDISG 209

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQ------NILDDIKAGKKRASEDFAIDSTPVF 202
             +      +        +   D     +         + +   +  A +   I +TP F
Sbjct: 210 PDHDTAKSFSRLDKIAEGEGQRDHLDTAKLNACVAKQDESVVKKEMAAGDKLGISATPTF 269

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F+ G  + G +       +ID  ++ 
Sbjct: 270 FVNGVRWSGVLDPAELKMMIDRALRQ 295


>gi|16124630|ref|NP_419194.1| hypothetical protein CC_0375 [Caulobacter crescentus CB15]
 gi|221233318|ref|YP_002515754.1| thiol:disulfide interchange protein DsbA [Caulobacter crescentus
           NA1000]
 gi|13421530|gb|AAK22362.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220962490|gb|ACL93846.1| thiol:disulfide interchange protein dsbA [Caulobacter crescentus
           NA1000]
          Length = 204

 Score = 98.1 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 84/184 (45%), Gaps = 2/184 (1%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
             ++  T +D+ +G  +A VT++EYAS+ C HCA ++ + F   + KYI TGK++Y+ R+
Sbjct: 23  PKSAEVTAEDMVLGDPNAKVTVIEYASVACPHCATWNAEVFPAFKAKYIDTGKVKYVHRD 82

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
                        A  A       Y+     L+  Q +   S + R  LL +A+ AG ++
Sbjct: 83  ALTGEPRLA-NAGAMLARCAGKDKYFQVTEALYRAQTNIFTSGDIRGELLTIAQAAGMNE 141

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             F++CL             ++   D  I  TP F + G    G+         +D+ I 
Sbjct: 142 AQFNSCL-SDENAAKSAERIEKMMTDNNIRGTPTFEVNGKRLGGEEGGEQTLAQLDAAIA 200

Query: 228 DSTR 231
           ++++
Sbjct: 201 EASK 204


>gi|291441264|ref|ZP_06580654.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
 gi|291344159|gb|EFE71115.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
          Length = 626

 Score = 98.1 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 71/219 (32%), Gaps = 13/219 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +G+L   +L  +  +  +        E        D    L        D   G  DA
Sbjct: 413 ATVGILLAALLSALLGWVVFHLAAVLRGETEA-----DLPRFLDRPVDPATDHITGPPDA 467

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+T+VEY    C  CA       +  +    +   +   L    +   S +A   A  A+
Sbjct: 468 PLTLVEYGDYECPFCAHATGVAQELQQRFGDRLRYVFRHLPLPDVHEHSELAARAAVAAD 527

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            +    +W    LLF  QD         + +L  A   G     F   L+ +     ++A
Sbjct: 528 AQG--RFWQMHDLLFAHQDQLEF-----EDILGYAGQIGLDVERFLEDLDSERTAARVRA 580

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
               A E       P FFIG   + G       +  +++
Sbjct: 581 DVASA-EASGAQGAPTFFIGNRRHTGPYDAQTLAARLEA 618


>gi|301165890|emb|CBW25463.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 263

 Score = 98.1 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 59/171 (34%), Gaps = 5/171 (2%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
            G ++AP+T+VEY+   C  C    N   + L+    K   +   L           A  
Sbjct: 95  RGAQEAPLTLVEYSDFQCPFCVRGFNTVKELLKKYDGKIRFVYKHLPLSFHKEALPAAH- 153

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                  +     + F   +F+ Q            L  MAK  G         +  + +
Sbjct: 154 YYEAIRLQSAEKAFKFHDEIFDNQRKLSTG---EPFLKKMAKKVGADMKRLAKDVKSKAV 210

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           ++ +++  K A++ F    TP F + G    G      F KII  + +   
Sbjct: 211 IERVESDIKEAAK-FGFQGTPGFLLNGIPVRGAYPIDHFEKIIAKLKEKGK 260


>gi|46578451|ref|YP_009259.1| DSBA-like thioredoxin domain-containing protein [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46447862|gb|AAS94518.1| DSBA-like thioredoxin domain protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311232379|gb|ADP85233.1| DSBA oxidoreductase [Desulfovibrio vulgaris RCH1]
          Length = 261

 Score = 98.1 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 63/184 (34%), Gaps = 4/184 (2%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
               +       G+ +APVT+V Y+  TC +C +                GK+RY+ ++ 
Sbjct: 81  PKKVNLADRPVRGEANAPVTVVAYSDFTCPYCQQAAGTVEML---LANYKGKVRYVFKQM 137

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           PL++               +      +        D           L  +A+ AG    
Sbjct: 138 PLETHENARTASNYYVAASLQDPAKAWKLYEAVFADRDRLVTEGEPFLKKVAQEAGLDMQ 197

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
              T +  + +   I+     A +   +  TP F +   +  G +   +FS  +D  ++ 
Sbjct: 198 RLATDIKGRKVKALIEEDMAEARK-LGVQGTPYFLVNDLVVRGALPLDLFSDAVDMALEK 256

Query: 229 STRR 232
           +  +
Sbjct: 257 AGAK 260


>gi|239932915|ref|ZP_04689868.1| Na+/H+ antiporter NhaA [Streptomyces ghanaensis ATCC 14672]
          Length = 632

 Score = 98.1 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 71/219 (32%), Gaps = 13/219 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +G+L   +L  +  +  +        E        D    L        D   G  DA
Sbjct: 419 ATVGILLAALLSALLGWVVFHLAAVLRGETEA-----DLPRFLDRPVDPATDHITGPPDA 473

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+T+VEY    C  CA       +  +    +   +   L    +   S +A   A  A+
Sbjct: 474 PLTLVEYGDYECPFCAHATGVAQELQQRFGDRLRYVFRHLPLPDVHEHSELAARAAVAAD 533

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            +    +W    LLF  QD         + +L  A   G     F   L+ +     ++A
Sbjct: 534 AQG--RFWQMHDLLFAHQDQLEF-----EDILGYAGQIGLDVERFLEDLDSERTAARVRA 586

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
               A E       P FFIG   + G       +  +++
Sbjct: 587 DVASA-EASGAQGAPTFFIGNRRHTGPYDAQTLAARLEA 624


>gi|134095225|ref|YP_001100300.1| putative sodium/proton antiporter [Herminiimonas arsenicoxydans]
 gi|189029165|sp|A4G6P0|NHAA_HERAR RecName: Full=Na(+)/H(+) antiporter nhaA; AltName:
           Full=Sodium/proton antiporter nhaA
 gi|133739128|emb|CAL62177.1| putative Na+/H+ antiporter fused with thioredoxin domain
           [Herminiimonas arsenicoxydans]
          Length = 621

 Score = 98.1 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 82/225 (36%), Gaps = 16/225 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +GVL  +V   +  +  +        E        D   +L        D   G +DA
Sbjct: 407 ATVGVLVSMVFATLLGWLIFKVAAQRWGEK-----TADLPMVLEPPVDPEIDHIRGPEDA 461

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            +T+VEY    C +CA     T  + + +      LRY++R  P      +A   +  A 
Sbjct: 462 QLTLVEYVDFECAYCAHA---TGSWDDLRAHFGDDLRYVVRHLPHHPHGPIAARASEAAA 518

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            +    +W ++  +F +Q         R+ L+  A   G     F   L+   +++ ++ 
Sbjct: 519 NQGM--FWPWLDFVFTRQHALE-----REHLIGYAAELGLDVERFIADLDSPAVIERVER 571

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               A       +TP FF+ G    G       + ++++  + + 
Sbjct: 572 DLASAV-ASGAHATPTFFVEGRRLRGSYDARTVTAVLEASRRGTR 615


>gi|315441495|ref|YP_004074372.1| protein-disulfide isomerase [Mycobacterium sp. Spyr1]
 gi|315265150|gb|ADU01891.1| protein-disulfide isomerase [Mycobacterium sp. Spyr1]
          Length = 220

 Score = 98.1 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 70/229 (30%), Gaps = 10/229 (4%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +  T+RI +   ++         Y       +         +   ++  +   +  V   
Sbjct: 1   MARTSRILLTAFVIAAMAIGALVYLSVRDRDSTTTAQPDTGEAGQVVRENSHRLNTV--- 57

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             D+ VT VE+    C  C   + +  K    +     ++ +++R FPL +         
Sbjct: 58  -PDSTVTFVEFLDFECEGCRAVYPEIEKA---RAEYGDRVNFVIRYFPLQAHVNAERAAR 113

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                   G        +++ Q  W   +    D     A   G    +FD    +   L
Sbjct: 114 AVEAAAQQGQLEAMYRKMYDTQAQWGEKQTPADDVFRGFATELGLDMAEFDAAYANPATL 173

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           + I+           +  TP FF+         S    ++  D  + ++
Sbjct: 174 ERIQLDMADG-RALGVQGTPTFFLNDTRIQ-PHSYEDLAQAFDQALAEN 220


>gi|311069870|ref|YP_003974793.1| thiol-disulfide oxidoreductase [Bacillus atrophaeus 1942]
 gi|310870387|gb|ADP33862.1| thiol-disulfide oxidoreductase [Bacillus atrophaeus 1942]
          Length = 223

 Score = 98.1 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 63/190 (33%), Gaps = 1/190 (0%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           +        +++ PS      +G+ DAPVT+VE+    C  C  F+N  F  ++  +I  
Sbjct: 31  NSTQQSSETVSSQPSIKGQPVLGKNDAPVTVVEFGDYKCPSCKVFNNDIFPKIQKDFIDK 90

Query: 99  GKLRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
           G +++           +      +    K     +W F   LF +Q +          L 
Sbjct: 91  GDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWSFHEKLFEEQPNTEQEWVTPALLG 150

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
           N+AK              D+             +    I +TP  ++   +         
Sbjct: 151 NVAKSTTKVNPATLKENLDKETFSSEVEKDSELNNKLNILATPTIYVNDKVIKKFGDYSE 210

Query: 218 FSKIIDSMIQ 227
             K I+  ++
Sbjct: 211 IKKAIEKELK 220


>gi|167648327|ref|YP_001685990.1| DSBA oxidoreductase [Caulobacter sp. K31]
 gi|167350757|gb|ABZ73492.1| DSBA oxidoreductase [Caulobacter sp. K31]
          Length = 211

 Score = 98.1 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 53/177 (29%), Positives = 87/177 (49%), Gaps = 1/177 (0%)

Query: 40  GVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG 99
           G     A  A  P+   D+ +G   A V +VEYAS++C HCA ++N+ F   + ++I TG
Sbjct: 19  GAAPTIARAAPLPAAEGDMVLGSPKAKVQVVEYASLSCTHCAHWNNEVFPAFKTRFIDTG 78

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
           K+RY+ REF  +     A      A +     Y+  +  +F++Q     S++    LL +
Sbjct: 79  KVRYVFREFLTEPYPFAA-AGYLLARRVGPAKYFEVIDTVFHQQAAIFQSEDLWGGLLKI 137

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
            K  G ++  F T L D+  LD + A   +A+E   ++ TP FF+ G  + G     
Sbjct: 138 GKGFGLTEAQFTTALQDKAALDAVNARVAKAAERDKVEVTPTFFVNGQRFEGGQPIE 194


>gi|107102093|ref|ZP_01366011.1| hypothetical protein PaerPA_01003142 [Pseudomonas aeruginosa PACS2]
          Length = 592

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 82/225 (36%), Gaps = 16/225 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +GVL  +V   +  +  +        E        D   +L        D   G +DA
Sbjct: 378 ATVGVLVSMVFATLLGWLIFKVAAQRWGEK-----TADLPMVLEPPVDPEIDHIRGPEDA 432

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            +T+VEY    C +CA     T  + + +      LRY++R  P      +A   +  A 
Sbjct: 433 QLTLVEYVDFECAYCAHA---TGSWDDLRAHFGDDLRYVVRHLPHHPHGPIAARASEAAA 489

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            +    +W ++  +F +Q         R+ L+  A   G     F   L+   +++ ++ 
Sbjct: 490 NQGM--FWPWLDFVFTRQHALE-----REHLIGYAAELGLDVERFIADLDSPAVIERVER 542

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               A       +TP FF+ G    G       + ++++  + + 
Sbjct: 543 DLASAV-ASGAHATPTFFVEGRRLRGSYDARTVTAVLEASRRGTR 586


>gi|126667123|ref|ZP_01738098.1| hypothetical protein MELB17_06234 [Marinobacter sp. ELB17]
 gi|126628529|gb|EAZ99151.1| hypothetical protein MELB17_06234 [Marinobacter sp. ELB17]
          Length = 242

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 85/229 (37%), Gaps = 14/229 (6%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +M+ T       +V + I  +F  +      +ELP+             +      VS+G
Sbjct: 28  IMTLT-------VVAMLIGLFFITSGPSPDSDELPVAKQGTPD----FPAELDQFGVSVG 76

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             DAPV + E+A   C  CA F + + +  ++      K+R++  E PL   +       
Sbjct: 77  AADAPVVVREFADYQCPACARFADASQRLKKEYVESG-KVRFVYFELPLSQHANAMPAAQ 135

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                     +W     L++ Q  W    + +      A   G S+N F  C+  +   +
Sbjct: 136 AARCAGDQNAFWPMHEALYSNQSAWAGVSDPQATFTRYAGDLGLSENRFSRCMATELHRE 195

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            I+   K A++   + STP   +   +       G  S +++  +  S 
Sbjct: 196 AIEQSAKVATQ-LRVVSTPTVMVDNIVLT-RPGWGQLSAVVERELAVSR 242


>gi|228995855|ref|ZP_04155513.1| disulfide bond formation protein D [Bacillus mycoides Rock3-17]
 gi|229003472|ref|ZP_04161290.1| disulfide bond formation protein D [Bacillus mycoides Rock1-4]
 gi|228757710|gb|EEM06937.1| disulfide bond formation protein D [Bacillus mycoides Rock1-4]
 gi|228763827|gb|EEM12716.1| disulfide bond formation protein D [Bacillus mycoides Rock3-17]
          Length = 219

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G++DAPV
Sbjct: 12  LGIVFSIAVLIVIGTVAYSIINDKKDKGNEMFAYSTQQS-------------LGKEDAPV 58

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV-AVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK+++    FP     +           K
Sbjct: 59  KVVEFGDFKCPACRTWDTTVLPRLKEEYINKGKVQFYFINFPFIGKDSNLGAAAGEAIYK 118

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ +   D ++
Sbjct: 119 QDPESFWTFYDEIYQIQKKDTEEWITEELLLNIVKEKLPKVNIEQFKKDLHSKETQDKVR 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 179 KDSDRA-QKLKVQGAPSVYVNGNL--SNPDYDSMKKAIDKELKK 219


>gi|262198405|ref|YP_003269614.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
 gi|262081752|gb|ACY17721.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
          Length = 276

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/260 (14%), Positives = 73/260 (28%), Gaps = 39/260 (15%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPI--------------------------- 37
             RIG +   VLL +  +     + +      +                           
Sbjct: 1   MKRIGFISMSVLLAVTGFGLVGCQQAQPQSSELAAKLDEIDKKLTRIEKQVENGAGAAAA 60

Query: 38  -----PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLE 92
                P            S +     ++G  DA VT+V+     C  C        +  E
Sbjct: 61  ARGRAPQRRPGPDPEKTYSVAVEGAPAVGPADAKVTVVKAFEFACPFCERARGTMDQIRE 120

Query: 93  DKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY 152
           +       +               A + A+ +      G W  +  L   +         
Sbjct: 121 EYGDDVRIVY-----KHYIVHPGSATVPAQASCAAGMQGKWKAMEDLIWDKAFKAGRDLS 175

Query: 153 RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
              +  +AK AG     +   + +    + ++   ++ ++   +  TP FFI G    G 
Sbjct: 176 EGKMEELAKEAGLDMAKYKADM-EGACKELVQKDHQQMAK-VGVTGTPGFFINGRFLRGA 233

Query: 213 MSEGVFSKIIDSMIQDSTRR 232
                F  +ID  ++ +  R
Sbjct: 234 QPFPAFKAVIDEEMKKADER 253


>gi|329888149|ref|ZP_08266747.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846705|gb|EGF96267.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 203

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/203 (25%), Positives = 80/203 (39%), Gaps = 3/203 (1%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
                +A   L +   V    A  A    T  D  +G+ DAPVT++EYAS TC HCA + 
Sbjct: 2   ALASLNAAPVLALDPAVTRGSATAAVPAVTAADRVMGRADAPVTVIEYASFTCSHCAHWT 61

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
           N      + +YI TGK+R + R+ P       A              ++     L + Q 
Sbjct: 62  NDILPQFKARYIDTGKVRLVFRDMPTPPAQIAATAAGIA-RCAAPNRFFDVAHSLMSGQA 120

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                 + RD        +G ++   +TC+ +      ++A    A     +  TP FF+
Sbjct: 121 AAFEKGDARDWFAAAIAASGRTQEQIETCMKNPATSQALQAEVDGAV-AAGVTGTPSFFV 179

Query: 205 GGNLYLGDMSEGVFSKIIDSMIQ 227
            G     D S    S  ID +I+
Sbjct: 180 NGRRVS-DHSLEALSAAIDPLIR 201


>gi|145294065|ref|YP_001136886.1| hypothetical protein cgR_0023 [Corynebacterium glutamicum R]
 gi|140843985|dbj|BAF52984.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 248

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 69/237 (29%), Gaps = 19/237 (8%)

Query: 7   RIGVLGGIVLLFIASYFF----------------YTRKGSALNELPIPDGVVDFRALLAA 50
            + V+  ++L+ +    +                      + +      G  D       
Sbjct: 12  TLVVIIAVLLIAVVLLMYRGNASETAEGAAATAPAGSDSGSASGTDSGSGAADSDLTSVE 71

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +      V++G  +APV +V ++   C  CA++ ++T   +            I      
Sbjct: 72  ARDPSDPVAVGDVNAPVGLVVFSDYQCPFCAKWSDETLPQMMKHVEDGNL--RIEWREVN 129

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
                            +   Y  + + LF   +        +D L+ +A   G   + F
Sbjct: 130 IFGEPSERGARAAYAAGLQDSYLEYHNALFANGEKPSEELLSKDGLIELAGELGLDVSKF 189

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                       I   ++   +     STP F +GG   +G     VF    +  + 
Sbjct: 190 TEDFQSPETAAAIAQHQQLGID-LGAYSTPAFLLGGQPIMGAQPASVFEAAFEQALA 245


>gi|148259417|ref|YP_001233544.1| protein-disulfide isomerase-like protein [Acidiphilium cryptum
           JF-5]
 gi|146401098|gb|ABQ29625.1| Protein-disulfide isomerase-like protein [Acidiphilium cryptum
           JF-5]
          Length = 209

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/222 (23%), Positives = 90/222 (40%), Gaps = 18/222 (8%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R  +LG +  L  A         +A          +                S+G  +AP
Sbjct: 3   RRSLLGMVGGLATAGSLGIAFPAAAAETKTDSPYSI---------------RSLGNPNAP 47

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+ EY S+ C HCAEF       + + Y+K GK+ Y+ ++FPL+  +  A  +AR    
Sbjct: 48  VTVYEYFSLNCPHCAEFATHALPKVIESYVKPGKVYYVFKDFPLNEDALWAAQIARALPA 107

Query: 127 RMDGGYWGFVSLL---FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           +    +   +      +         K+Y++AL   A  AG  +  FD  + ++ +   +
Sbjct: 108 KAYYPFISELFRTQDEWAYAPGLKTPKDYQNALFRYAALAGMDRTTFDAAIANKKLRAFV 167

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
                 A + + ++STP F I G    G +S   FS  + + 
Sbjct: 168 LNELNDAEKTYKVNSTPTFIINGRKREGAVSFDTFSSWLKAA 209


>gi|228989666|ref|ZP_04149648.1| disulfide bond formation protein D [Bacillus pseudomycoides DSM
           12442]
 gi|228770000|gb|EEM18582.1| disulfide bond formation protein D [Bacillus pseudomycoides DSM
           12442]
          Length = 219

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 80/224 (35%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G++DAPV
Sbjct: 12  LGIVFSIAVLIVIGTVAYSIINDKKDKGNEMFAYSTQQS-------------LGKEDAPV 58

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV-AVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK+++    FP     +           K
Sbjct: 59  KVVEFGDFKCPACRTWDTTVLPRLKEEYINKGKVQFYFINFPFIGKDSNLGAAAGEAIYK 118

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN  K      +   F   L+ +   D ++
Sbjct: 119 QDPESFWTFYDEIYQIQKKDTEEWITEELLLNTVKEKLPKVNIEQFKKDLHSKETQDKVR 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 179 KDSDRA-QKLKVQGAPSIYVNGNL--SNPDYDSMKKAIDKELKK 219


>gi|157803211|ref|YP_001491760.1| protein-disulfide isomerase [Rickettsia canadensis str. McKiel]
 gi|157784474|gb|ABV72975.1| Protein-disulfide isomerase [Rickettsia canadensis str. McKiel]
          Length = 274

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 89/214 (41%), Gaps = 7/214 (3%)

Query: 23  FFYTRKGSALNELPIPDG----VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
                  +  NE+  PD         + +         D+ +G K + V ++EY S TC 
Sbjct: 61  IVPANDNNQTNEVSTPDSQEHKDPKIKPIKVTFKVDDNDMVLGNKKSNVIVIEYFSPTCP 120

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
           HCA +H   F  L+ KYI T K+ Y++REF                 K     +  F ++
Sbjct: 121 HCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDL--DAAILARCKGDINSFVQFHNI 178

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           +  +QD W  S  YR+ L ++ K  G S  ++  CLN   I + + A     ++      
Sbjct: 179 ILKQQDKWAYSNKYRELLTDIGKLGGISPEEYKQCLNSDKITETLIANTNLVAKTPKFIG 238

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           TP FF+ G +   + S    +K +D  + +   +
Sbjct: 239 TPSFFVNG-VQTKNYSIDNIAKAVDKALDEQKEK 271


>gi|326402643|ref|YP_004282724.1| hypothetical protein ACMV_04950 [Acidiphilium multivorum AIU301]
 gi|325049504|dbj|BAJ79842.1| hypothetical protein ACMV_04950 [Acidiphilium multivorum AIU301]
          Length = 209

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/222 (23%), Positives = 90/222 (40%), Gaps = 18/222 (8%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R  +LG +  L  A         +A          +                S+G  +AP
Sbjct: 3   RRSLLGMVGGLATAGSLGIAFPAAAAETKADSPYSI---------------RSLGNPNAP 47

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+ EY S+ C HCAEF       + + Y+K GK+ Y+ ++FPL+  +  A  +AR    
Sbjct: 48  VTVYEYFSLNCPHCAEFATHALPKVIESYVKPGKVYYVFKDFPLNEDALWAAQIARALPA 107

Query: 127 RMDGGYWGFVSLL---FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           +    +   +      +         K+Y++AL   A  AG  +  FD  + ++ +   +
Sbjct: 108 KAYYPFISELFRTQDEWAYAPGLKTPKDYQNALFRYAALAGMDRTTFDAAIANKKLRAFV 167

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
                 A + + ++STP F I G    G +S   FS  + + 
Sbjct: 168 LNELNDAEKTYKVNSTPTFIINGRKREGAVSFDTFSSWLKAA 209


>gi|218660391|ref|ZP_03516321.1| DSBA oxidoreductase [Rhizobium etli IE4771]
          Length = 190

 Score = 97.8 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 87/187 (46%), Gaps = 3/187 (1%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
             +  A     P    D  +G   APVT++EY+S TC HC ++  +    +E +++  GK
Sbjct: 5   PANSEAADLLEPIGRVDRPVGSASAPVTIIEYSSPTCSHCVDYRTQVAPEIEKEFVARGK 64

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
            R I R F  +    V +++      +    +    +L ++K DD   S +    + ++A
Sbjct: 65  ARLIFRPFVRN---NVDMVIFMLCAWQDGAKFEELTNLFYSKYDDIAQSGDIEKTIRDIA 121

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
             AG  ++ FD  ++DQ+ LD +     +A EDF ++ TP FF+ G  + G  S      
Sbjct: 122 GSAGIDRSAFDRLVSDQSTLDGLTKLTSQAREDFEVEGTPTFFVNGKKFTGAQSVEEMRA 181

Query: 221 IIDSMIQ 227
            I+   +
Sbjct: 182 NIEEAAK 188


>gi|309792603|ref|ZP_07687065.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
 gi|308225417|gb|EFO79183.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
          Length = 233

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/222 (22%), Positives = 76/222 (34%), Gaps = 10/222 (4%)

Query: 8   IGVLGGIVLLFIASYFFYTRKG--SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
           IG+   +V+L + S     R            P  V D  A   A P+     + G  DA
Sbjct: 9   IGIGSLLVILLLTSVASLGRNATEQRNANNLEPIIVSDHPAPPNAEPN---GRAWGPVDA 65

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+ ++EYA   C  C  F       +   +  TGK+R+ +R  P           A    
Sbjct: 66  PIQVIEYADYECESCGYFARTYEAEVIAAFAATGKVRFEIRNAPFHGEGARNAAAAAYCA 125

Query: 126 KRMDGGYWGFVSLLFNKQ---DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 +W     LF  Q               L  MA   G +   F+ CL        
Sbjct: 126 AEQ-DAFWPLHETLFLNQPTVHGSGAQVFSHARLNEMAAQLGLNSAAFEQCLGSGTYTAQ 184

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           ++A     +    +  TP FFI G ++ G +S   F +I   
Sbjct: 185 VEADYAE-TSRVGVTGTPTFFINGRMFPGILSTDDFRRIFRE 225


>gi|297572314|ref|YP_003698088.1| DSBA oxidoreductase [Arcanobacterium haemolyticum DSM 20595]
 gi|296932661|gb|ADH93469.1| DSBA oxidoreductase [Arcanobacterium haemolyticum DSM 20595]
          Length = 251

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/244 (16%), Positives = 71/244 (29%), Gaps = 29/244 (11%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS------------- 53
           R  ++  I LL +A           L+                   +             
Sbjct: 12  RTIIIALIALLTVAVLVLSFVVSGTLSSKEGKAAAPSSSTSQPKENTETKKELTPEIKAI 71

Query: 54  --------TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
                   +    ++G  DAPV +  Y+   C HC ++  +T   L+D          I 
Sbjct: 72  IEQQHRKESNDPRALGNVDAPVIIEMYSDYRCGHCRQWSLETLPKLQDFIDSGK--IRIE 129

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
                       ++        +   +W +   LF    +        +AL  +A   G 
Sbjct: 130 YNSMPVLGDESVLIAQASHAAALQNQFWEYHHELFANAPEAKP-----EALTELAGKIGM 184

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
               F   L D   +  +   + R +    I  TP F IG +   G      F  II+  
Sbjct: 185 DTEKFAADLKDPETVKAVDTERSRGTS-LGITGTPAFLIGYSFVPGAYPADQFIGIINQE 243

Query: 226 IQDS 229
           +Q +
Sbjct: 244 LQRA 247


>gi|300934216|ref|ZP_07149472.1| hypothetical protein CresD4_09109 [Corynebacterium resistens DSM
           45100]
          Length = 317

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/176 (21%), Positives = 62/176 (35%), Gaps = 2/176 (1%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
                +IG  DAPV + E+A M C  CA FHN+T   +   Y+  G +R    + P++  
Sbjct: 129 AEDPFAIGAIDAPVVISEFADMECPFCASFHNETRSKIVQNYVDKGLVRLEWNDLPINGK 188

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN-YRDALLNMAKFAGFSKNDFDT 172
           + V    A  A  +          L    +D   +      D +             F  
Sbjct: 189 NAVEGAKAGRAAAKQGKFQEFMDQLYTASKDKQGHPGYKIEDFVKFAEAAGVPDIEKFRK 248

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               +     +   ++  +    +  TP F +G     G     VF K+ID  ++ 
Sbjct: 249 DATSKEFDKPVNEARQYGTS-IGVSGTPAFVVGTKFVSGAQPWDVFKKVIDEELER 303


>gi|219847445|ref|YP_002461878.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
 gi|219541704|gb|ACL23442.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
          Length = 232

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 78/225 (34%), Gaps = 17/225 (7%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I V    V+   A     TR  + +     P G  D                 G  DAPV
Sbjct: 24  IAVGVIAVIAITALVVLLTRNTAEITTPTAPVGRTD-----------DGFYYKGNPDAPV 72

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEK 126
            ++ +    C  CA F       LE  YI TGK+++I  E P  +               
Sbjct: 73  KVIAFEDYQCPGCAFFTRNLEPILERDYINTGKVQFIYHELPLTNIHPNALPAAEAARCA 132

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
              G +W     LF  Q  W    +  +     A   G  +  FD+C+      + I A 
Sbjct: 133 GDQGKFWEMHGQLFANQSIWSQLNSPLNTFSGYAGIIGIDRAAFDSCMQAATHREAILAA 192

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + A+E   + +TP F + G +   +         ID+ ++ + R
Sbjct: 193 AQSAAE-LGVQATPSFSVNGQIVDSNR----LFTAIDAALRAAGR 232


>gi|325271665|ref|ZP_08138163.1| putative sodium/proton antiporter [Pseudomonas sp. TJI-51]
 gi|324103200|gb|EGC00549.1| putative sodium/proton antiporter [Pseudomonas sp. TJI-51]
          Length = 378

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 81/225 (36%), Gaps = 16/225 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +GVL  +V   +  +  +        E        D   +L        D   G +DA
Sbjct: 164 ATVGVLVSMVFATLLGWLIFKVAAQRWGEK-----TADLPMVLEPPVDPEIDHIRGPEDA 218

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            +T+VEY    C +CA     T  + + +      LRY++R  P      +A   +  A 
Sbjct: 219 QLTLVEYVDFECAYCAHA---TGSWDDLRAHFGDDLRYVVRHLPHHPHGPIAARASEAAA 275

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            +    +W ++  +F +Q         R+ L+  A   G     F   L+   +++ ++ 
Sbjct: 276 NQGM--FWPWLDFVFTRQHALE-----REHLIGYAVELGLDVERFIADLDSTAVIERVER 328

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               A       +TP FF+ G    G       +  +++  + + 
Sbjct: 329 DLASAV-ASGAHATPTFFVEGRRLRGSYDARTVTAALEASRRGTR 372


>gi|271968711|ref|YP_003342907.1| sodium/proton antiporter [Streptosporangium roseum DSM 43021]
 gi|270511886|gb|ACZ90164.1| putative sodium/proton antiporter [Streptosporangium roseum DSM
           43021]
          Length = 629

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/215 (18%), Positives = 64/215 (29%), Gaps = 11/215 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPD--GVVDFRALLAASPSTMKDVSIGQK 63
            ++G+L   +   + ++  +         L I    G  +    LAA     +D   G +
Sbjct: 409 AKLGILTAALCAPLMTWAVHRVTTLLPKRLRIRALLGTAESIVDLAAPVDPDRDHVRGPQ 468

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
            APVT+VEY    C +C +      + L D                 D      +     
Sbjct: 469 VAPVTVVEYGDFECPYCGQAEAVVRELLADLGDVR---YVWRHLPLHDVHPYAQLAAEAA 525

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                   +W    LL + QD+          L+  A   G     F   L        +
Sbjct: 526 EAAAEQEAFWEMHDLLLDHQDELRIRD-----LIGYAGELGLDVERFRDSLRGHAGAARV 580

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
                 A +   +  TP FFI G  + G       
Sbjct: 581 AEDIDSA-DLSGVSGTPTFFINGRRHHGAYDIATL 614


>gi|315504345|ref|YP_004083232.1| dsba oxidoreductase [Micromonospora sp. L5]
 gi|315410964|gb|ADU09081.1| DSBA oxidoreductase [Micromonospora sp. L5]
          Length = 184

 Score = 97.4 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/187 (17%), Positives = 56/187 (29%), Gaps = 8/187 (4%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
              +         P T +D   G  DAPVT+VEY    C  C   +    + L  +    
Sbjct: 2   TTPLQVTTARLRIPVTERDHVRGPVDAPVTVVEYGDFQCRFCGAAYPNLAEVLRQRADMV 61

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
             +        +   +  A   A  A  R    +W     L+  QD           L  
Sbjct: 62  RLVYRHFPITNVHPYAETAAETAEAAAARG--RFWEMYDWLYQHQDQLDQV-----HLSL 114

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
             +  G S  +    +  Q   D ++           ++ TP  F+    + G       
Sbjct: 115 GVEQIGLSPEEIAAEVGRQEYADRVRQDFVGGI-RSGVNGTPTLFVNDVRHDGGYDLAEL 173

Query: 219 SKIIDSM 225
             ++D+ 
Sbjct: 174 LAVVDAA 180


>gi|190571339|ref|YP_001975697.1| hypothetical protein WPa_0944 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357611|emb|CAQ55052.1| hypothetical protein WP0944 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 243

 Score = 97.4 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 100/239 (41%), Gaps = 15/239 (6%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
            +   I ++    LLF+  +   +   +    LP      D             D  +G 
Sbjct: 5   FNKLSISIVMIFRLLFLLIFISVSSYAAIEQNLPN-TQKTDEITSKELLSLLPDDKLLGD 63

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
             AP+ M+EYAS+TC+HC+ FH K F  +++KYI TGK+ YI R FPLD           
Sbjct: 64  PKAPILMIEYASLTCYHCSLFHKKVFPKIKEKYIDTGKMLYIFRHFPLDYRGL--KAAML 121

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILD 181
                 +  Y+ F   +FN  D W  S       L  +A  +   ++ F+ C+ND+ ++D
Sbjct: 122 SYCYEKEEDYFNFNKAVFNAIDSWNYSNFSDLTILQKIAALSNLKQDVFNQCINDKKMMD 181

Query: 182 DIKAGKKRASEDFAIDSTPVFFI----------GGN-LYLGDMSEGVFSKIIDSMIQDS 229
            I   K  A     I +TPVF I           G   + G      F+ +ID +   +
Sbjct: 182 KIINDKSLAINKLDITATPVFIIKINDDKSYVENGKIKHEGYRELEYFTNVIDELYGKA 240


>gi|317123225|ref|YP_004097337.1| sodium/proton antiporter, NhaA family [Intrasporangium calvum DSM
           43043]
 gi|315587313|gb|ADU46610.1| sodium/proton antiporter, NhaA family [Intrasporangium calvum DSM
           43043]
          Length = 627

 Score = 97.4 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 59/201 (29%), Gaps = 12/201 (5%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
            L  +   +       +L       +D   G   AP+T+VEYA   C  C        + 
Sbjct: 426 TLAAVLHGETTAGLPTVLDRPVDPERDHVRGSVTAPLTLVEYADFECPFCGRATGVVAEV 485

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
                     +   L    +       +           G +W    LLF  Q       
Sbjct: 486 RAHFGADLRYVMRHLPLPDVHPH--AELAALAVESAGAQGRFWEMHDLLFEHQGQLET-- 541

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
              + L   A   G     F   L+D+   D I+   + A E      TP FF+G   ++
Sbjct: 542 ---EDLAGYASELGLDVERFLRDLDDEVHSDRIREDVRSA-EASGARGTPTFFVGDQRHV 597

Query: 211 GDMSEGVFSKIIDSMIQDSTR 231
           G              ++ S R
Sbjct: 598 GPYDAQTLIA----ELEASRR 614


>gi|163751466|ref|ZP_02158690.1| hypothetical protein KT99_10483 [Shewanella benthica KT99]
 gi|161328680|gb|EDP99829.1| hypothetical protein KT99_10483 [Shewanella benthica KT99]
          Length = 261

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 48/209 (22%), Positives = 77/209 (36%), Gaps = 17/209 (8%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKD--VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
            + +       + L             SIG   A + ++E++   C +C  F ++TF  L
Sbjct: 59  TIAMSSQQPQHKTLPTQENIDADGRLPSIGSAGAEIAIIEFSDYQCPYCKRFIDQTFTQL 118

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
           + KYI TGK+RY+ R+FPL                     YW     LFN          
Sbjct: 119 KRKYIDTGKVRYLTRDFPLSFHPKAKAAAIAANCSLRQDAYWPMRDSLFNNMGQLG---- 174

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG----- 206
             +     A         F  CL D+++L  I+      S+   I  TP F IG      
Sbjct: 175 -DELYQQTASELALDMTQFTECLTDESVLGKIEQDMAYGSQ-LGIRGTPSFVIGRVEGNR 232

Query: 207 ----NLYLGDMSEGVFSKIIDSMIQDSTR 231
                L +G  S   F+ ++D ++ +  +
Sbjct: 233 LISPRLVVGAQSFESFAVLLDELLANDKK 261


>gi|219850456|ref|YP_002464889.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
 gi|219544715|gb|ACL26453.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
          Length = 293

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/201 (21%), Positives = 75/201 (37%), Gaps = 4/201 (1%)

Query: 25  YTRKGSALNELPIP---DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCA 81
            +    +   LP P   D  V   ++     S      +G  +APVT+VE+    C  C 
Sbjct: 66  TSIPTPSTTALPTPLITDSGVLTASMARLGLSAEPYAVLGDPNAPVTIVEFTDFGCPFCR 125

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
             H  TF+ L ++++ TG++ Y+++  P+ S       LA          +    +L  +
Sbjct: 126 RHHLLTFRTLVEEFVATGRVFYVIKHLPVSSQQGEQAALAAICAGEQGRYWEMHNALFAD 185

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
            +    N    +  +  +A   GF       C    +    I      A     +  TPV
Sbjct: 186 GEAWQGNETIAQRRIDAIAAELGFDVAALRACTERTDTKAIIARHVSEAH-TLRVFGTPV 244

Query: 202 FFIGGNLYLGDMSEGVFSKII 222
           FFI   L  G     V+ +++
Sbjct: 245 FFINNRLLAGAQPIEVWRQVL 265


>gi|127512573|ref|YP_001093770.1| DSBA oxidoreductase [Shewanella loihica PV-4]
 gi|126637868|gb|ABO23511.1| DSBA oxidoreductase [Shewanella loihica PV-4]
          Length = 262

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/177 (24%), Positives = 66/177 (37%), Gaps = 15/177 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
            ++G+  A V ++E++   C +C  + + TF  ++  YI TGK++YI R+FPL       
Sbjct: 85  PALGEATAQVAIIEFSDYQCPYCKRYMDNTFTKIKSDYIDTGKVKYIARDFPLGFHPKAK 144

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                         YW     LF       +           A         F  CL DQ
Sbjct: 145 GAAIAANCSLQQDAYWPMRDALFKNMRQLGDKLYQDT-----ATQLSLDMTKFAACLEDQ 199

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGG---------NLYLGDMSEGVFSKIIDSM 225
            I+  I+      S    +  TP F IG           L +G  S   F  +ID++
Sbjct: 200 AIMSKIEQDIGYGSS-IGVRGTPSFLIGKLENNRLIEPKLVVGAQSYDTFKAVIDAL 255


>gi|299534983|ref|ZP_07048311.1| thiol-disulfide oxidoreductase [Lysinibacillus fusiformis ZC1]
 gi|298729625|gb|EFI70172.1| thiol-disulfide oxidoreductase [Lysinibacillus fusiformis ZC1]
          Length = 227

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/229 (16%), Positives = 69/229 (30%), Gaps = 16/229 (6%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            +I V+  +++    +      + +       P G           PS       G+  A
Sbjct: 8   AKIAVILTLLVFVFVALIVVLNQKNDPIREKAPTG----------PPSIEGQPLFGESTA 57

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM-LARCA 124
            VT+VE+    C  C  + +  F  L + YI +G + +     P     ++     A   
Sbjct: 58  SVTIVEFGDFKCPACKAWGDTVFPKLVEDYIDSGDVNFAYVNVPFHGQESILAALAAESV 117

Query: 125 EKRMDGGYWGFVSLLFNKQDDWIN----SKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
            ++    YW F   LF  Q +              L   +     S       L  +  +
Sbjct: 118 YQQDPNAYWEFHKTLFTSQPETAKHDELWVTTEKLLELTSNMPSISPEKLTQDLEQELTM 177

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             ++       +   +  TP  FIG              KII   +  +
Sbjct: 178 PQVEIDTAL-YKKHGVGVTPTIFIGDKKISDPFDYEEIQKIIKEELSSA 225


>gi|298248027|ref|ZP_06971832.1| DSBA oxidoreductase [Ktedonobacter racemifer DSM 44963]
 gi|297550686|gb|EFH84552.1| DSBA oxidoreductase [Ktedonobacter racemifer DSM 44963]
          Length = 202

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/175 (15%), Positives = 50/175 (28%), Gaps = 8/175 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P + +D   G  DAPV +V+Y    C +            +    +   +        + 
Sbjct: 10  PVSEQDHRQGSADAPVMLVQYGDYECPYTRRSTTVVRALQQQLGTQMRFVFRNFPLTEIH 69

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
                             G +W     +F+ Q            L   A+        F+
Sbjct: 70  PH--ALHSAEAAEAAAAQGKFWEMHDYIFHHQHTLE-----DADLRRFAEALDLDVGQFE 122

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             +     L  I+A  +   +   +  TP F+I G  + G   +      I   +
Sbjct: 123 YDMAHHQHLRRIEADVEGGIQS-GVQGTPTFYINGVRHDGSWEQAALFAAIQQAL 176


>gi|116071982|ref|ZP_01469250.1| hypothetical protein BL107_07519 [Synechococcus sp. BL107]
 gi|116065605|gb|EAU71363.1| hypothetical protein BL107_07519 [Synechococcus sp. BL107]
          Length = 242

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 75/210 (35%), Gaps = 15/210 (7%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
                        +     +  L        + S+G   AP+T+VE++   C +C +FH 
Sbjct: 33  QATTPRPPTNETGEPQTRLQPKLTTDLLVEGEPSLGTARAPLTIVEFSDFECRYCQQFHQ 92

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
                L+ +YI+TG +R+I ++ PL          A          YW     LF+ Q  
Sbjct: 93  TVMPNLKKEYIETGLVRFIHKDLPLPFHRQALPAAAAARCAGEQNKYWTTYGALFDGQSC 152

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
                     ++ +A+  G   N    C+N       I A    A +   I +TP F IG
Sbjct: 153 LQCKG-----VVAIAREQGVDANTLQACMNRAATKALINANVSEA-QLHGIRATPTFVIG 206

Query: 206 ---------GNLYLGDMSEGVFSKIIDSMI 226
                    G +  G M    F  ++D  +
Sbjct: 207 PTRTDNSHRGEIVEGAMPWIQFKAMLDEQL 236


>gi|229162042|ref|ZP_04290016.1| hypothetical protein bcere0009_28230 [Bacillus cereus R309803]
 gi|228621448|gb|EEK78300.1| hypothetical protein bcere0009_28230 [Bacillus cereus R309803]
          Length = 218

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 70/195 (35%), Gaps = 3/195 (1%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           +  V    ++   P   K  ++G++DAPV+++E+    C  C  +  + F  L+  YI T
Sbjct: 24  EDKVATNKVIKDLPPIGKQPTLGKEDAPVSVIEFGDFKCPACKAWGERIFPQLQKDYIDT 83

Query: 99  GKLRYILREFPLDSVSTVAVM-LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY--RDA 155
           GK+++           +      A    K+    YW F   LFN Q +  +         
Sbjct: 84  GKVKFSYVNVLFHGTESKLSALAAESVYKQDPQAYWNFHKELFNAQPENHDDPWITSEKL 143

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           L     +              +    +     ++ ++D+ +  TP   + G +       
Sbjct: 144 LEIAKTYTPSINATQFEEDLKKQTEQEEVNRDEKLTQDYGVAQTPSIVVNGTMLSDPYDY 203

Query: 216 GVFSKIIDSMIQDST 230
                +I+  +++  
Sbjct: 204 EQIKNLIEKALKEKK 218


>gi|269838059|ref|YP_003320287.1| DSBA oxidoreductase [Sphaerobacter thermophilus DSM 20745]
 gi|269787322|gb|ACZ39465.1| DSBA oxidoreductase [Sphaerobacter thermophilus DSM 20745]
          Length = 247

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/217 (20%), Positives = 71/217 (32%), Gaps = 7/217 (3%)

Query: 17  LFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMK----DVSIGQKDAPVTMVEY 72
           +F             L  L  P G  D   +  A P           +GQ+ APV +VE+
Sbjct: 33  IFGGLVAVALIAAVVLILLNRPQGSEDVSDIAVAPPPDASIPTNGRVMGQEGAPVHVVEW 92

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGY 132
                  C  F       L  +Y+ TGK+ +  R+F      +              G +
Sbjct: 93  GDYQUPGCGYFTRAVKPQLIQEYVATGKITFEYRDFAFLGAES-TRAAEAAFCAEDQGKF 151

Query: 133 WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASE 192
           W +   +F  Q            L  MA+  G     F+ C +++    D++A    A +
Sbjct: 152 WQYHDTVFLNQRGENQGAFSEARLKEMARQVGLDMEAFNECYDNRTHKQDVEAMYNEA-K 210

Query: 193 DFAIDSTPVFFIGGNLYLGDMS-EGVFSKIIDSMIQD 228
           +  +  TP   I G L  G           ID  +  
Sbjct: 211 EAGVTGTPSIMINGQLLQGWNGRWETLKAAIDQALGQ 247


>gi|329850284|ref|ZP_08265129.1| putative disulfide isomerase [Asticcacaulis biprosthecum C19]
 gi|328840599|gb|EGF90170.1| putative disulfide isomerase [Asticcacaulis biprosthecum C19]
          Length = 223

 Score = 97.0 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 79/201 (39%), Gaps = 7/201 (3%)

Query: 18  FIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTC 77
            +A+        +       P   V    + AA P  + D+S+G   A +T++EYAS  C
Sbjct: 9   LMAAVVLGMAALALPAMAAAPAKPVQAIVIPAAKPGLLPDMSLGNPKAKITVIEYASAAC 68

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG------ 131
            HCA ++   +   E KY+KTGK+R+I RE   +  +                       
Sbjct: 69  PHCAHWNETVWPQFEAKYVKTGKVRFIFREVLTNPQAYALSAFMVGRCAVNRSQDPTSSA 128

Query: 132 -YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
            Y+  +   F+ QD +  +      L ++    G ++ D   C+ D+  +          
Sbjct: 129 PYFAVLHSFFSGQDVYYKTNRLGFVLNDINIKTGMTEADIQACVGDEKAMAAFYDNMNAH 188

Query: 191 SEDFAIDSTPVFFIGGNLYLG 211
            E   I+STP F + G    G
Sbjct: 189 LEADQIESTPTFVVNGKKIEG 209


>gi|15603904|ref|NP_220419.1| hypothetical protein RP025 [Rickettsia prowazekii str. Madrid E]
 gi|81859425|sp|Q9ZEB9|DSB_RICPR RecName: Full=Putative protein-disulfide oxidoreductase RP025;
           Flags: Precursor
 gi|3860595|emb|CAA14496.1| unknown [Rickettsia prowazekii]
 gi|292571620|gb|ADE29535.1| Protein-disulfide isomerase [Rickettsia prowazekii Rp22]
          Length = 272

 Score = 96.6 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 3/179 (1%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
              D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF     
Sbjct: 93  DDNDMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVIREFIATKQ 152

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                       K     +  F +++  +QD W  S  YR+ L ++ +  G    ++  C
Sbjct: 153 DL--DAAILARCKGDINSFIQFHNIILQQQDKWAYSNKYRELLTDIGQLGGIPPEEYKQC 210

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           LN   I   + A     ++      TP FF+ G +   + S    SK +D  + D T++
Sbjct: 211 LNSDKITATLIANTNLVAKAPKFIGTPSFFVNG-VQTENYSIDNISKAVDKALDDETKK 268


>gi|68171231|ref|ZP_00544635.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657639|ref|YP_507055.1| hypothetical protein ECH_0234 [Ehrlichia chaffeensis str. Arkansas]
 gi|67999351|gb|EAM85996.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599096|gb|ABD44565.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 240

 Score = 96.6 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 86/172 (50%), Gaps = 2/172 (1%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             D  IG   APV ++EYAS +C HCA F    F  LE KYIKTGK+ YI R FPLD + 
Sbjct: 58  PNDRFIGNTKAPVIIIEYASFSCMHCAHFTLNVFPELERKYIKTGKVLYIFRNFPLDYI- 116

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                            ++ +   +F+  +  + +      L N+AK +  +   F+ C+
Sbjct: 117 -SLKAAMLGICYNTASSFFTYTKAVFSSIEALVTNYKDLGVLSNIAKISNVTDERFEKCI 175

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           ND++I++ I   K  A+    +++TPVFFI G  Y        FS+ ID +I
Sbjct: 176 NDEDIMNYIVQEKFVANRKLQVNATPVFFINGRKYDKPHDIESFSETIDELI 227


>gi|302869178|ref|YP_003837815.1| DSBA oxidoreductase [Micromonospora aurantiaca ATCC 27029]
 gi|302572037|gb|ADL48239.1| DSBA oxidoreductase [Micromonospora aurantiaca ATCC 27029]
          Length = 184

 Score = 96.6 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/187 (17%), Positives = 55/187 (29%), Gaps = 8/187 (4%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
              +         P T +D   G  DAPVT+VEY    C  C   +    + L  +    
Sbjct: 2   TTPLQVTTARLRIPVTERDHVRGPVDAPVTIVEYGDFQCRFCGAAYPNLTEVLRQRADTV 61

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
                      +   +  A   A  A  R    +W     L+  QD           L  
Sbjct: 62  RLAYRHFPITNVHPYAESAAETAEAAAARG--RFWEMYDWLYQHQDQLDQV-----HLSL 114

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
             +  G S  +    +  Q   D ++           ++ TP  F+    + G       
Sbjct: 115 GVEQIGLSPEEIAAEVGRQEYADRVRQDFVGGI-RSGVNGTPTLFVNDVRHDGGYDLAEL 173

Query: 219 SKIIDSM 225
             ++D+ 
Sbjct: 174 LAVVDAA 180


>gi|221635547|ref|YP_002523423.1| dsba oxidoreductase [Thermomicrobium roseum DSM 5159]
 gi|221158043|gb|ACM07161.1| dsba oxidoreductase [Thermomicrobium roseum DSM 5159]
          Length = 251

 Score = 96.6 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 82/218 (37%), Gaps = 6/218 (2%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           + +   +V+  +A+         +  E+      V    +   +        +G  +APV
Sbjct: 38  LFITVPVVIALVAAGVGIWWSQRSAREV----AAVQMPDVSKYTSVPRDGRVLGDPNAPV 93

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            ++E+    C  C  F  + F  + ++YI TGK+R+  R+F               A   
Sbjct: 94  HVIEWGDYQCPACKSFEQRFFPTILEQYIVTGKVRWEFRDFAFI-GKESVRAAEAAACAL 152

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
             G +W F + L+  Q            L  +A+ AG     F +CL      D+++   
Sbjct: 153 DQGKFWEFHAALYANQTGENVGAFTDRRLEEIARVAGLDVGAFRSCLRQGKHADEVQQMV 212

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + A +   + +TP F + G+      S    ++ I+  
Sbjct: 213 REA-QSLGVRATPSFSVNGSAPFTIRSLSDLTQRIEEA 249


>gi|114798923|ref|YP_760617.1| DSBA-like thioredoxin domain-containing protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114739097|gb|ABI77222.1| DSBA-like thioredoxin domain protein [Hyphomonas neptunium ATCC
           15444]
          Length = 223

 Score = 96.6 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 87/230 (37%), Gaps = 14/230 (6%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +++ +R         L + +              P                       +G
Sbjct: 1   MLTLSRRFAAVAFSALALVACGAAGDGAGTSGANPSEANA-----------DGELGHVLG 49

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
           Q DAP+T++EYAS TC  C  FH+     +E+KYI TGK++++ RE+PL+ +   A  +A
Sbjct: 50  QADAPLTIIEYASPTCPACKYFHDTVKPTIEEKYISTGKVKFVFREYPLNEIDVAAYAMA 109

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
           RCA           +            +   +  L  + +  G +           + + 
Sbjct: 110 RCAGDDKFFDVLDDLFENQEGIRYAAQNGVVKTTLGAIGQRHGIADTATFEACLSNSEIR 169

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNL--YLG-DMSEGVFSKIIDSMIQD 228
              A     SE + ++ TP F I G    + G   +   FSK ID+ + +
Sbjct: 170 QALADTYATSEKWGVEGTPTFIIDGVKHNFQGEYTTAEGFSKQIDAKLAE 219


>gi|227832075|ref|YP_002833782.1| putative secreted protein [Corynebacterium aurimucosum ATCC 700975]
 gi|227453091|gb|ACP31844.1| putative secreted protein [Corynebacterium aurimucosum ATCC 700975]
          Length = 289

 Score = 96.6 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 68/193 (35%), Gaps = 1/193 (0%)

Query: 38  PDGVVDFRALLAASPSTMKDV-SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
           P G      +         D  ++G  DAPV + E++   C  C+   N T   L  KY+
Sbjct: 94  PGGDTKSGDITVVHRKKENDPFAVGAVDAPVVISEFSDFECPFCSRHANVTEPDLLKKYV 153

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
           + G +R    +FP++  + V    A  A             L    +D   + +   +  
Sbjct: 154 EKGLVRIEWNDFPVNGPAAVEAAKAGRAAAAQGKFQEFKHELYTASKDISGHPEFGIEDF 213

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
           +  A+ AG +  D        +   ++       +    I  TP F +G     G     
Sbjct: 214 MKFAEKAGVADLDKFRQQATDDTYTEVIEKATSYASQIGITGTPAFVVGDQFVGGAQPPE 273

Query: 217 VFSKIIDSMIQDS 229
           VF +II   +  +
Sbjct: 274 VFEQIIQEQLGKA 286


>gi|153832115|ref|ZP_01984782.1| DsbA oxidoreductase [Vibrio harveyi HY01]
 gi|148871730|gb|EDL70571.1| DsbA oxidoreductase [Vibrio harveyi HY01]
          Length = 260

 Score = 96.6 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 73/179 (40%), Gaps = 15/179 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
            S+G  +A + ++E++   C +C  F + TF  +++ Y+ +GK++Y+ R+FPL       
Sbjct: 85  PSMGDDNATIAIIEFSDYQCPYCKRFTDNTFAKIKENYVDSGKVKYLTRDFPLGFHPQAK 144

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                       G YW     LF+   +   +   +      A         F  CL D 
Sbjct: 145 GAAIAANCSFKQGEYWPMRHALFSNMRNLNTALYQKT-----ASDLKLDIEKFSACLEDP 199

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFI----GG-----NLYLGDMSEGVFSKIIDSMIQ 227
            + ++++     AS    I  TP F +     G      L +G     VFS + D +++
Sbjct: 200 QMAENVENDIALAS-TLGIRGTPSFVVGRIENGQLVGAQLVVGAQDYRVFSALFDDLLK 257


>gi|229492049|ref|ZP_04385863.1| Na+/H+ antiporter NhaA [Rhodococcus erythropolis SK121]
 gi|229321073|gb|EEN86880.1| Na+/H+ antiporter NhaA [Rhodococcus erythropolis SK121]
          Length = 591

 Score = 96.6 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 72/225 (32%), Gaps = 13/225 (5%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +GVL  +VL  +     +    + L E        D   +L        D   G +DA
Sbjct: 376 ATVGVLVAMVLAAVLGAVIFRVAATKLGEAEA-----DLPIVLEPPVDPEIDHIRGPEDA 430

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            +T+VE+    C  CA                   +  +     +D      V       
Sbjct: 431 QLTLVEFVDFECGFCAHATGGWDDLHVHFGDDLRYV--VRHLPLVDIHPHALVAAHAAEA 488

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
                 +W ++  +F +Q+        R  L+  A   G   + F   L+   + + ++ 
Sbjct: 489 AARQHMFWEWLDFVFTRQNALA-----RTDLIGYAAEIGLDVDQFVADLDSDAVAERVQR 543

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               A +      TP FF+ G   +G       +K ++   + + 
Sbjct: 544 DISSA-QSSGARETPTFFVEGCRIIGSYDARTLTKELEHSRRGAR 587


>gi|297566270|ref|YP_003685242.1| DSBA oxidoreductase [Meiothermus silvanus DSM 9946]
 gi|296850719|gb|ADH63734.1| DSBA oxidoreductase [Meiothermus silvanus DSM 9946]
          Length = 236

 Score = 96.6 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 46/208 (22%), Positives = 79/208 (37%), Gaps = 4/208 (1%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
             +         L +   V       AA P+       G   A VT+V++++  C HCA+
Sbjct: 11  GLFLIVAVIAVVLAVVLFVFLRPKPTAADPAAGARFVFGSPSAKVTIVDFSNYLCPHCAD 70

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
              +    +   Y+ TGK+RYI R+FP      V       A       Y  +  +LF  
Sbjct: 71  HALRNVPEIFRDYVDTGKVRYIFRDFPFTGQDNVIRAGEAAACAADANRYRDYHEVLFRA 130

Query: 143 QDDWI--NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
           Q  W   +        +++A   G     F  CL   +    + A +   +   A+  TP
Sbjct: 131 QRLWGGLSGAALDQFFIDLASQLGIPAGPFAECLRSGSKRAGVLADRDL-TTQLALRGTP 189

Query: 201 VFFIGGNLY-LGDMSEGVFSKIIDSMIQ 227
            FF+ G L+  G +    + + I++ + 
Sbjct: 190 TFFVNGQLFDDGYVPYEKWKERIENALA 217


>gi|294084569|ref|YP_003551327.1| DSBA oxidoreductase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664142|gb|ADE39243.1| DSBA oxidoreductase [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 262

 Score = 96.6 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 63/230 (27%), Gaps = 11/230 (4%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +M+   + +   I  L + +   +                    A             IG
Sbjct: 38  LMNRKSVIITTIIAALGMFAVGAFLYS----PTPEKTATATAMPASNEVPLIRPHSPVIG 93

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             DAPVT+VE+    C  C  FH    + L     K   +                  + 
Sbjct: 94  SSDAPVTIVEFFDPACESCRAFHPIVKEILSKFQGKVRVV-----LRYAAFHPPSEEAIR 148

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                R+ G +   +  L   Q  W        ++  + K  G              I+ 
Sbjct: 149 VLETARIQGKFEAVLERLLETQPKWAPHGREPVSIWELIKETGIDVERARRDAKLPGIVA 208

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            +        +   I  TP FF+ G     +        ++ S ++ S R
Sbjct: 209 VLNQDAAD-VKTVGIRGTPTFFVNGKPLP-EFGAQQLHDLVKSEVELSER 256


>gi|145223389|ref|YP_001134067.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
 gi|145215875|gb|ABP45279.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
          Length = 219

 Score = 96.2 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/229 (15%), Positives = 63/229 (27%), Gaps = 12/229 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TRI +   +V+        Y              G    +A   A         + 
Sbjct: 1   MNPMTRILLTFFVVITVAIGAGVYFSSRDGGT-----AGSGGTQADGEAQVVRENSHRLS 55

Query: 62  Q-KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
              D+ VT VE+    C  C        +       +   + ++ R FP+          
Sbjct: 56  SAPDSDVTFVEFLDFECEGCRAAFPAVEQLRAQYGQQ---VTFVARYFPMPGHFNGERAA 112

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNI 179
                    G +      +F  QD W   +    +     A   G     +D   N    
Sbjct: 113 RAVEAAAQQGQFEPMYKKMFETQDQWGEKQVPADEVFRGYATELGLDVAAWDEAYNAPAT 172

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           LD I+      +    +  TP FF+ G       +       I + + +
Sbjct: 173 LDRIQEDVADGT-ALGVQGTPTFFVNGKQLE-IKTYADLGAAIKNALGE 219


>gi|241766654|ref|ZP_04764500.1| DSBA oxidoreductase [Acidovorax delafieldii 2AN]
 gi|241363048|gb|EER58691.1| DSBA oxidoreductase [Acidovorax delafieldii 2AN]
          Length = 259

 Score = 96.2 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 64/181 (35%), Gaps = 14/181 (7%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
            ++G   AP+T+V +    C  C  F  ++   L   YI TGKLR ILR+ PLD      
Sbjct: 82  HTLGATSAPLTLVMFTDHECPFCKRFLQESLPRLRQDYIDTGKLRLILRDLPLDMHPNAQ 141

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                       G +W  +    +           + A+  + +  G   +  D C+ D 
Sbjct: 142 KAAEVARCAAEQGKHWPLLEAFASA-----PEPLAQPAMARLIQGMGLDASRIDACVADG 196

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIG--------GNLYLGDMSEGVFSKIIDSMIQDS 229
                +KA    A      + TP F +G        G   +G        + +D  +  +
Sbjct: 197 RYTAKVKASVAEA-RRLGFNGTPTFVLGATTPGALEGEKMVGIQPYESLKRRLDEHLAKA 255

Query: 230 T 230
            
Sbjct: 256 R 256


>gi|116622720|ref|YP_824876.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116225882|gb|ABJ84591.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 293

 Score = 96.2 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/180 (19%), Positives = 66/180 (36%), Gaps = 9/180 (5%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
             +  T+    IG  +A + +VE++   C +C +      K           +R I ++F
Sbjct: 118 PVAIPTLGSPMIGPANARIVLVEFSDFQCPYCVKA---VAKINAILQAYPNDVRLIFKQF 174

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           PL++    ++  A        G +W     LF  +         R  +L  A   G    
Sbjct: 175 PLETHPQASISAAAALAAHNQGKFWAMHDTLFANRTQLS-----RQNILGWAAKLGLDMK 229

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            F   L+   I   +    +   +   ++ TP  FI G  Y G+++      +ID  ++ 
Sbjct: 230 RFTADLDSDAIKKAVIKDTQDGDKA-GVEGTPTVFIDGQRYNGELALDAVKPVIDGELKR 288


>gi|294813944|ref|ZP_06772587.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|326442355|ref|ZP_08217089.1| hypothetical protein SclaA2_14874 [Streptomyces clavuligerus ATCC
           27064]
 gi|294326543|gb|EFG08186.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
          Length = 293

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 78/225 (34%), Gaps = 11/225 (4%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP--------STMKDVSIGQKD 64
             +LL IASY       S           V                       +++G+ D
Sbjct: 28  AALLLGIASYTATRPDDSPARSSASAPAEVSADPQSGVYAELARLARRDAADPLAVGRAD 87

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APV ++EYA   C  C +F   T   L +KY+ +G LR   R FP+    + A   A  A
Sbjct: 88  APVVLIEYADFKCGFCGKFARDTEPGLIEKYVDSGVLRIEWRNFPIFGAESEAAARAAWA 147

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             R    +    +   +   +    +     L    +      + F   L+       ++
Sbjct: 148 AGRQGRFWQFHAAAYADGSKEKGFGEERLKELA--EEAGVKDADRFARDLDSAEAKAAVR 205

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             ++ A +     STP F + G    G      F++ I++  + +
Sbjct: 206 KDQEEAYQ-LGASSTPSFLVNGRPIAGAQPMETFTEAIEAAHRAA 249


>gi|111018707|ref|YP_701679.1| NahA family Na(+)/H(+) antiporter [Rhodococcus jostii RHA1]
 gi|123340817|sp|Q0SG15|NHAA1_RHOSR RecName: Full=Na(+)/H(+) antiporter nhaA 1; AltName:
           Full=Sodium/proton antiporter nhaA 1
 gi|110818237|gb|ABG93521.1| Na+/H+ antiporter, NhaA family protein [Rhodococcus jostii RHA1]
          Length = 622

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 69/228 (30%), Gaps = 19/228 (8%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           +  R+GVL   V+  +  +  +       + +  P  VV    L    P   +D   G  
Sbjct: 403 NEARVGVLTAAVIATVLGWALFRLS----DTVHPPTEVVGLTLLRPVDPG--RDHLRGPA 456

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           DAP+T+VEY    C  C++              +   +   L    +             
Sbjct: 457 DAPLTLVEYGDFECPFCSKATGSIRDVRAHFGDELRYVFRHLPLDDVHPH--ARFAAQAS 514

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                 G +W     LF   D         D +   A   G   + F+  +     +  I
Sbjct: 515 EAAAAQGRFWEMHDHLFANSDALA-----EDEIFGYAAELGLDMDRFEEDIRRGTYVHRI 569

Query: 184 KAGKKRASEDFAIDSTPVFFIG--GN---LYLGDMSEGVFSKIIDSMI 226
               +  +E      TP F++G  G     + G        + ++   
Sbjct: 570 DDD-ELDAESSDFRGTPTFYLGATGTDLARHSGPYDAATLIRKLEEAR 616


>gi|311743346|ref|ZP_07717153.1| NhaA family sodium:proton (Na+:H+) antiporter [Aeromicrobium
           marinum DSM 15272]
 gi|311313414|gb|EFQ83324.1| NhaA family sodium:proton (Na+:H+) antiporter [Aeromicrobium
           marinum DSM 15272]
          Length = 610

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 43/224 (19%), Positives = 74/224 (33%), Gaps = 15/224 (6%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
            R+GVL   V+ F   +            L          A L       +D   G+ DA
Sbjct: 400 ARVGVLLASVIAFGLGWVVL-------ASLDRHAPTEAVGARLLRPFDPERDHHRGRPDA 452

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           P+ MVEY    C  C+       +  +        +   L    +       +       
Sbjct: 453 PLVMVEYLDFECPFCSRMTGSVDQVSDHFGDDLVWVWRHLPLHRVHPH--SQLAAQAAEA 510

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
             + G +  +  LLF +QDD       R  LL  A   G   + F+  L+   ++  ++ 
Sbjct: 511 AALQGRHLEYGPLLFARQDDLT-----RTDLLAYAAELGLDLDRFEADLDSAAVVRRVQD 565

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
               A     +  TP FFIG   + G +        ++ +  ++
Sbjct: 566 DVDDADLMD-LAGTPTFFIGTERHSGPIDARSLITALERLRTEA 608


>gi|304406113|ref|ZP_07387770.1| DSBA oxidoreductase [Paenibacillus curdlanolyticus YK9]
 gi|304344697|gb|EFM10534.1| DSBA oxidoreductase [Paenibacillus curdlanolyticus YK9]
          Length = 244

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 72/223 (32%), Gaps = 20/223 (8%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           V GG++++ +     + +      +    D                   ++G KDA V +
Sbjct: 30  VTGGVLIIALIVAVAFLKPADKQADPNSFDFNAMA--------------TLGSKDAKVKI 75

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR-CAEKRM 128
           VE+    C  C  F       L+ +YI  G +      +P     +    LA      + 
Sbjct: 76  VEFGDFKCPACQVFSQDVEPQLKAEYIDKGLVSLSFMNYPFIGPDSRTAALAGLSVYHQN 135

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDALLN--MAKFAGFSKNDFDTCLNDQNILDDIKAG 186
           +  +W +   L+  Q +        D L+    ++      +   + + ++   D +   
Sbjct: 136 NDAFWKYYDALYKNQPNESEIWATPDYLVQLAQSEKLDIDFDKLRSDIENETYADQLSDQ 195

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLG--DMSEGVFSKIIDSMIQ 227
             R  +   +  TP  F+ G    G   M        +D  + 
Sbjct: 196 MSR-VKPLGVTGTPTLFVNGTKVGGADAMKYDAVKAAVDKALA 237


>gi|291572113|dbj|BAI94385.1| DSBA oxidoreductase [Arthrospira platensis NIES-39]
          Length = 252

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 63/186 (33%), Gaps = 8/186 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
            +             + G  DA + +VE++   C  C   H    ++++    +   +  
Sbjct: 75  QQMKTQPRAIIGDSPTFGAADAEIVLVEFSDFQCPFCRRAHGTIKEFMDRHQDQVTLVFK 134

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
            L    + + +  A   A  A+++    +W + + LF  QDD   +     A+       
Sbjct: 135 HLPLSQIHAQALPAAKAAWAAQQQG--KFWEYQNALFEGQDDLGEALYEAIAISLGLDL- 191

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
                 F+   N    +  I+   + AS    I  TP F + G    G +      + + 
Sbjct: 192 ----EQFNRDRNSDGAIAAIEQDMQLAS-VLGISGTPFFVMNGETLSGAVDLSTLEETLA 246

Query: 224 SMIQDS 229
            +I   
Sbjct: 247 EVIARE 252


>gi|255530443|ref|YP_003090815.1| DSBA oxidoreductase [Pedobacter heparinus DSM 2366]
 gi|255343427|gb|ACU02753.1| DSBA oxidoreductase [Pedobacter heparinus DSM 2366]
          Length = 173

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 65/162 (40%), Gaps = 8/162 (4%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P    D  IG  DA V +VEY    C HCA  H  T + L+    +   +         
Sbjct: 7   PPVGPGDHVIGHADAAVEIVEYGDFQCPHCAAAHPVTKEILKVFGDQVRFVFRNFPLAES 66

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
              +T+A + A  A  +    YW    ++F  Q          D+L  +A   G +   F
Sbjct: 67  HRYATIAAIAAEAAGLQ--HKYWEMHDMIFEHQASLSY-----DSLFVLAGKLGLNPEQF 119

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
           +  L ++ + D +++  +       ++ TP FF+ GN + G 
Sbjct: 120 ERDLQNEALRDKVESDFESGI-RSGVNGTPSFFVNGNKFDGA 160


>gi|152974300|ref|YP_001373817.1| DSBA oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152023052|gb|ABS20822.1| DSBA oxidoreductase [Bacillus cytotoxicus NVH 391-98]
          Length = 217

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+       +          +A             +G++DAPV
Sbjct: 10  LGIVFSIAVLIVIGTIVYSIINDKKEKGNEMFAYSTQQA-------------LGKEDAPV 56

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV-AVMLARCAEK 126
            +VE+    C  C  +    F  L++ YI  GK+++    FP     +           K
Sbjct: 57  KVVEFGDFKCPACRTWDATVFPRLKEDYINKGKVQFYFINFPFIGKDSELGAAAGEAIYK 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + + + ++
Sbjct: 117 QDPDSFWKFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVNVEQFKKDLHSKEMKEKVR 176

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA E   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 177 KDFDRA-EKLKVQGAPSVYVNGNL--TNPDYDSMKKEIDKELKK 217


>gi|119854999|ref|YP_935604.1| DSBA oxidoreductase [Mycobacterium sp. KMS]
 gi|145225999|ref|YP_001136653.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
 gi|119697717|gb|ABL94789.1| DSBA oxidoreductase [Mycobacterium sp. KMS]
 gi|145218462|gb|ABP47865.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
          Length = 221

 Score = 95.8 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 62/231 (26%), Gaps = 12/231 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TRI +   IV+        Y              G    +A   A         + 
Sbjct: 1   MNPLTRILLTFFIVITVAIGAGVYFSTRDGGT-----AGSGGTQADGEAQVVRENSHRLS 55

Query: 62  Q-KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
              D+ VT VE+    C  C        +          ++ ++ R FP+          
Sbjct: 56  SAPDSDVTFVEFLDFECEGCRAAFPAVEQLRAQY---GQQVTFVARYFPMPGHFNGERAA 112

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY-RDALLNMAKFAGFSKNDFDTCLNDQNI 179
                    G +      +F  Q  W   +    +     A   G     ++   N    
Sbjct: 113 RAVEAAAQQGQFEPMYKKMFETQSQWGEKQVPADEVFRGFATELGLDVAAWEEAYNAPAT 172

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           LD I+      +    +  TP FF+ G       +       I + + +  
Sbjct: 173 LDRIEEDVADGT-ALGVQGTPTFFVNGKQIE-IKTYADLGAAIKNALGEQQ 221


>gi|296272843|ref|YP_003655474.1| DsbA oxidoreductase [Arcobacter nitrofigilis DSM 7299]
 gi|296097017|gb|ADG92967.1| DsbA oxidoreductase [Arcobacter nitrofigilis DSM 7299]
          Length = 213

 Score = 95.8 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 77/219 (35%), Gaps = 14/219 (6%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I ++  I L F+  YF+   K S   ++      V  R            + IG KDA V
Sbjct: 9   IVIVALIGLFFVGGYFYKQNKASEFGKVASEKAEVFQRDY---------SLVIGPKDAKV 59

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            +VE+    C  CA ++      +       G ++ +LR  P  + +  AV +   A ++
Sbjct: 60  QLVEFFDPACGTCAYYYPFVKDLI---KKHKGDIKLVLRYAPFHANANYAVKMLEGAREQ 116

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
                   +      Q    +    R   + + K            +++      I+   
Sbjct: 117 NLFKETLELMFATQNQWLDGHGVVPRKLWIVLEKSNILDMKKLSKSMDNLMYDKIIEQDL 176

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             A     +  TP FF+ G     D+S     K+I+S +
Sbjct: 177 DDA-RVLNVRGTPSFFVNGIPLQ-DLSGENLQKLIESQL 213


>gi|229103716|ref|ZP_04234396.1| hypothetical protein bcere0019_28670 [Bacillus cereus Rock3-28]
 gi|228679592|gb|EEL33789.1| hypothetical protein bcere0019_28670 [Bacillus cereus Rock3-28]
          Length = 226

 Score = 95.8 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 80/227 (35%), Gaps = 13/227 (5%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           ++ ++  +++    + F    K          +  V    ++   P   K  ++G++DAP
Sbjct: 10  KLLLITTLIIFAAVTAFVVFNK----------EEKVATNKVIKDLPPIGKQPTLGKEDAP 59

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM-LARCAE 125
           V+++ +    C  C  +  + F  L+  YI TGK+++           +      A    
Sbjct: 60  VSIIAFGDFKCPACKAWGERIFPQLQKDYIDTGKVKFSYVNVLFHGTESKLSALAAESVY 119

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKN--YRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
           K+    YW F   LFN Q +  +         L     +              +    + 
Sbjct: 120 KQDPQAYWSFHKELFNAQPENHDDPWITPEKLLEIAKTYTPSINTTQLEEDLKKQTEQEE 179

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               ++ ++D++++ TP   + G              +I+  +++  
Sbjct: 180 VNRDEKLTQDYSVEQTPSIVVNGTTLSDPYDYEQIKNLIEKALKEKK 226


>gi|149908466|ref|ZP_01897129.1| putative membrane protein [Moritella sp. PE36]
 gi|149808629|gb|EDM68564.1| putative membrane protein [Moritella sp. PE36]
          Length = 254

 Score = 95.5 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 68/181 (37%), Gaps = 15/181 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
             +G   A + ++E++   C +C  F ++TF  L+  YI  GK++Y+ R+FPL       
Sbjct: 80  PLLGDAGAQLAIIEFSDYQCPYCKRFIDQTFDKLKANYIDVGKVQYLTRDFPLSFHPKAK 139

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                         YW   + LFN            +     A         F  CL+D 
Sbjct: 140 GAAVAANCSLQQDAYWPMRTALFNNMKQLG-----DELYQQTATDLSLDMTKFSDCLSDP 194

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFF---------IGGNLYLGDMSEGVFSKIIDSMIQD 228
             L  ++A     +    I  TP F          +   L +G  S   F  ++D ++++
Sbjct: 195 QTLSKVEADMALGTS-LGIRGTPSFVVGRIEDNQLVNPQLIVGAQSYETFVALLDGLMKE 253

Query: 229 S 229
           +
Sbjct: 254 N 254


>gi|51473314|ref|YP_067071.1| hypothetical protein RT0103 [Rickettsia typhi str. Wilmington]
 gi|81610835|sp|Q68XQ3|DSB_RICTY RecName: Full=Putative protein-disulfide oxidoreductase RT0103;
           Flags: Precursor
 gi|51459626|gb|AAU03589.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 270

 Score = 95.5 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 83/178 (46%), Gaps = 3/178 (1%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
              D+ +G K + V +VEY S TC HCA +H   F  L+ KYI T K+ Y++REF     
Sbjct: 94  DNNDMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPALKKKYIDTNKIAYVVREFIATKQ 153

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                       K     +  F +++  +QD W  S  YR+ L ++ +  G S  ++  C
Sbjct: 154 DL--DAAILARCKGDINSFIQFHNIILQQQDKWAYSNKYRELLTDIGQLGGISPEEYKQC 211

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           LN   I + + A     ++      TP FF+ G +   + S    S+ +D  ++D T+
Sbjct: 212 LNSDKITETLIANTNLVAKAPKFIGTPSFFVNG-VQTENYSIDNISRAVDRALEDETK 268


>gi|16923692|gb|AAL31540.1|AF435074_5 HCCA isomerase [Corynebacterium glutamicum]
          Length = 254

 Score = 95.5 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 67/236 (28%), Gaps = 20/236 (8%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNEL-----------------PIPDGVVDFRALLAAS 51
            V+   VLL       Y    S   E                      G  D       +
Sbjct: 19  LVVIIAVLLIAVVLLMYRGNASDTAEGVSAAATSDSAAASTAASGSASGTADSDLTSVEA 78

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
                 V++G  +APV +V ++   C  CA++ ++T   +            I       
Sbjct: 79  RDPSGPVAVGDVNAPVGLVVFSDYQCPFCAKWSDETLPQMMKHVEDGNL--RIEWREVNI 136

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
                           +   Y  + + LF+  +         + L+ +A   G  ++ F 
Sbjct: 137 FGEPSERGARAAYAAGLQDAYLEYHNALFDNGEKPSEELLSEEGLIKLAGDLGLDESKFT 196

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                      I   ++   +     STP F +GG   +G     VF    +  + 
Sbjct: 197 ADFQSPETAAAIAQHQQLGID-LGAYSTPAFLLGGQPIMGAQPASVFEAAFEQALA 251


>gi|218887262|ref|YP_002436583.1| DSBA oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758216|gb|ACL09115.1| DSBA oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 267

 Score = 95.5 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 60/189 (31%), Gaps = 4/189 (2%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
                     +       G  +APVT++ Y+  TC +C +                 K+R
Sbjct: 80  QVDQTQPKKANLEGRPMRGPANAPVTIIAYSDFTCPYCQQAAGTMELL---LANYKDKVR 136

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
           Y+ +  PLDS     +         +  G   +       +D           L   A  
Sbjct: 137 YVFKHMPLDSHDNARLASEYHVAAGLQDGKKAWAFYETVFRDREKLVAEGEPFLKKAAAD 196

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           AG         +  + + D I+     A     +  TP F +   +  G +   +FS  +
Sbjct: 197 AGLDMKRLAQDIKGKKVKDSIEEDMAEA-RALNVQGTPYFLVNDLVIRGSLPLDLFSDAV 255

Query: 223 DSMIQDSTR 231
           D  ++ + +
Sbjct: 256 DMALEAAAK 264


>gi|320162490|ref|YP_004175715.1| peptidyl-prolyl cis-trans isomerase B [Anaerolinea thermophila
           UNI-1]
 gi|319996344|dbj|BAJ65115.1| peptidyl-prolyl cis-trans isomerase B [Anaerolinea thermophila
           UNI-1]
          Length = 400

 Score = 95.5 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 32/236 (13%), Positives = 69/236 (29%), Gaps = 11/236 (4%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTM--------- 55
             R  +    V+  +         G  +     P    +  ++L     T+         
Sbjct: 1   MLRKLLPLLAVMALLLGACQPQTAGGKVPISGTPMAGCEVSSVLPTPNPTLQALIPAPGK 60

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
            D  +G+  A VT++EY+   C +CA       + +E        +          +   
Sbjct: 61  DDHILGKDTALVTIIEYSDYQCPYCAMLAPVLRQLVEKYPDDVRVVFRYFPLTSHPNSWV 120

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
            A       ++         +      Q      +N  D  + +A+    + + F     
Sbjct: 121 AAQAAEAAGKQGKFVEMHELIFA-QQDQLANYTPENALDYFVTLAEQLKLNVDQFKQDYA 179

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + +   I+     A     +  TP  F+ G  Y   M     S +++     + +
Sbjct: 180 SEEVKARIQKNLDEAMNT-GLPGTPFLFLNGLPYQDRMDLETLSSLVELFKLQARQ 234


>gi|163845898|ref|YP_001633942.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222523620|ref|YP_002568090.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
 gi|163667187|gb|ABY33553.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222447499|gb|ACM51765.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
          Length = 260

 Score = 95.5 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/198 (17%), Positives = 70/198 (35%), Gaps = 1/198 (0%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
               + +    I    +   ++     S      +G  +APVT++E+    C  C   H 
Sbjct: 59  VFTPTPIPTPVISADGITTASMAQLGISAEPYAILGDPNAPVTIIEFTDFGCTFCRRHHV 118

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
            TF  L +++I +G++ Y++R+ P+ S       LA          +     L       
Sbjct: 119 LTFPALREEFISSGQVFYVVRQLPVTSPHGDQAALAALCAGEQGKYWEMHDQLFAAGDAW 178

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
           + ++   R  ++ +A   G        C+        +      A     +  TP FFI 
Sbjct: 179 YSDATTARRRIIALATDLGLDSAVLQRCMEHPATQATLARHVSEAH-ALRVFGTPTFFIN 237

Query: 206 GNLYLGDMSEGVFSKIID 223
             L+ G      +  +++
Sbjct: 238 NQLFAGAQPIARWRDVLE 255


>gi|256831273|ref|YP_003160000.1| DSBA oxidoreductase [Jonesia denitrificans DSM 20603]
 gi|256684804|gb|ACV07697.1| DSBA oxidoreductase [Jonesia denitrificans DSM 20603]
          Length = 299

 Score = 95.5 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/246 (15%), Positives = 72/246 (29%), Gaps = 30/246 (12%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS--------- 59
            ++  ++ L +          +  +    P G                D           
Sbjct: 56  FIVLTVIALIVLVLAIQPSTTNQADPQQPPVGTEQSTDTADQDTQGDTDAVEPPADVQGP 115

Query: 60  ------------------IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
                             +G  DAPV MV ++   C +CA++ N T   LE+        
Sbjct: 116 DEVNIADIERRDPNDPLAVGPVDAPVVMVVFSDYQCPYCAKWSNDTLTVLENYVDAGDL- 174

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
             +                         G +  +   LF   +         D L+ +A 
Sbjct: 175 -RVEWRDVNIFGENSERAARASYAAGQQGQFLAYHHALFPGGEISSEQVLSEDGLIALAG 233

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKI 221
             G   + F   L  ++  +++    +   +     STP F +GG   +G     VF+  
Sbjct: 234 DLGLDTDQFTKDLTSKDTAEEVAKNAQLGLD-LGAYSTPAFLVGGQPIVGAQPTDVFTSA 292

Query: 222 IDSMIQ 227
           ID+ +Q
Sbjct: 293 IDTALQ 298


>gi|182437678|ref|YP_001825397.1| hypothetical protein SGR_3885 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178466194|dbj|BAG20714.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 265

 Score = 95.5 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 47/230 (20%), Positives = 84/230 (36%), Gaps = 17/230 (7%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP----------- 52
           S++R  ++ G V +  A    +    +   +   PD      A ++A P           
Sbjct: 14  SSSRKPLVYGAVTVVAAGLLGFASYRATAPDDTAPDTSSAPAAEVSADPNEGVYPELAKL 73

Query: 53  ---STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
                   +++G+ DAPV ++EYA   C +C +F   T   L ++Y+K G LR   R FP
Sbjct: 74  ARRDADDKLAVGRADAPVVLIEYADFKCGYCGKFARDTEPELIEQYVKDGTLRIEWRNFP 133

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           +    +        A  + +  +    +       +    K+   AL    +      + 
Sbjct: 134 IFGEESENAARGAWAAGQQNRFWEFHGAAYAEGAKEKGFGKDRVKALA--EEAGVKDLDR 191

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           F   L+       +K  +++A       STP F I G    G   +  F 
Sbjct: 192 FMKDLDGDAARAAVKKDQEQAY-GIGATSTPSFLINGRPIAGAQPDETFR 240


>gi|262184070|ref|ZP_06043491.1| putative secreted protein [Corynebacterium aurimucosum ATCC 700975]
          Length = 261

 Score = 95.5 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 68/193 (35%), Gaps = 1/193 (0%)

Query: 38  PDGVVDFRALLAASPSTMKDV-SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
           P G      +         D  ++G  DAPV + E++   C  C+   N T   L  KY+
Sbjct: 66  PGGDTKSGDITVVHRKKENDPFAVGAVDAPVVISEFSDFECPFCSRHANVTEPDLLKKYV 125

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
           + G +R    +FP++  + V    A  A             L    +D   + +   +  
Sbjct: 126 EKGLVRIEWNDFPVNGPAAVEAAKAGRAAAAQGKFQEFKHELYTASKDISGHPEFGIEDF 185

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
           +  A+ AG +  D        +   ++       +    I  TP F +G     G     
Sbjct: 186 MKFAEKAGVADLDKFRQQATDDTYTEVIEKATSYASQIGITGTPAFVVGDQFVGGAQPPE 245

Query: 217 VFSKIIDSMIQDS 229
           VF +II   +  +
Sbjct: 246 VFEQIIQEQLGKA 258


>gi|149922484|ref|ZP_01910916.1| DsbA oxidoreductase [Plesiocystis pacifica SIR-1]
 gi|149816679|gb|EDM76171.1| DsbA oxidoreductase [Plesiocystis pacifica SIR-1]
          Length = 680

 Score = 95.5 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/214 (12%), Positives = 54/214 (25%), Gaps = 10/214 (4%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASP----STMKDVSIGQKDAPVTMVEYASMT 76
           +       G A        G                      + G+ DA VT++ +  M 
Sbjct: 254 ALMALASDGPAFEARKPSGGSKARPGRPDPEVHYAVPVDGRPTKGRADALVTLIAFGDMQ 313

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C  C +         +        +               A+ L     +        F 
Sbjct: 314 CPFCRKAEATLDALAKRYGKDLRIVYRHNPLPMHAQAKDAALALVAADRQG------EFF 367

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
           ++     +   + +     + +                        I A  ++ ++ F  
Sbjct: 368 AMRAALYEAAEDGRLAESGIFSTLARQLGLDIRSFKADMADPDAAKIIAEDQKVAQQFGA 427

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
             TP FF+ G    G   E  F+ +ID  +  + 
Sbjct: 428 TGTPAFFVNGRFLSGAQPEAAFAALIDEELDSAK 461



 Score = 75.8 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 67/201 (33%), Gaps = 13/201 (6%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQK--DAPVTMVEYASMTCFHCAEFHNKT 87
            A  +                 P +  D+S G    +A +T+V ++   C +C   H+  
Sbjct: 48  DARAQELADAVEGQLEGERFRVPVSASDLSFGAPAAEARITIVVFSDYQCPYCGRLHDAL 107

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI 147
            +       ++  +R + + FPL                +  G       ++F +  +  
Sbjct: 108 DEVA----ARSQDVRVVYKHFPLAMHGEARDAALALLAAQRQGRGLELHRVMFERPGELS 163

Query: 148 NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
                   L  +A+ AG    +       Q +  +I  G     +  A+ STP +FI G 
Sbjct: 164 E-------LEPLARAAGIQDVEGLLVEVGQGMGAEIVDGDIELGKALAVRSTPSYFINGL 216

Query: 208 LYLGDMSEGVFSKIIDSMIQD 228
              G  +     ++I +  + 
Sbjct: 217 PVRGARAAEQLEELIAAEREQ 237



 Score = 75.0 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 38/206 (18%), Positives = 65/206 (31%), Gaps = 8/206 (3%)

Query: 22  YFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCA 81
           Y   ++  +   E+P           L   P      S  ++ A + ++      C +CA
Sbjct: 475 YAAMSKSWATKVEVPPVAAHSREAVALDGRPVRGVQPSK-KRKADIEILTCLDFDCPYCA 533

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
            +H    + L      +GK+ Y +  FPL                   G +W    LLF 
Sbjct: 534 RWHQTIDEALA-DGRYSGKVSYAVAHFPLPMHKDAEGAHRAAIAAGEQGKFWEMHDLLFA 592

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
            +             L  A+F       F   L        I A K+  S+   +  TP 
Sbjct: 593 DKSKRS-----EADYLEYARFLQLDVARFSKDLASAATQAVIDADKQLCSK-LGVSGTPH 646

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            F+ G    G +   +   ++D  + 
Sbjct: 647 SFVNGRSMRGALPMTMVGPVLDEELA 672


>gi|239928300|ref|ZP_04685253.1| hypothetical protein SghaA1_08748 [Streptomyces ghanaensis ATCC
           14672]
 gi|291436629|ref|ZP_06576019.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
 gi|291339524|gb|EFE66480.1| DSBA oxidoreductase [Streptomyces ghanaensis ATCC 14672]
          Length = 252

 Score = 95.5 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 69/198 (34%), Gaps = 1/198 (0%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
                + +  A+   P     VD   L  A       ++IG+ DAPV M+EY+   C  C
Sbjct: 43  GGGTRSEQPPAVVSEPSRMPPVDDGLLALARREPSDALAIGRADAPVVMIEYSDFQCPFC 102

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
            +F  +T   L   Y+  G LR   R FP+    +    LA  A  R    +     +  
Sbjct: 103 GKFARETKPELLRSYVDKGVLRIEWRNFPVFGEESERAALAGWAAGRQQKFWEFHDVVYG 162

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
             +    +  +    +    +      + F   +      + ++  ++       + STP
Sbjct: 163 KPRARNADEFSQDRLVGMAREAGVADIDRFRADMASAEAREAVRRDREEGYS-LGVASTP 221

Query: 201 VFFIGGNLYLGDMSEGVF 218
            F + G   LG      F
Sbjct: 222 AFLVNGRPVLGAQPTDTF 239


>gi|229083781|ref|ZP_04216097.1| disulfide bond formation protein D [Bacillus cereus Rock3-44]
 gi|228699532|gb|EEL52201.1| disulfide bond formation protein D [Bacillus cereus Rock3-44]
          Length = 219

 Score = 95.1 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 82/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+KDAPV
Sbjct: 12  LGIVFSIAVLIVIGTIAYSIINDKKDKGDEMFAYSSQQS-------------LGKKDAPV 58

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L++ YI   K+++    FP     + +         K
Sbjct: 59  KVVEFGDFKCPACRTWDATVLPRLKEDYINKDKVQFYFINFPFIGKDSDLGAAAGEAIYK 118

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      + + F   L+ + I + ++
Sbjct: 119 QDPESFWTFYDEIYQNQGKDTEEWITEELLLNIVKEKLPKVNVDQFKKDLHSKEIQEKVR 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 179 KDADRA-KKLKVQGAPSVYVNGNL--TNPDYDSIKKEIDKALKK 219


>gi|297560316|ref|YP_003679290.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296844764|gb|ADH66784.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 241

 Score = 95.1 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 77/209 (36%), Gaps = 3/209 (1%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                 G    +    +       L    P      ++G  DAPV ++ Y+   C  CA+
Sbjct: 36  GAAGSPGGTAADTVSEETRAAGEELARRDP--ADPHAMGTADAPVVLIVYSDYLCPFCAD 93

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
           + ++T   L + Y+  G +R   REFP     +  +     A    D  +     +    
Sbjct: 94  WVHRTQPELVEAYVAPGLVRIEWREFPYLGEGSRLLARGAVAAGNQDRFWEYHARVYAAP 153

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           +D   ++   R ++ + A+  G   + F   L+       ++       +D  +   P F
Sbjct: 154 EDFTGDADEVRASMRDAAEEIGLDTDAFARDLDAAEAGAAVERDFTEG-QDMGMSGAPAF 212

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + G+  LG      F+  ID+ ++ + R
Sbjct: 213 LVNGDPVLGAQPLEAFTDSIDAALRAAGR 241


>gi|295705305|ref|YP_003598380.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium DSM 319]
 gi|294802964|gb|ADF40030.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium DSM 319]
          Length = 235

 Score = 95.1 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/229 (16%), Positives = 77/229 (33%), Gaps = 21/229 (9%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I  + GI+ + I      +       +        +                +G++ APV
Sbjct: 22  IFWVIGIIAVCILGLIVLSNMSKGGGDEKAALTYDNQ-------------PYLGKESAPV 68

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            +VE+    C  C  F    F  ++  Y+ TGK+++    +   +  +           +
Sbjct: 69  EVVEFGDYKCPACKNFTESFFPLIQKDYVDTGKVKFYFMNYAFINNDSSRAAEFAETVYK 128

Query: 128 --MDGGYWGFVSLLFNKQD--DWINSKNYRDALLNMAKFAGFSKNDFD--TCLNDQNILD 181
              +  +W F  LL+ KQ+  D          L +  K      +     +   D    D
Sbjct: 129 ELGNDTFWKFHELLYKKQNAADEKKDVLTESYLEDTLKEVSRDADAKKVASAFKDGKGKD 188

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                 K A  +  I  TP  ++GG  + G  +   F +++    +++ 
Sbjct: 189 AFDQDMKTA-NNLGITGTPTIYVGGKKFEGK-TIDDFDQMVKDAAKENK 235


>gi|221215314|ref|ZP_03588279.1| Na+/H+ antiporter NhaA [Burkholderia multivorans CGD1]
 gi|221164746|gb|EED97227.1| Na+/H+ antiporter NhaA [Burkholderia multivorans CGD1]
          Length = 641

 Score = 95.1 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 72/225 (32%), Gaps = 16/225 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +GVL  ++L  +  +  +        E        D   +L        D   G +DA
Sbjct: 427 ATVGVLVSMMLATLLGWLIFKVAARRWGE-----ETADLPMVLEPPVDPEVDHIRGPEDA 481

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            +T+VEY    C +CA                   +   L   P        +       
Sbjct: 482 QLTLVEYVDFECEYCAHATGSWEDLRAHFGDDLRYVVRHLPHHPHGP-----IAARASEA 536

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
               G +W ++  +F +Q         R+ L+  A   G   + F   L+   +++ ++ 
Sbjct: 537 ASNQGMFWPWLDFVFTRQHALE-----REDLIGYAAELGLDVDRFIADLDSPAVIERVER 591

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               A       +TP FF+ G    G       +  +++  + + 
Sbjct: 592 DLASAV-ASGAHATPTFFVEGRRLRGSYDARSVTAALEASRRGTR 635


>gi|196034723|ref|ZP_03102131.1| conserved hypothetical protein [Bacillus cereus W]
 gi|195992766|gb|EDX56726.1| conserved hypothetical protein [Bacillus cereus W]
          Length = 217

 Score = 95.1 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 10  LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 56

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 57  KVVEFGDFKCPACRTWDVTVLPQLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 117 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFKKDLHSKEIKEKVR 176

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 177 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSLKKAIDKELKK 217


>gi|257069593|ref|YP_003155848.1| protein-disulfide isomerase [Brachybacterium faecium DSM 4810]
 gi|256560411|gb|ACU86258.1| protein-disulfide isomerase [Brachybacterium faecium DSM 4810]
          Length = 282

 Score = 95.1 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 67/201 (33%), Gaps = 3/201 (1%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
                 +  P  V         +      ++ G  DAPV ++ +    C +CAE+  +T 
Sbjct: 83  AEDPGAVEHPSSVAVPDLSEEEARDEDDLLAEGPVDAPVVLIVFTDYQCPYCAEWSQETL 142

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN 148
             + +   +      I                           +  +   LF   +    
Sbjct: 143 PAVREYVERGEL--RIEWRDVNIYGDDSERAARASLAAARQDAHAEYHDRLFEGGEIRTG 200

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           ++    +L+ +A   G     F   L+ + + + I A   +  +   I STP F +GG  
Sbjct: 201 AELDESSLVALADELGLDTEQFTEDLHSEEVAETISANASQGWD-LGIMSTPAFVVGGTP 259

Query: 209 YLGDMSEGVFSKIIDSMIQDS 229
            +G     VF+  ID  + +S
Sbjct: 260 MVGAQPTDVFTTAIDDALAES 280


>gi|222150255|ref|YP_002559408.1| thiol-disulfide oxidoreductase DsbD [Macrococcus caseolyticus
           JCSC5402]
 gi|222119377|dbj|BAH16712.1| thiol-disulfide oxidoreductase DsbD [Macrococcus caseolyticus
           JCSC5402]
          Length = 235

 Score = 95.1 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 66/230 (28%), Gaps = 3/230 (1%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           ++ +     ++ G++   I S             L   +        L           I
Sbjct: 7   LIFTMIMTLLVIGVIAALIISNQNKKESSVDTESLGTANTNNQQGLKLLDQIDIKDQPMI 66

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK--TGKLRYILREFPLDSVSTVAV 118
           G+ +A VT++E+    C  C  F       L+ KYI     KL +I   F  +     ++
Sbjct: 67  GKDEAKVTIIEFGDFKCPACKVFELDIKPDLKKKYIDSGKAKLYFINTPFHGEGSMLGSL 126

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
                 ++  D       +L   + D                  A  + +     +    
Sbjct: 127 AAETLIKQEPDKYSAFQQALFEMQPDTEEEWLTIDAVKKAAKTAAVSNIDKLVKDVEALK 186

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               +K       E   +  TP   + G      M      K+ID  ++ 
Sbjct: 187 EKAAVKKDINL-VEKHNVTMTPTIIVNGKEVKNPMDPAEVDKVIDEAVKQ 235


>gi|118575427|ref|YP_875170.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
 gi|118193948|gb|ABK76866.1| protein-disulfide isomerase [Cenarchaeum symbiosum A]
          Length = 212

 Score = 95.1 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 69/177 (38%), Gaps = 6/177 (3%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ++     +G  DAP+T+VE+    C  C  + + T   + ++YI+TG ++++  +     
Sbjct: 35  TSNGSPVVGNADAPITIVEFGDYQCHQCYNWFHNTKPGITEEYIETGMVKFVFVDMAFLG 94

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             ++   +A          +     L   +     +    R+ L   A   G     FD 
Sbjct: 95  RDSLPASVAAYCAGDQGMYWEYHDMLYTLQDPQIDSGWASRERLKAFAFDLGLDPGVFDG 154

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFI---GGN--LYLGDMSEGVFSKIIDS 224
           CL+       +++    A E F +  TP F I    G     +G     VF  ++DS
Sbjct: 155 CLDSNKHQGRVQSNVAEARE-FGVSGTPTFAIIFEDGRTETIVGAQPFSVFKNVLDS 210


>gi|308271840|emb|CBX28448.1| hypothetical protein N47_G37720 [uncultured Desulfobacterium sp.]
          Length = 252

 Score = 94.7 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 69/179 (38%), Gaps = 10/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ST      G  +APV +V +    C +CA+      + L+    +   ++ + + FPL S
Sbjct: 81  STAGSPFKGPSNAPVVLVLFTDFECPYCAQLVPVLDQVLKKYPKE---VKLVFKNFPLQS 137

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
                            G +W F  LLF        ++     L  + K AG +K +FD 
Sbjct: 138 HRYAMNAAIAALAAESQGKFWEFHDLLFKN-----YNQLNDKKLEEIIKMAGLNKQEFDK 192

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            ++D   +  +K           +  TP  FI G L   ++S   F K ID  ++   +
Sbjct: 193 KMHDPQTIQKVKKDTIEGINAD-VRGTPSVFINGKLLK-NLSMTEFIKAIDKELKKVQK 249


>gi|317122836|ref|YP_004102839.1| DSBA oxidoreductase [Thermaerobacter marianensis DSM 12885]
 gi|315592816|gb|ADU52112.1| DSBA oxidoreductase [Thermaerobacter marianensis DSM 12885]
          Length = 300

 Score = 94.7 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 40/188 (21%), Positives = 65/188 (34%), Gaps = 5/188 (2%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
                        +   +G   APVT+VE+A   C +C EF    F    + YI TGK+R
Sbjct: 76  GEAPASPDVFQLDRQPMLGSAGAPVTVVEFADFKCPYCREFAMNEFPRFREAYIDTGKVR 135

Query: 103 YILREFPLDSVSTVAVMLA-RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
           +    +P     +     A      +   G W F+  +   Q          + L++ A+
Sbjct: 136 FYFINYPFIGPDSDTAAQALEAIYAQAPEGVWAFIDRVMQLQGPEDQQWATPEFLVDAAR 195

Query: 162 FAGFSKNDFD--TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
            A    +       L      D ++A +  A     +  TP  F+ G     D S    S
Sbjct: 196 QAVPGIDAERLAQDLRSGRYRDAVEADRAIA-RRVGVQGTPALFVNGRFVP-DWSFEGLS 253

Query: 220 KIIDSMIQ 227
             +D  + 
Sbjct: 254 AAVDEALA 261


>gi|294499922|ref|YP_003563622.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium QM B1551]
 gi|294349859|gb|ADE70188.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium QM B1551]
          Length = 235

 Score = 94.7 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 77/229 (33%), Gaps = 21/229 (9%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I  + GI+ + I      +       +        +                +G++ APV
Sbjct: 22  IFWVIGIIAVCILGLIVLSNMSKGGGDERAALTYDNQ-------------PYLGKESAPV 68

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            +VE+    C  C  F    F  ++  Y+ TGK+++    +   +  +           +
Sbjct: 69  EVVEFGDYKCPACKNFTESFFPLIQKDYVDTGKVKFYFMNYAFINNDSSRAAEFAETVYK 128

Query: 128 --MDGGYWGFVSLLFNKQD--DWINSKNYRDALLNMAKFAGFSKNDFD--TCLNDQNILD 181
              +  +W F  LL+ KQ+  D          L +  K      +     +   D    D
Sbjct: 129 ELGNDTFWKFHELLYKKQNAADEKKDVLTESYLEDTLKEVSSDADAKKVASAFKDGKGKD 188

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                 K A  D  I  TP  ++GG  + G  +   F +++    +++ 
Sbjct: 189 AFDQDMKTA-NDLGITGTPTIYVGGKKFEGK-TIDDFDQMVKDAAKENK 235


>gi|30260702|ref|NP_843079.1| hypothetical protein BA_0544 [Bacillus anthracis str. Ames]
 gi|47525817|ref|YP_017166.1| hypothetical protein GBAA_0544 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|167635698|ref|ZP_02394009.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|167640666|ref|ZP_02398927.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170688485|ref|ZP_02879692.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|170708195|ref|ZP_02898641.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|177653756|ref|ZP_02935857.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190568219|ref|ZP_03021128.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196041354|ref|ZP_03108648.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|227816584|ref|YP_002816593.1| hypothetical protein BAMEG_4042 [Bacillus anthracis str. CDC 684]
 gi|229600248|ref|YP_002865147.1| hypothetical protein BAA_0625 [Bacillus anthracis str. A0248]
 gi|254684378|ref|ZP_05148238.1| hypothetical protein BantC_11017 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254722179|ref|ZP_05183968.1| hypothetical protein BantA1_06902 [Bacillus anthracis str. A1055]
 gi|254738842|ref|ZP_05196545.1| hypothetical protein BantWNA_27074 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254743773|ref|ZP_05201457.1| hypothetical protein BantKB_22659 [Bacillus anthracis str. Kruger
           B]
 gi|254755066|ref|ZP_05207100.1| hypothetical protein BantV_21532 [Bacillus anthracis str. Vollum]
 gi|254762200|ref|ZP_05214044.1| hypothetical protein BantA9_27277 [Bacillus anthracis str.
           Australia 94]
 gi|34921575|sp|Q81YT8|BDBD_BACAN RecName: Full=Probable disulfide bond formation protein D; AltName:
           Full=Disulfide oxidoreductase D; AltName:
           Full=Thiol-disulfide oxidoreductase D; Flags: Precursor
 gi|30254070|gb|AAP24565.1| conserved hypothetical protein [Bacillus anthracis str. Ames]
 gi|47500965|gb|AAT29641.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|167511381|gb|EDR86766.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|167528957|gb|EDR91713.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|170126851|gb|EDS95732.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|170667510|gb|EDT18266.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|172081148|gb|EDT66224.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190560711|gb|EDV14687.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196027839|gb|EDX66452.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|227003673|gb|ACP13416.1| conserved hypothetical protein [Bacillus anthracis str. CDC 684]
 gi|229264656|gb|ACQ46293.1| conserved hypothetical protein [Bacillus anthracis str. A0248]
          Length = 217

 Score = 94.7 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 10  LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 56

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 57  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 117 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFKKDLHSKEIKEKVR 176

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 177 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSLKKAIDKELKK 217


>gi|163938469|ref|YP_001643353.1| DSBA oxidoreductase [Bacillus weihenstephanensis KBAB4]
 gi|163860666|gb|ABY41725.1| DSBA oxidoreductase [Bacillus weihenstephanensis KBAB4]
          Length = 217

 Score = 94.7 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 10  LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 56

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 57  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + + D ++
Sbjct: 117 QDQDSFWIFYDEIYQNQKKDTEEWITEELLLNIVKEKLPKINVEQFKKDLHSKEMKDKVR 176

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 177 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 217


>gi|49481661|ref|YP_034804.1| thiol-disulfide oxidoreductase (disulfide bond formation protein D)
           (disulfideoxidoreductase D) [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|49333217|gb|AAT63863.1| probable thiol-disulfide oxidoreductase (disulfide bond formation
           protein D) (disulfideoxidoreductase D) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
          Length = 219

 Score = 94.7 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 82/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+   +  ++          ++             +G+ DAPV
Sbjct: 12  LGIVFSIAVLIVIGTIVYSIINNKKDKGNEMFAYSTQQS-------------LGKDDAPV 58

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 59  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 118

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 119 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFKKDLHSKEIKEKVR 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 179 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSLKKAIDKELKK 219


>gi|116619661|ref|YP_821817.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
 gi|116222823|gb|ABJ81532.1| DSBA oxidoreductase [Candidatus Solibacter usitatus Ellin6076]
          Length = 246

 Score = 94.7 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 42/200 (21%), Positives = 70/200 (35%), Gaps = 14/200 (7%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
           +   P    + +   A          +G K AP+T+VEY    C  C  FH   F  L+ 
Sbjct: 51  QQAKPAAPQEEQPTRAKITDLSGVSMLGTKTAPLTIVEYTDYQCPFCQRFHVTAFSELKK 110

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           +YI TGK+R+  ++ PLD                    +W    ++          K   
Sbjct: 111 QYIDTGKVRFFSKDMPLDFHPNALRAAQAARCAAEQKKFWELRDVMGAN-----PDKLDI 165

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF--------IG 205
           D ++N A            C++     D ++     A +    + TP F         + 
Sbjct: 166 DHIMNFAADLKMDTAALRACVDSGKYKDTVQRDVLEAMK-IGANGTPTFIVGKSVGEGVD 224

Query: 206 GNLYLGDMSEGVFSKIIDSM 225
           G L +G M   +F   + S+
Sbjct: 225 GELVVGAMPFEMFDAKLKSL 244


>gi|225862522|ref|YP_002747900.1| hypothetical protein BCA_0581 [Bacillus cereus 03BB102]
 gi|225788028|gb|ACO28245.1| conserved hypothetical protein [Bacillus cereus 03BB102]
          Length = 217

 Score = 94.7 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 10  LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 56

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 57  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 117 QDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVEQFKKDLHSKEIKEKVR 176

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 177 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 217


>gi|284052965|ref|ZP_06383175.1| DSBA oxidoreductase [Arthrospira platensis str. Paraca]
          Length = 252

 Score = 94.7 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 63/186 (33%), Gaps = 8/186 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
            +             + G  DA + +VE++   C  C   H    ++++    +   +  
Sbjct: 75  QQMKTQPRAIIGDSPTFGAADAEIVLVEFSDFQCPFCRRAHGTIKEFMDRHQDQVTLVFK 134

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
            L    + + +  A   A  A+++    +W + + LF  QDD   +     A+       
Sbjct: 135 HLPLSQIHAQALPAAKAAWAAQQQG--KFWEYQNALFEGQDDLGEALYEAIAISLGLDL- 191

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
                 F+   N    +  I+   + AS    I  TP F + G    G +      + + 
Sbjct: 192 ----EQFNRDRNSDGAIAAIEQDMQLAS-VIGISGTPFFVMNGETLSGAVDLSTLEETLA 246

Query: 224 SMIQDS 229
            +I   
Sbjct: 247 EVIARE 252


>gi|33867165|ref|NP_898723.1| hypothetical protein PBD2.108 [Rhodococcus erythropolis]
 gi|33668999|gb|AAP73993.1| conserved hypothetical protein [Rhodococcus erythropolis]
          Length = 236

 Score = 94.7 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/226 (12%), Positives = 68/226 (30%), Gaps = 13/226 (5%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           +  +  +    V   +        + +         G    R       +          
Sbjct: 23  TNAKFSIALVAVFAVVLGALLLGNRSATETTNAGASGASVLRDDTHLLSTA--------P 74

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           D  V +VE+    C  C   +    +    +     ++ + +R FP+ S +   +     
Sbjct: 75  DNDVVLVEFLDFECEACLAMYPTMERI---RAEYADRITFGVRYFPIPSHTNSGLAARVV 131

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINS-KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G +      +++ Q  W  S ++      + A+  G     FD  +ND  + + 
Sbjct: 132 EASSRQGKFVEMYQRMYDTQTQWGESSESQEAVFRSFAQDLGLDMAAFDADVNDPAVAER 191

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++       +   +  TP  F+ G       +    +  ID+ +  
Sbjct: 192 VEQDFNEGID-LGVQGTPTLFLNGVQLPSMPTYDDLTARIDAALSQ 236


>gi|218901684|ref|YP_002449518.1| hypothetical protein BCAH820_0544 [Bacillus cereus AH820]
 gi|218538254|gb|ACK90652.1| conserved hypothetical protein [Bacillus cereus AH820]
          Length = 217

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 10  LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 56

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 57  KVVEFGDFKCPACRTWDVTVLPRLKEEYIAKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 117 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFKKDLHSKEIKEKVR 176

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 177 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSLKKAIDKELKK 217


>gi|94264471|ref|ZP_01288259.1| DSBA oxidoreductase [delta proteobacterium MLMS-1]
 gi|93455102|gb|EAT05326.1| DSBA oxidoreductase [delta proteobacterium MLMS-1]
          Length = 282

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 70/210 (33%), Gaps = 11/210 (5%)

Query: 19  IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
           +++    +        +   + V +     A      +   +G +DA V +VE++   C 
Sbjct: 82  LSAVGLQSAGIPEKLLVAGDEVVQELELQFAVEIDISEAPFLGPEDASVVLVEFSDFQCP 141

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
           HCA          E   +    L+ + + FPL S              +  G +W     
Sbjct: 142 HCAR----VKPLTEQLLLNNDDLKVVFKHFPLSSHEQAKPAALAAMAAQQQGKFWEMHDR 197

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           +F  Q D          L  +A+  G     F   +N + +   ++       +   +  
Sbjct: 198 IFAAQQDLSPRT-----LQEIARDIGLDMELFQRDINSRELARRLEQDMADGQQA-GVRG 251

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           TP  FI G       ++    ++ID  ++ 
Sbjct: 252 TPALFINGIPVT-QRNQQGIQQMIDRALER 280


>gi|84496057|ref|ZP_00994911.1| hypothetical protein JNB_01020 [Janibacter sp. HTCC2649]
 gi|84382825|gb|EAP98706.1| hypothetical protein JNB_01020 [Janibacter sp. HTCC2649]
          Length = 228

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/225 (13%), Positives = 67/225 (29%), Gaps = 7/225 (3%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           +  +  V+   +++                     D                    +G  
Sbjct: 7   NAVKRNVIVSSLVVATFVALVTAALTLGAKTADPADPADAATGTATGKLVRDDSHRLGAA 66

Query: 64  -DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
               V +VE+    C  C        +    +    GK+ +++R FP+DS +        
Sbjct: 67  GTGEVVLVEFLDFECESCRAAFPVVEEL---RATYAGKVDFVVRYFPIDSHANAVNSAVA 123

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD-ALLNMAKFAGFSKNDFDTCLNDQNILD 181
                    +      ++  Q  W   +  +       A+  G     +D  + D+  L+
Sbjct: 124 VEAAAQQDKFEEMYKRMYETQAAWGEQRESKASVFRGFAQELGLDMAAYDKAVADKATLE 183

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            ++  ++   +   +  TP FF+ G       S   F   I++ +
Sbjct: 184 RVERDRQDGLD-LGVQGTPTFFLNGKKLE-PTSTQDFRDKIEAAL 226


>gi|228944297|ref|ZP_04106671.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228815377|gb|EEM61624.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 210

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPQLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 110 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFKKDLHSKEIKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSLKKAIDKELKK 210


>gi|49183539|ref|YP_026791.1| hypothetical protein BAS0513 [Bacillus anthracis str. Sterne]
 gi|49177466|gb|AAT52842.1| conserved hypothetical protein [Bacillus anthracis str. Sterne]
          Length = 219

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 12  LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 58

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 59  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 118

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 119 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFKKDLHSKEIKEKVR 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 179 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSLKKAIDKELKK 219


>gi|65317963|ref|ZP_00390922.1| COG1651: Protein-disulfide isomerase [Bacillus anthracis str.
           A2012]
 gi|165871788|ref|ZP_02216432.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|228925732|ref|ZP_04088817.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229089606|ref|ZP_04220869.1| disulfide bond formation protein D [Bacillus cereus Rock3-42]
 gi|229120140|ref|ZP_04249391.1| disulfide bond formation protein D [Bacillus cereus 95/8201]
 gi|164712513|gb|EDR18046.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|228663181|gb|EEL18770.1| disulfide bond formation protein D [Bacillus cereus 95/8201]
 gi|228693724|gb|EEL47424.1| disulfide bond formation protein D [Bacillus cereus Rock3-42]
 gi|228833925|gb|EEM79477.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 210

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 110 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFKKDLHSKEIKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSLKKAIDKELKK 210


>gi|149923922|ref|ZP_01912309.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149815210|gb|EDM74758.1| DSBA-like thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 508

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 48/207 (23%), Gaps = 10/207 (4%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
           ++     + +     P    VV    L     +  K        A V +V      C  C
Sbjct: 303 AWSQARARSNPPKPGPDTRQVVATAKLTPRRGAAKKGQRAKDP-AKVELVMCGDFDCPFC 361

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
                                                        +      +  +    
Sbjct: 362 KRSTATLTALEARYGSDLAVFFRHFPLPMHKDARPAHRAAIAADNQGQLWAMFELLYAEP 421

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
            ++            L  MAK        F   + D +    I A  K       +  TP
Sbjct: 422 KQRSQ--------AELEAMAKQLQLDMKRFRKDMADPDTDARIDADIKT-CSGLGVSGTP 472

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            FFI G L  G   E  F+ +ID  + 
Sbjct: 473 TFFINGRLLSGAQPEASFATVIDEELA 499



 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/174 (13%), Positives = 49/174 (28%), Gaps = 9/174 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
             +G     VT+V +    C +C+ +     + L     +   +                
Sbjct: 116 PWLGAALPQVTIVVFTDYQCPYCSRWEQTVRELLTRYPDRLRVVYRQFP--------LAF 167

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
              A  A +     +        + +      +  R  L   A   G     F   L+  
Sbjct: 168 HKQAEPAARAALAAHAQGRFPDMHARLFDNQRQLTRADLERHAADLGLDVQRFQADLDAP 227

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D ++A             TP+ FI G    G        +++   ++ + +
Sbjct: 228 WLADRVQADMAFGQSR-GARGTPMSFINGRPLSGAQPIDAAEELVLEELRRAEQ 280


>gi|189219630|ref|YP_001940271.1| protein-disulfide isomerase [Methylacidiphilum infernorum V4]
 gi|189186488|gb|ACD83673.1| Protein-disulfide isomerase [Methylacidiphilum infernorum V4]
          Length = 381

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 64/201 (31%), Gaps = 4/201 (1%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
             E                    + D   GQ  APV ++EY    C  C  ++    K L
Sbjct: 24  PAENRSARDGSFDGGAQKYLFPLLGDWIKGQVRAPVFLIEYVDFQCPVCKRYNETVNKLL 83

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
           +D       L  I R  P  +     +         ++G +W  V LLF  Q+ W    +
Sbjct: 84  KDYQGN---LSVIYRHKPSQTHPYAFIAALSAEAAGLEGRFWPMVDLLFENQERWAGVAD 140

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
                   A      +  F   L    + D I    + +     +   P F +GG     
Sbjct: 141 PIKLFKEYALALNIPEEKFMQNLRKPELRDKIFKDLQSSF-ILGMTRVPSFILGGERIPN 199

Query: 212 DMSEGVFSKIIDSMIQDSTRR 232
             S   F  ++++ +  S +R
Sbjct: 200 PQSYEDFKILVEAALIKSKKR 220


>gi|78355210|ref|YP_386659.1| DSBA-like thioredoxin domain-containing protein [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78217615|gb|ABB36964.1| DSBA-like thioredoxin domain protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 270

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 57/190 (30%), Gaps = 4/190 (2%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
                             G +DAPVT+V Y+  TC +CA+        +E       K+R
Sbjct: 85  QADMTQPKQVKLDGRPVRGPQDAPVTIVAYSDFTCPYCAQAAGTVAALMEHYKG---KVR 141

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
            + + +PL S               M      +        +     K     +   A  
Sbjct: 142 LVFKHYPLKSHDNAETASRMFVAAAMQDEAKAWALYDAMFVERARVIKEGSAFISAKAAE 201

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G                  ++  ++ A E+  ++ TP F +   +  G +    F+  +
Sbjct: 202 LGLDAARLARDAQSDAATRILREDRQEA-ENLGLEGTPTFLVNDIVVRGSLPLPQFADAV 260

Query: 223 DSMIQDSTRR 232
           D     +  R
Sbjct: 261 DMAWAKAAGR 270


>gi|88608124|ref|YP_506766.1| hypothetical protein NSE_0900 [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600293|gb|ABD45761.1| conserved hypothetical protein [Neorickettsia sennetsu str.
           Miyayama]
          Length = 230

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 60/236 (25%), Positives = 96/236 (40%), Gaps = 12/236 (5%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           M MS      L G+V L   S  F        + L      V     L        D+ I
Sbjct: 1   MCMSYK--LFLCGLVALISFSLAFSAPSSLHSDALKFNPRTVKLSENLLFP----ADLPI 54

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS------VS 114
           G  DAP+T+V+Y+S +C HC     +      +KY++TGK+  I+R+FPLD       V 
Sbjct: 55  GGIDAPITIVDYSSFSCTHCKAAFERLILPTYEKYVRTGKVMLIMRDFPLDKLSFDASVF 114

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                     +          +  + N   +  ++    D +++ +   G +K  F +C+
Sbjct: 115 LGCYRKTIMPDDERVIKLITKLFDIGNGSKNKEDAGKAFDGIVSDSNLQGNTKEKFLSCV 174

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            D  + DD+   K    +   ID TP+ FI G  Y G      F K I+ ++ +S 
Sbjct: 175 EDLGVKDDVLYSKLFGIKKIGIDGTPMIFINGERYTGPFKFSSFEKKIEKILNNSR 230


>gi|229009968|ref|ZP_04167185.1| disulfide bond formation protein D [Bacillus mycoides DSM 2048]
 gi|229056319|ref|ZP_04195737.1| disulfide bond formation protein D [Bacillus cereus AH603]
 gi|229131478|ref|ZP_04260371.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST196]
 gi|228651978|gb|EEL07922.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST196]
 gi|228720987|gb|EEL72529.1| disulfide bond formation protein D [Bacillus cereus AH603]
 gi|228751306|gb|EEM01115.1| disulfide bond formation protein D [Bacillus mycoides DSM 2048]
          Length = 210

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + + D ++
Sbjct: 110 QDQDSFWIFYDEIYQNQKKDTEEWITEELLLNIVKEKLPKINVEQFKKDLHSKEMKDKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 210


>gi|159897139|ref|YP_001543386.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890178|gb|ABX03258.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 246

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 70/221 (31%), Gaps = 7/221 (3%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           ++ G+V +   ++ F     + +        +           ++      G  +AP+ +
Sbjct: 25  LMLGLVGIVGLTFVFIQALQTPVAPPSASIPIRPVINAAIGQ-TSEGYWYKGDPNAPIKV 83

Query: 70  VEYASMTCFHCAEFHNKTFKYLED--KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           +E+A   C  C +          D                       +            
Sbjct: 84  IEFADFECPGCRQLEVDLANANFDAEYIETGKVQWIYREFPLRSIHKSAQYTAEVSRCAG 143

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
             G YW     L++ Q  W N  N    +L+ A  AG + +  + C++ +     I A  
Sbjct: 144 DQGVYWPVHMALYDSQLQWTNLDNPNPLILDAAVKAGANLDKLEDCMDAETHTAAINASY 203

Query: 188 KRASEDFAIDSTPVFFIGGNLY--LGDMSEGVFSKIIDSMI 226
             A +   +D TP  FI  +    +GD         ID+ +
Sbjct: 204 DSA-KSLGLDQTPTVFINDDRINFVGDF-YTDLKLAIDAKL 242


>gi|149918692|ref|ZP_01907180.1| thioredoxin domain protein [Plesiocystis pacifica SIR-1]
 gi|149820533|gb|EDM79947.1| thioredoxin domain protein [Plesiocystis pacifica SIR-1]
          Length = 329

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/215 (16%), Positives = 67/215 (31%), Gaps = 8/215 (3%)

Query: 17  LFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMT 76
           + +A +        A       D  V   AL           + G   APVT+V +A   
Sbjct: 123 MIVAQFIADRLAEGATPSDIKLDIDVVIDALEVRDIPVEGRPTYGNDLAPVTVVVFADFQ 182

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C HC        K ++    +   +          S     V    C    + G +W   
Sbjct: 183 CPHCRMEAPVLRKAVQQYRGRAKLVFKHYPLR---SHGRAEVAAQACEAAHLQGKFWEMH 239

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
            L+F+ Q    ++   R       +  G     +   +  +++   +   +K   +   I
Sbjct: 240 DLVFDHQTQLEDADLER----YAKQIDGLDVAKWKADMATEDVKLAVAKDRKIG-DALGI 294

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
             TP  +I G      +  G     ID  ++  ++
Sbjct: 295 QGTPAVYINGRTVTPLLWGGSLEAWIDDALRRPSK 329


>gi|229028336|ref|ZP_04184466.1| disulfide bond formation protein D [Bacillus cereus AH1271]
 gi|228732980|gb|EEL83832.1| disulfide bond formation protein D [Bacillus cereus AH1271]
          Length = 218

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 85/234 (36%), Gaps = 22/234 (9%)

Query: 1   MVMSTTRI---GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD 57
           M M + ++   G++  I +L +     Y+      ++          ++           
Sbjct: 1   MYMKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS----------- 49

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-V 116
             +G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP     + +
Sbjct: 50  --LGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDL 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCL 174
                    K+    +W F   ++  Q          + LLN+ K      +   F   L
Sbjct: 108 GAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVNVEQFKKDL 167

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + + I + ++    RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 168 HSKEIKEKVRKDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 218


>gi|21224330|ref|NP_630109.1| hypothetical protein SCO5993 [Streptomyces coelicolor A3(2)]
 gi|15020712|emb|CAC44607.1| putative membrane protein [Streptomyces coelicolor A3(2)]
          Length = 270

 Score = 94.3 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/176 (21%), Positives = 63/176 (35%), Gaps = 1/176 (0%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           D   L  A       ++IG+ DAPV ++EY+   C  C  F  +T   L   Y+  G LR
Sbjct: 74  DEGLLALARRDASDPLAIGRADAPVVLIEYSDFQCPFCGRFARETKPELLRSYVDKGTLR 133

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
              R FP+    +    LA  A  R +  +          ++    + +  + +    + 
Sbjct: 134 IEWRNFPIFGEESEQAALAGWAAGRQNKFWEFHDVAYGKPRERNTGAFDAENLVAMAREA 193

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
                  F   +        ++A ++       + STP F + G   LG      F
Sbjct: 194 GIADIERFQADMASDEARGAVRADQEEGY-TLGVTSTPAFLVNGRPILGAQPTDTF 248


>gi|159899804|ref|YP_001546051.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159892843|gb|ABX05923.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 228

 Score = 93.9 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/220 (19%), Positives = 75/220 (34%), Gaps = 19/220 (8%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           ++ +   + +L I +    T+ G+   +            +  +         +G+ DAP
Sbjct: 26  KMLLWLSVPVLLIVAVVMLTKAGAEPAQ-----------TVDVSRLIYPDSPVLGKTDAP 74

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           VT+VE+    C  C  F       L         +            +   + +A     
Sbjct: 75  VTIVEFLDPECESCRAFFPIVKDVLAQNGDNVRLVVRYFPL-----HNNSVLAIAATEAA 129

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQNILDDIKA 185
              G YW    LLFNKQ +W   +  + AL+           + F   L+D  I+  I+ 
Sbjct: 130 GNQGKYWEMQELLFNKQSEWGEKQTPQTALMLQYAQELGLDGDQFAKDLSDPKIMQKIER 189

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
               A +   +  TP FF+ G      +S+      ID  
Sbjct: 190 DNADA-QALNVRGTPSFFVNGKEVS-SLSQAALQSAIDDA 227


>gi|118476232|ref|YP_893383.1| thiol-disulfide oxidoreductase [Bacillus thuringiensis str. Al
           Hakam]
 gi|118415457|gb|ABK83876.1| thiol-disulfide oxidoreductase [Bacillus thuringiensis str. Al
           Hakam]
          Length = 218

 Score = 93.9 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 85/234 (36%), Gaps = 22/234 (9%)

Query: 1   MVMSTTRI---GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD 57
           M M + ++   G++  I +L +     Y+      ++          ++           
Sbjct: 1   MYMKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS----------- 49

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-V 116
             +G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP     + +
Sbjct: 50  --LGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDL 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCL 174
                    K+    +W F   ++  Q          + LLN+ K      +   F   L
Sbjct: 108 GAAAGEAIYKQDQDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVEQFKKDL 167

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + + I + ++    RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 168 HSKEIKEKVRKDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 218


>gi|254455828|ref|ZP_05069257.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082830|gb|EDZ60256.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 192

 Score = 93.9 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 69/181 (38%), Gaps = 2/181 (1%)

Query: 46  ALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYIL 105
            +   S   +K + IG  DA ++++ + S+TC HCA FH      L+  Y+ TG  +   
Sbjct: 14  TISNISAENIKRIVIGNADAKISIIAFESLTCSHCANFHKDVLPDLKKDYLDTGLAKIEF 73

Query: 106 REFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
           R FPLD                              ++    +S    +  L        
Sbjct: 74  RHFPLDIA--AFNASKVAQCNNDGDSKILNSLYANQQKWVKGSSAAEANQNLKKFLENEG 131

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
              +F+ C+ND+ I D I   +    + F +++TP   I    +   ++     K ++ +
Sbjct: 132 FNINFEACINDEKIEDFILNDRIDGVKKFKVNATPTIIINDKKFEKTLNYKNLKKALEKL 191

Query: 226 I 226
           I
Sbjct: 192 I 192


>gi|182435058|ref|YP_001822777.1| hypothetical protein SGR_1265 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178463574|dbj|BAG18094.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 249

 Score = 93.9 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 64/193 (33%), Gaps = 1/193 (0%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
               S      +    VD   L  A   +   +++G+ DAPV M+EY+   C  C  F  
Sbjct: 45  QGGDSPATVQSVAPAPVDESLLALARRDSGDALAVGRADAPVVMIEYSDFQCPFCGRFAR 104

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
           +T   L   Y+  G LR   R FP+    +     A  A  +    +          ++ 
Sbjct: 105 ETEPELIRSYVDKGVLRIEWRNFPVFGEESEQAARAAWAAGQQKKFWDFHEVAFGEPRER 164

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
                +    +    +        F + +      D ++  ++       + STP F I 
Sbjct: 165 NQGDFSTDKLVGMAREAGVGDIGRFRSDMASGAAHDAVRKDREEGY-GLGVTSTPAFLIN 223

Query: 206 GNLYLGDMSEGVF 218
           G   LG      F
Sbjct: 224 GTPVLGAQPTATF 236


>gi|228931971|ref|ZP_04094864.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228827689|gb|EEM73430.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 210

 Score = 93.9 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 110 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVAQFKKDLHSKEIKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSLKKAIDKELKK 210


>gi|42779678|ref|NP_976925.1| hypothetical protein BCE_0598 [Bacillus cereus ATCC 10987]
 gi|42735595|gb|AAS39533.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
          Length = 217

 Score = 93.9 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 10  LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 56

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 57  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K        + F   L+ + I + ++
Sbjct: 117 QDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVDQFKKDLHSKEIKEKVR 176

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 177 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 217


>gi|223936243|ref|ZP_03628156.1| DSBA oxidoreductase [bacterium Ellin514]
 gi|223895105|gb|EEF61553.1| DSBA oxidoreductase [bacterium Ellin514]
          Length = 186

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 59/189 (31%), Gaps = 8/189 (4%)

Query: 40  GVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTG 99
                +A   A P + +D   G   AP+ +VEY    C +C   H    +   +   +  
Sbjct: 5   ATTHAQAPKLAVPISKRDHMQGSIKAPLNLVEYGDYECPYCGLAHPVVKEVQSELGDRLC 64

Query: 100 KLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM 159
            +        +   +  A   A  A  +    +W    +L+  Q          + L++ 
Sbjct: 65  FVFRNFPLVDMHPHAETAAEAAEAAGAQG--QFWEMHDILYENQHALD-----DEDLISH 117

Query: 160 AKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           A             L++      ++   +       +  TP FF+ G L+ G+       
Sbjct: 118 AAKLDLDMERLVDELDEGVYRPRVEEDFQSGV-RSGVSGTPAFFVNGFLHEGEYDFDTLV 176

Query: 220 KIIDSMIQD 228
             +    + 
Sbjct: 177 NALMETREQ 185


>gi|326775696|ref|ZP_08234961.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
 gi|326656029|gb|EGE40875.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
          Length = 249

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 64/193 (33%), Gaps = 1/193 (0%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
               S      +    VD   L  A   +   +++G+ DAPV M+EY+   C  C  F  
Sbjct: 45  QGGDSPATVESVAPAPVDESLLALARRDSGDALAVGRADAPVVMIEYSDFQCPFCGRFAR 104

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
           +T   L   Y+  G LR   R FP+    +     A  A  +    +          ++ 
Sbjct: 105 ETEPELIRSYVDKGVLRIEWRNFPVFGEESEQAARAAWAAGQQKKFWDFHEVAFGEPRER 164

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
                +    +    +        F + +      D ++  ++       + STP F I 
Sbjct: 165 NQGDFSTDKLVGMAREAGVGDIGRFRSDMASGAAHDAVRKDREEGY-GLGVTSTPAFLIN 223

Query: 206 GNLYLGDMSEGVF 218
           G   LG      F
Sbjct: 224 GTPVLGAQPTATF 236


>gi|229095194|ref|ZP_04226186.1| disulfide bond formation protein D [Bacillus cereus Rock3-29]
 gi|229101296|ref|ZP_04232044.1| disulfide bond formation protein D [Bacillus cereus Rock3-28]
 gi|229114142|ref|ZP_04243563.1| disulfide bond formation protein D [Bacillus cereus Rock1-3]
 gi|228669162|gb|EEL24583.1| disulfide bond formation protein D [Bacillus cereus Rock1-3]
 gi|228682120|gb|EEL36249.1| disulfide bond formation protein D [Bacillus cereus Rock3-28]
 gi|228688053|gb|EEL41939.1| disulfide bond formation protein D [Bacillus cereus Rock3-29]
          Length = 218

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 85/234 (36%), Gaps = 22/234 (9%)

Query: 1   MVMSTTRI---GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD 57
           M M + ++   GV+  I +L +     Y+      ++          ++           
Sbjct: 1   MYMKSNKLMALGVVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS----------- 49

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-V 116
             +G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP     + +
Sbjct: 50  --LGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDL 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCL 174
                    K+    +W F   ++  Q          + LL++ K      +   F   L
Sbjct: 108 GAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLSIVKEKLPKVDVEQFKKDL 167

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + + I + ++    RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 168 HSKEIKEKVRKDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 218


>gi|149180935|ref|ZP_01859437.1| BdbD [Bacillus sp. SG-1]
 gi|148851454|gb|EDL65602.1| BdbD [Bacillus sp. SG-1]
          Length = 214

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/221 (19%), Positives = 77/221 (34%), Gaps = 17/221 (7%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           + ++   V++ +A     T K              D    L + P T     IG+KDAP 
Sbjct: 4   LVLITLAVVILLAMIVVLTNKS------------KDTDQTLESHPPTANQPMIGKKDAPA 51

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           ++VE+    C  C  +    +  L+  +I TGK  +           +    LA  +  +
Sbjct: 52  SVVEFGDFKCPACKAWGEMIYPQLKADFIDTGKANFTYINTEFHGKESTLSALAAESILK 111

Query: 128 MDGG-YWGFVSLLFNKQDDWINSKNY---RDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
            D G YW F   LF +Q    +   +      +    K      + F   +  Q  ++++
Sbjct: 112 NDPGSYWEFHKKLFEEQPADNHDALWITVDKLVEVAKKTTDIEADQFRQDIEQQTYMEEV 171

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
                   +DF I  TP   I G +            +I+ 
Sbjct: 172 NVDSSL-VQDFNIQKTPTIIINGTMLEDPYDYEKIKALIEE 211


>gi|148547207|ref|YP_001267309.1| DSBA oxidoreductase [Pseudomonas putida F1]
 gi|148511265|gb|ABQ78125.1| DSBA oxidoreductase [Pseudomonas putida F1]
          Length = 179

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 56/181 (30%), Gaps = 8/181 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P +  D   G   A VT+VE+    C +C E +       +        +          
Sbjct: 7   PVSADDHRQGSAHAKVTLVEFGDYECPYCGEAYWMVKNLQQHFRDDLLFVFRNFPLTTAH 66

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
                             G +W     L+  QD           L       G S+ +FD
Sbjct: 67  PH--ALGAAVTAEYAGSRGFFWEAHDGLYENQDRLGLPLYRAIVLK-----HGLSREEFD 119

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
             + +   +  I+A          ++ TP F+I G  Y G       S++I+ ++     
Sbjct: 120 LAMQEDTYIPKIQADFNGGV-RSGVNGTPAFYIDGLRYDGVPEFIGMSQMIELLLVRGRN 178

Query: 232 R 232
           R
Sbjct: 179 R 179


>gi|229021177|ref|ZP_04177820.1| disulfide bond formation protein D [Bacillus cereus AH1273]
 gi|229022082|ref|ZP_04178636.1| disulfide bond formation protein D [Bacillus cereus AH1272]
 gi|228739234|gb|EEL89676.1| disulfide bond formation protein D [Bacillus cereus AH1272]
 gi|228740137|gb|EEL90491.1| disulfide bond formation protein D [Bacillus cereus AH1273]
          Length = 210

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +GV+  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGVVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + + D ++
Sbjct: 110 QDQDSFWIFYDEIYQNQKKDTEEWITEELLLNIVKEKLPKINVEQFKKDLHSKEMKDKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 210


>gi|295841184|dbj|BAJ06981.1| disulfide isomerase [uncultured bacterium]
          Length = 179

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 4/177 (2%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ++ ++VS+G   APVT++EY S+TC  C  FH   +  L+ +YI TG +R+I R FP   
Sbjct: 6   ASSEEVSLGSIQAPVTIIEYGSLTCGKCLSFHKYVYPELKKQYIDTGTVRFIFRHFPTGE 65

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            +      A C        Y+  +  LF+  D W+ ++N     +  A     +   F T
Sbjct: 66  AAVYGARAANCTG----DKYYEMLDKLFSTTDTWVRAENREAIFVKYATSLELNSETFVT 121

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           C+ ++  LD+I   +K A ++  +  TP FFI G++  G  S      +I   I  +
Sbjct: 122 CIRNKKHLDNILLQQKAARKELDVIGTPTFFINGSMVRGKRSFPEMEALISEAINKA 178


>gi|323488386|ref|ZP_08093633.1| thiol-disulfide oxidoreductase [Planococcus donghaensis MPA1U2]
 gi|323397893|gb|EGA90692.1| thiol-disulfide oxidoreductase [Planococcus donghaensis MPA1U2]
          Length = 227

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/225 (15%), Positives = 75/225 (33%), Gaps = 17/225 (7%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           ++ VL   + + I +          +  +                         G+++AP
Sbjct: 13  KLAVLLTTLAVLIIAAIVILTNQQRIQSVET------------TQVDVSGQPIFGEEEAP 60

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV-AVMLARCAE 125
           VT+VE+    C  C  +    +  L + YI +  +++           +V A + A    
Sbjct: 61  VTVVEFGDFKCPSCKAWGEMIYPQLVEDYIDSEDVKFSYINVLFHGEESVLASIAAESVY 120

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNY---RDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
           ++    YW F   LF++Q    +   +   +  L   + F    +   +  +  Q  +D 
Sbjct: 121 QQSPDAYWDFHKALFDEQPTQNHDALWVTPKKILEVASVFPSIDQGKLEGDIEQQATMDQ 180

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           ++  +    E+  +  TP   + G              +ID  + 
Sbjct: 181 VEIDEAL-VEEAEVAQTPTIVVNGTQLEDPFDYDAIKALIDKELA 224


>gi|196046835|ref|ZP_03114057.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|196022370|gb|EDX61055.1| conserved hypothetical protein [Bacillus cereus 03BB108]
          Length = 216

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 116 QDQDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVEQFKKDLHSKEIKEKVR 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 216


>gi|55377693|ref|YP_135543.1| hypothetical protein rrnAC0856 [Haloarcula marismortui ATCC 43049]
 gi|55230418|gb|AAV45837.1| unknown [Haloarcula marismortui ATCC 43049]
          Length = 222

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/232 (14%), Positives = 69/232 (29%), Gaps = 16/232 (6%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TR G+L   V    A          +        G  +      A    +     G
Sbjct: 1   MTRFTRRGLLAATVGAVGAMAGCAGGSSES-----ESAGETETATPTPAPGQPLSTPVAG 55

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV--- 118
             +A VT+  Y    C HCA +    +  + + Y+  G +RY   +FP+      +    
Sbjct: 56  DPEADVTVAVYEDYACPHCATYSESVYPQVREDYLTDGAIRYEFHDFPIPVDEDASWQAA 115

Query: 119 -MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                  +   DG ++ +   LF  Q+         D   ++ +               +
Sbjct: 116 SAARAVQDNVGDGAFFTYSERLFANQNQLGP-----DTYADLTEGIDIDGETVRAAATGE 170

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD-MSEGVFSKIIDSMIQD 228
                +   ++   +   +  TP  ++         +S       I++   D
Sbjct: 171 LYRPTVSGDREAGIDR-GVQGTPAVYVNNERVEWSEVSYEPVRAAIEAARSD 221


>gi|229165482|ref|ZP_04293264.1| disulfide bond formation protein D [Bacillus cereus AH621]
 gi|228617987|gb|EEK75030.1| disulfide bond formation protein D [Bacillus cereus AH621]
          Length = 210

 Score = 93.9 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + + + ++
Sbjct: 110 QDQDSFWIFYDEIYQNQKKDTEEWITEELLLNIVKEKLPKINVEQFKKDLHSKEMKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 210


>gi|326778314|ref|ZP_08237579.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
 gi|326658647|gb|EGE43493.1| DSBA oxidoreductase [Streptomyces cf. griseus XylebKG-1]
          Length = 264

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 83/230 (36%), Gaps = 17/230 (7%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP----------- 52
            ++R  ++ G V +  A    +    +   +   PD      A ++A P           
Sbjct: 13  KSSRKPLVYGAVTVVAAGLLGFASYRATAPDDTAPDTSSAPAAEVSADPNEGVYPELAKL 72

Query: 53  ---STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
                   +++G+ DAPV ++EYA   C +C +F   T   L ++Y+K G LR   R FP
Sbjct: 73  ARRDADDKLAVGRADAPVVLIEYADFKCGYCGKFARDTEPKLIEQYVKDGTLRIEWRNFP 132

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           +    +        A  + +  +    +       +    K+   AL    +      + 
Sbjct: 133 IFGEESENAARGAWAAGQQNRFWEFHGAAYAEGAKEKGFGKDRVKALA--EEAGVKDLDR 190

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFS 219
           F   L+       +K  +++A       STP F I G    G   +  F 
Sbjct: 191 FMKDLDGDAARAAVKKDQEQAY-GIGATSTPSFLINGRPIAGAQPDETFR 239


>gi|206974164|ref|ZP_03235081.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217958079|ref|YP_002336623.1| hypothetical protein BCAH187_A0618 [Bacillus cereus AH187]
 gi|206747404|gb|EDZ58794.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217064517|gb|ACJ78767.1| conserved hypothetical protein [Bacillus cereus AH187]
          Length = 216

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K        + F   L+ + I + ++
Sbjct: 116 QDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVDQFKKDLHSKEIKEKVR 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 216


>gi|229182875|ref|ZP_04310110.1| disulfide bond formation protein D [Bacillus cereus BGSC 6E1]
 gi|228600611|gb|EEK58196.1| disulfide bond formation protein D [Bacillus cereus BGSC 6E1]
          Length = 210

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 110 QDQDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVEQFKKDLHSKEIKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 210


>gi|75761274|ref|ZP_00741255.1| Thiol:disulfide interchange protein dsbA [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|74491233|gb|EAO54468.1| Thiol:disulfide interchange protein dsbA [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
          Length = 218

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 85/234 (36%), Gaps = 22/234 (9%)

Query: 1   MVMSTTRI---GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD 57
           M M + ++   G++  I +L +     Y+      ++          ++           
Sbjct: 1   MYMKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS----------- 49

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-V 116
             +G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP     + +
Sbjct: 50  --LGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDL 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCL 174
                    K+    +W F   ++  Q          D LL++ K      +   F   L
Sbjct: 108 GAAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQFKKDL 167

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + + I + ++    RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 168 HSKEITEKVRKDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 218


>gi|94969550|ref|YP_591598.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
 gi|94551600|gb|ABF41524.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
          Length = 281

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/178 (23%), Positives = 65/178 (36%), Gaps = 6/178 (3%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
               S G K+APVT+VE+A + C  C        K          ++ +           
Sbjct: 108 ADGPSKGPKNAPVTIVEFADLECPACKAALPSIEK--MQTENANVRVIFQNFPLEKLHPW 165

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                L     K  D   W F+  ++  Q D    +N  D+L   A  AG        C+
Sbjct: 166 AARAALYVDCLKTDDVVAWKFIDGVYEHQQDIN-EQNADDSLKKYAGEAGADAAKTAGCI 224

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG--DMSEGVFSKIIDSMIQDST 230
            D     +++A +K   E  AI STP  FI G        +    F +++D   +++ 
Sbjct: 225 ADPKTRANVQASEKLG-EGLAITSTPTLFINGRKVSSFNSLPAETFKQLVDFAAKNAK 281


>gi|19551268|ref|NP_599270.1| protein-disulfide isomerase [Corynebacterium glutamicum ATCC 13032]
 gi|21322783|dbj|BAB97412.1| Protein-disulfide isomerase [Corynebacterium glutamicum ATCC 13032]
          Length = 254

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 64/236 (27%), Gaps = 20/236 (8%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNEL----------------PIPDGVVDFRALLAASP 52
            V+   VLL       Y    S   E                            L +   
Sbjct: 19  LVVIIAVLLIAVVLLMYRGNASDTAEGVSAAATSDSAAASTAASGSASGAADSDLTSVEA 78

Query: 53  STMKDVS-IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
               D   +G  DAPV +V ++   C  CA++ ++T   +            I       
Sbjct: 79  RDPSDPVAVGDVDAPVGLVVFSDYQCPFCAKWSDETLPQMMKHVEDGNL--RIEWREVNI 136

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
                           +   Y  + + LF   +         + L+ +A   G  ++ F 
Sbjct: 137 FGEPSERGARAAYAAGLQDAYLEYHNALFANGEKPSEDLLSEEGLIKLAGDLGLDESKFT 196

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                      I   ++   +     STP F +GG   +G     VF    +  + 
Sbjct: 197 ADFQSPETAVAIAQHQQLGID-LGAYSTPAFLLGGQPIMGAQPASVFEAAFEQALA 251


>gi|259506161|ref|ZP_05749063.1| thioredoxin domain protein (DSBA) [Corynebacterium efficiens
           YS-314]
 gi|259166238|gb|EEW50792.1| thioredoxin domain protein (DSBA) [Corynebacterium efficiens
           YS-314]
          Length = 253

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 70/226 (30%), Gaps = 9/226 (3%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
              +I V   + ++ I     +    +     P P+ VV     +    S +   +    
Sbjct: 36  RKAQIIVWALLAIVVITGIVAFLIGRADSTSAPAPETVVSDAGQVVRDNSRVLSQA---P 92

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +    +VE+    C  C   +    +  E+       + ++ R FPL             
Sbjct: 93  NEKAVLVEFLDFECEACRAAYPFVEELREEYSDT---VTFVNRYFPLQGHRNSMPAAVAV 149

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G Y      +F  Q +W  S   +       A+  G     +D  + D    + 
Sbjct: 150 EAAAQQGQYEAMYHRMFETQSEWGESAEDKSAVFRGFAEDLGLDMAAYDAAVADPATEER 209

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++      +    +  TP FF+ G L     S   F   +D+   D
Sbjct: 210 VRLDVADGT-ALGVGGTPTFFLDGQLLT-PDSLEQFRAEVDAAAAD 253


>gi|149374352|ref|ZP_01892126.1| DSBA oxidoreductase [Marinobacter algicola DG893]
 gi|149361055|gb|EDM49505.1| DSBA oxidoreductase [Marinobacter algicola DG893]
          Length = 212

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/226 (12%), Positives = 60/226 (26%), Gaps = 15/226 (6%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR  V+  ++   +     +              G  +   +            IG +D
Sbjct: 2   RTRTLVISLVLFCLVIFAAAFIYY-------DRSQGTNEPAVVEKTPLVRDYSPVIGPED 54

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+   +C  C   +    +       +   +        +         +    
Sbjct: 55  APVTIVEFFDPSCEGCRAMYPYVKQIRAAYPDRVRLV-----LRYVLFHKGSEEAVRMVE 109

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
                G Y   +  +   Q       +        A  +     +      +   +D I 
Sbjct: 110 TAGEQGIYEPVLDAVMEAQPQ--WHDDPDVTAAWDAAESAGLDVEAARASMNSPEIDGIV 167

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                  +   I  TP F++ G      +       ++ S ++ S 
Sbjct: 168 QQDAADVKAVGISGTPTFYVNGEKLS-RLGPQELYDLVTSKVESSK 212


>gi|325284363|ref|YP_004256903.1| DSBA oxidoreductase [Deinococcus proteolyticus MRP]
 gi|324316427|gb|ADY27540.1| DSBA oxidoreductase [Deinococcus proteolyticus MRP]
          Length = 216

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 70/196 (35%), Gaps = 6/196 (3%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
            L          A+            +G  DA VT+VE+    C  CA         ++ 
Sbjct: 26  NLAKRPKPQSSAAISTEQLIRPDSPFLGPADAKVTIVEFFDPECESCAAVEPALMDVMQK 85

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN-Y 152
              +   +R + R FPL S ST+A  L   A +      W     LF KQ +W   +   
Sbjct: 86  YNGE---VRLVARYFPLHSNSTLAAGLIEAAAQDSADKRWRMRDYLFQKQREWGEQQTAQ 142

Query: 153 RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
            D  L+ A+  G  ++     +    + D +   +K   E   +  TP FF+ G     +
Sbjct: 143 TDKFLDYAEDMGLDRSKAQATMESAAVRDLLARDRKDG-EAVGVTGTPTFFVNGKPLP-E 200

Query: 213 MSEGVFSKIIDSMIQD 228
           +S       I   + +
Sbjct: 201 LSLEALENAIQEGLNE 216


>gi|229137346|ref|ZP_04265960.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST26]
 gi|228646118|gb|EEL02338.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST26]
          Length = 210

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K        + F   L+ + I + ++
Sbjct: 110 QDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVDQFKKDLHSKEIKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 210


>gi|218895599|ref|YP_002444010.1| hypothetical protein BCG9842_B4758 [Bacillus cereus G9842]
 gi|218543082|gb|ACK95476.1| conserved hypothetical protein [Bacillus cereus G9842]
 gi|326938262|gb|AEA14158.1| Thiol-disulfide oxidoreductase BdbD [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 216

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          D LL++ K      +   F   L+ + I + ++
Sbjct: 116 QDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQFKKDLHSKEITEKVR 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 216


>gi|46446969|ref|YP_008334.1| hypothetical protein pc1335 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46400610|emb|CAF24059.1| hypothetical protein pc1335 [Candidatus Protochlamydia amoebophila
           UWE25]
          Length = 175

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/178 (17%), Positives = 64/178 (35%), Gaps = 8/178 (4%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
           ++P + KD  +G  +APV +VEY    C  CA  H    + L++   +            
Sbjct: 6   STPISEKDHILGNLNAPVVLVEYGDYQCKTCALTHPIVKQLLKEMRGQLCFAFRHFPLK- 64

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
            +S     +         +   +W     L++            +A  + A+    +   
Sbjct: 65  -NSHPLAFIASQAAEAAALQNKFWQMHECLYHHHHALSL-----EAFPSYAEEIQLNIKL 118

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           F+  L + +++  I+       +   ++ TP FFI    Y GD S       + + + 
Sbjct: 119 FNENLQNPSLISCIEENFCSGLDS-GVNGTPCFFINKERYDGDRSYDTLLSALKNAVS 175


>gi|62388911|ref|YP_224313.1| HCCA isomerase, protein [Corynebacterium glutamicum ATCC 13032]
 gi|41324244|emb|CAF18584.1| HCCA ISOMERASE, secreted protein [Corynebacterium glutamicum ATCC
           13032]
          Length = 248

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 64/236 (27%), Gaps = 20/236 (8%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNEL----------------PIPDGVVDFRALLAASP 52
            V+   VLL       Y    S   E                            L +   
Sbjct: 13  LVVIIAVLLIAVVLLMYRGNASDTAEGVSAAATSDSAAASTAASGSASGAADSDLTSVEA 72

Query: 53  STMKDVS-IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
               D   +G  DAPV +V ++   C  CA++ ++T   +            I       
Sbjct: 73  RDPSDPVAVGDVDAPVGLVVFSDYQCPFCAKWSDETLPQMMKHVEDGNL--RIEWREVNI 130

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
                           +   Y  + + LF   +         + L+ +A   G  ++ F 
Sbjct: 131 FGEPSERGARAAYAAGLQDAYLEYHNALFANGEKPSEDLLSEEGLIKLAGDLGLDESKFT 190

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                      I   ++   +     STP F +GG   +G     VF    +  + 
Sbjct: 191 ADFQSPETAVAIAQHQQLGID-LGAYSTPAFLLGGQPIMGAQPASVFEAAFEQALA 245


>gi|228906288|ref|ZP_04070173.1| disulfide bond formation protein D [Bacillus thuringiensis IBL 200]
 gi|228853311|gb|EEM98083.1| disulfide bond formation protein D [Bacillus thuringiensis IBL 200]
          Length = 218

 Score = 93.5 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 85/234 (36%), Gaps = 22/234 (9%)

Query: 1   MVMSTTRI---GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD 57
           M M + ++   GV+  I +L +     Y+      ++          ++           
Sbjct: 1   MYMKSNKLMALGVVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS----------- 49

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-V 116
             +G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP     + +
Sbjct: 50  --LGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDL 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCL 174
                    K+    +W F   ++  Q          D LL++ K      +   F   L
Sbjct: 108 GAAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVAQFKKDL 167

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + + I + ++    RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 168 HSKEIKEKVRKDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 218


>gi|253574373|ref|ZP_04851714.1| disulfide dehydrogenase D [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251846078|gb|EES74085.1| disulfide dehydrogenase D [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 282

 Score = 93.1 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 71/208 (34%), Gaps = 4/208 (1%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +  L  I +L I     + +         +P+         A      K   +G  +A V
Sbjct: 59  VSSLILIGVLVITLAVVFLKDSDTSELKDLPNYTEIKGDYTAEGLKYEKQPHLGDPNAKV 118

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR-YILREFPLDSVSTVAVMLARCAEK 126
            ++E+A   C  C ++       L+  +I TGK+  + +    +D  S +A         
Sbjct: 119 KVIEFADFKCPACKKWEETYMDQLQQDFIDTGKIELFFINYAFIDRDSIMAASAGEAIAA 178

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD--IK 184
           + +  +W F   L+  Q D        D LL+  K      +      + +       +K
Sbjct: 179 QSNEKFWEFKRKLYEHQGDETKIWATPDFLLDFVKKNIEGIDYDRFAKDLKEYTYMLPVK 238

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGD 212
              K     + ++ TP F + G L    
Sbjct: 239 EDFKTGG-YYGVNGTPQFMVNGELLPSA 265


>gi|222094295|ref|YP_002528354.1| thiol-disulfide oxidoreductase (disulfide bond formation protein d)
           (disulfideoxidoreductase d) [Bacillus cereus Q1]
 gi|221238352|gb|ACM11062.1| probable thiol-disulfide oxidoreductase (disulfide bond formation
           protein D) (disulfideoxidoreductase D) [Bacillus cereus
           Q1]
          Length = 216

 Score = 93.1 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K        + F   L+ + I + ++
Sbjct: 116 QDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVDQFKKDLHSKEIKEKVR 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 216


>gi|308176268|ref|YP_003915674.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter
           arilaitensis Re117]
 gi|307743731|emb|CBT74703.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter
           arilaitensis Re117]
          Length = 249

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 64/200 (32%), Gaps = 5/200 (2%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKT 87
                      +   D       SP  +  ++ G  DAPV +V ++   C  CA++ ++T
Sbjct: 50  SQQTETPADATEQAPDLSQFELRSPDDL--LAAGPVDAPVGVVVFSDYQCKFCAKWSSET 107

Query: 88  FKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWI 147
              + D   +      +                         G +W +   LF       
Sbjct: 108 LPLILDYAKEGKV--RVEWRDVNIFGDDSERAALASYAAAKQGKFWEYHDELFADGKSRK 165

Query: 148 NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGN 207
            S     +L  +A   G     F T +  +     I +  +   +   + STP F + G 
Sbjct: 166 GSGLSEKSLAKLAADLGLDTKQFTTDVKSEEAAKMIDSNAQLGLQ-LGVYSTPAFLVDGE 224

Query: 208 LYLGDMSEGVFSKIIDSMIQ 227
             +G   + VF   I++ + 
Sbjct: 225 PVMGAQPKSVFIDKIEAALA 244


>gi|228899228|ref|ZP_04063493.1| disulfide bond formation protein D [Bacillus thuringiensis IBL
           4222]
 gi|228937780|ref|ZP_04100411.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228963629|ref|ZP_04124778.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228970661|ref|ZP_04131305.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228977239|ref|ZP_04137636.1| disulfide bond formation protein D [Bacillus thuringiensis Bt407]
 gi|228782458|gb|EEM30639.1| disulfide bond formation protein D [Bacillus thuringiensis Bt407]
 gi|228789054|gb|EEM36989.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796060|gb|EEM43519.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228821886|gb|EEM67883.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228860407|gb|EEN04802.1| disulfide bond formation protein D [Bacillus thuringiensis IBL
           4222]
          Length = 210

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          D LL++ K      +   F   L+ + I + ++
Sbjct: 110 QDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQFKKDLHSKEITEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 210


>gi|110667760|ref|YP_657571.1| protein-disulfide isomerase [Haloquadratum walsbyi DSM 16790]
 gi|109625507|emb|CAJ51934.1| protein-disulfide isomerase [Haloquadratum walsbyi DSM 16790]
          Length = 227

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 70/226 (30%), Gaps = 2/226 (0%)

Query: 1   MVMSTTRIGVLGGIVLLFIASY-FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS 59
           M M +TR   +  I  +   +         +A        G +D         S++   +
Sbjct: 1   MSMQSTRRKYIAMIGAVGGGAMTGCLGGNTNAGGTGNDVTGPLDCDVGAIDRVSSLPTPT 60

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
            G  DAPVT+  +    C HC  F  +    +   Y++ G ++Y   +FP+         
Sbjct: 61  RGSDDAPVTVAVFEDFACPHCQTFSLEVAPKIVSNYVEQGDVQYQYFDFPIPVSEWSWRA 120

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
            +         G   F   + +  +           +++         + F      Q  
Sbjct: 121 ASASRAVHDKAGDKAFFDFITSVYEQQSELNTNGYQIVHDIASPTEVDDCFVAASAKQEP 180

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
              +    ++   D  +DSTP  F+ G               I++ 
Sbjct: 181 YRPVIEDTRQQGVDRGVDSTPTIFVNGIPVSRP-DWSSVKSAIEAE 225


>gi|242277879|ref|YP_002990008.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
 gi|242120773|gb|ACS78469.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
          Length = 274

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 42/210 (20%), Positives = 79/210 (37%), Gaps = 5/210 (2%)

Query: 22  YFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCA 81
                +  S   +L     +              + + +G  DAPVT+VEY+   C +C+
Sbjct: 51  LVILEQGISEREKLKREARLEAEIKNPLKPQIRAERIMLGNADAPVTIVEYSDFLCPYCS 110

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
           +  +   K       +  K R I +  P+ + S    +             + F +L+F 
Sbjct: 111 KGASVVSKLA---QDQPDKYRVIFKHLPMHAKSRELSLNFEAIALFDKAKAYQFHNLVFE 167

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
           +Q + +   N    L N+    G          N   +   +    K A E F I++TP 
Sbjct: 168 RQKE-LYDDNSGVVLSNILGEVGVDPEQVRKIANSAQVQQYLLDDGKEAGE-FKINATPT 225

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           F I G +  G +   +F   ++ +++ ST+
Sbjct: 226 FLINGVVVRGYLPVDMFENKVNLILEKSTQ 255


>gi|189218656|ref|YP_001939297.1| protein-disulfide isomerase [Methylacidiphilum infernorum V4]
 gi|189185514|gb|ACD82699.1| Protein-disulfide isomerase [Methylacidiphilum infernorum V4]
          Length = 237

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/216 (20%), Positives = 73/216 (33%), Gaps = 7/216 (3%)

Query: 18  FIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTC 77
           F  S F    + +A    P P   +   A          D   G+  APV ++EY  + C
Sbjct: 18  FFFSPFAAKARQNAEPIPPSPLPPLSAEARAKILKPLSIDWIQGEPSAPVIIIEYLDLEC 77

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS 137
             CA ++    +    K     K+ +I+R  P  +                 G +W  V 
Sbjct: 78  PVCAAYYPLLQEL---KKKYGDKIAWIIRHNPSMTHPEAFPASMAAEAAGRQGKFWEMVG 134

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN---ILDDIKAGKKRASEDF 194
           LL   Q +W       +  ++ A+  G ++  F   L       +   I A    A    
Sbjct: 135 LLLTNQKEWSFRPTCSEWFIHYAQKLGLNEEQFKKDLQGVEGIPLRKRILADCLSAI-RV 193

Query: 195 AIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            +D  P FFI G       +   F  +I++ +    
Sbjct: 194 GVDGNPCFFINGEKITNPSNFQEFVTLIEAELIKKK 229


>gi|218233246|ref|YP_002365341.1| hypothetical protein BCB4264_A0580 [Bacillus cereus B4264]
 gi|218161203|gb|ACK61195.1| conserved hypothetical protein [Bacillus cereus B4264]
          Length = 216

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          D LL++ K      +   F   L+ ++I + + 
Sbjct: 116 QDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVNVEQFKKDLHSKDIKEKVS 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 216


>gi|269962760|ref|ZP_06177102.1| hypothetical protein VME_34860 [Vibrio harveyi 1DA3]
 gi|269832515|gb|EEZ86632.1| hypothetical protein VME_34860 [Vibrio harveyi 1DA3]
          Length = 260

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 73/179 (40%), Gaps = 15/179 (8%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
            S+G  +A + ++E++   C +C  F + TF  +++ Y+ +GK++Y+ R+FPL       
Sbjct: 85  PSMGADNATIAIIEFSDYQCPYCKRFTDNTFAKIKENYVDSGKVKYLTRDFPLGFHPQAK 144

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                       G YW     LF+   +   +   +      A       + F  CL D 
Sbjct: 145 GAAIAANCSFKQGEYWPMRHALFSNMRNLNTALYQKT-----ASDLKLDIDKFSACLEDP 199

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFI----GG-----NLYLGDMSEGVFSKIIDSMIQ 227
            +  +++     AS    I  TP F +     G      L +G     VFS + D +++
Sbjct: 200 QMAKNVENDIALAS-TLGIRGTPSFVVGRIEDGQLVGAQLVVGAQDYRVFSALFDDLLK 257


>gi|228983744|ref|ZP_04143941.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229154250|ref|ZP_04282370.1| disulfide bond formation protein D [Bacillus cereus ATCC 4342]
 gi|228629074|gb|EEK85781.1| disulfide bond formation protein D [Bacillus cereus ATCC 4342]
 gi|228775939|gb|EEM24308.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 210

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 110 QDQDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVAQFKKDLHSKEIKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 210


>gi|301052194|ref|YP_003790405.1| putative thiol-disulfide oxidoreductase [Bacillus anthracis CI]
 gi|300374363|gb|ADK03267.1| putative thiol-disulfide oxidoreductase [Bacillus cereus biovar
           anthracis str. CI]
          Length = 216

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 116 QDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVAQFKKDLHSKEIKEKVR 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 216


>gi|206968625|ref|ZP_03229581.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|206737545|gb|EDZ54692.1| conserved hypothetical protein [Bacillus cereus AH1134]
          Length = 216

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 82/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          D LL++ K      +   F   L+ ++I + ++
Sbjct: 116 QDKDSFWIFYDEIYQNQRKDTEEWITEDLLLSIVKEKLPKVDVEQFKKDLHSKDIKEKVR 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 216


>gi|228956961|ref|ZP_04118740.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228802716|gb|EEM49554.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 218

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 85/234 (36%), Gaps = 22/234 (9%)

Query: 1   MVMSTTRI---GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD 57
           M M + ++   G++  I +L +     Y+      ++          ++           
Sbjct: 1   MYMKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS----------- 49

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-V 116
             +G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP     + +
Sbjct: 50  --LGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDL 107

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCL 174
                    K+    +W F   ++  Q          D LL++ K      +   F   L
Sbjct: 108 GAAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQFKKDL 167

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + ++I + +     RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 168 HSKDIKEKVSKDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 218


>gi|47567104|ref|ZP_00237820.1| thiol-disulfide oxidoreductase BdbD [Bacillus cereus G9241]
 gi|47556160|gb|EAL14495.1| thiol-disulfide oxidoreductase BdbD [Bacillus cereus G9241]
          Length = 217

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 10  LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 56

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 57  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 116

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 117 QDKDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDIAQFKKDLHSKEIKEKVR 176

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 177 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 217


>gi|84515029|ref|ZP_01002392.1| thiol:disulfide interchange protein, DsbA family [Loktanella
           vestfoldensis SKA53]
 gi|84511188|gb|EAQ07642.1| thiol:disulfide interchange protein, DsbA family [Loktanella
           vestfoldensis SKA53]
          Length = 221

 Score = 93.1 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 80/171 (46%), Gaps = 2/171 (1%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           ++ +G  DA V ++EYAS TC HCA FH   FK +++ YI T K+R++ RE   D     
Sbjct: 51  EMVLGNPDAAVEVIEYASFTCPHCASFHADQFKQIKENYIDTDKIRFVYREVYFDRPGLW 110

Query: 117 AVMLARCAEKRMDGGYWG-FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN 175
           A M+AR          +   +           +     + L  +AK AG      D  L+
Sbjct: 111 ASMIARSTNNPDFFFSFAGMLYEQQRSWLAGGDPVVIVEELRRLAKVAGLDDAALDAALS 170

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +    + +    +  +E   I STP F I G LY  +M+   F++I+D+ I
Sbjct: 171 NGPKAEALFTWYQANAERDGISSTPSFLIDGRLYS-NMAYPEFAEILDARI 220


>gi|228913229|ref|ZP_04076867.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228846412|gb|EEM91426.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 210

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 110 QDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVAQFKKDLHSKEIKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 210


>gi|30018731|ref|NP_830362.1| Thiol-disulfide oxidoreductase BdbD [Bacillus cereus ATCC 14579]
 gi|296501303|ref|YP_003663003.1| Thiol-disulfide oxidoreductase BdbD [Bacillus thuringiensis BMB171]
 gi|34921563|sp|Q81I73|BDBD_BACCR RecName: Full=Probable disulfide bond formation protein D; AltName:
           Full=Disulfide oxidoreductase D; AltName:
           Full=Thiol-disulfide oxidoreductase D; Flags: Precursor
 gi|29894272|gb|AAP07563.1| Thiol-disulfide oxidoreductase BdbD [Bacillus cereus ATCC 14579]
 gi|296322355|gb|ADH05283.1| Thiol-disulfide oxidoreductase BdbD [Bacillus thuringiensis BMB171]
          Length = 216

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          D LL++ K      +   F   L+ ++I + + 
Sbjct: 116 QDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQFKKDLHSKDIKEKVS 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 216


>gi|225020231|ref|ZP_03709423.1| hypothetical protein CORMATOL_00234 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946975|gb|EEG28184.1| hypothetical protein CORMATOL_00234 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 287

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 71/198 (35%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
            P  D   +   L     +     ++G  DAPV + E++   C  CA + N   K +  +
Sbjct: 86  GPGGDIKSEADVLNVHRRNAKDPFAVGAVDAPVVISEFSDFECPFCALYVNGARKQILSE 145

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           Y+  G +R    +FP++  + VA   A  A       +    +L         + +N   
Sbjct: 146 YVDQGLVRLEWNDFPINGPNAVAAAKAGRAAAAQGKFHEFHDALYQASAGVKGHPENKTA 205

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
             +  AK AG             +  D++    +       ID  P   +G     G   
Sbjct: 206 DFVRFAKEAGVPDLAKFEEQATDSTYDEVIKKAQGYGSSLGIDGVPAALVGTQFVSGAQP 265

Query: 215 EGVFSKIIDSMIQDSTRR 232
             VF ++I++ +  +  +
Sbjct: 266 IEVFRQVIETELVKAKAK 283


>gi|311695791|gb|ADP98664.1| DSBA oxidoreductase [marine bacterium HP15]
          Length = 243

 Score = 92.8 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/204 (17%), Positives = 71/204 (34%), Gaps = 5/204 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
           F+           +P    +     A        VS+G  DAPV + E+A   C  C  F
Sbjct: 41  FFLTAPPKPTSDGLPVAAPNAEDFPAQ--LDQFGVSVGPDDAPVVVREFADYQCPACGNF 98

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
            + + +  E+   +  K+R++  + PL       +             YW     L++ Q
Sbjct: 99  ASASKQLKEEYVAEG-KVRFVYFDLPLQQHQNAMLAAQAARCAGDQDAYWAMHERLYDSQ 157

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
            +W  S +        A   G  +  F  C+  +   + ++  ++ A +   + STP   
Sbjct: 158 TEWSGSNDPVATFTRYAGDLGLEERRFRRCMTTELHREAVEQSRQVAMQ-LRVTSTPTVL 216

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQ 227
           +           G  S +++  + 
Sbjct: 217 VDNIRLT-RPGWGQLSAVVERELA 239


>gi|229108150|ref|ZP_04237773.1| disulfide bond formation protein D [Bacillus cereus Rock1-15]
 gi|228675280|gb|EEL30501.1| disulfide bond formation protein D [Bacillus cereus Rock1-15]
          Length = 210

 Score = 92.8 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          D LL++ K      +   F   L+ ++I + + 
Sbjct: 110 QDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKIDVEQFKKDLHSKDIKEKVS 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 210


>gi|228919406|ref|ZP_04082773.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228951034|ref|ZP_04113154.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229042398|ref|ZP_04190146.1| disulfide bond formation protein D [Bacillus cereus AH676]
 gi|229068229|ref|ZP_04201534.1| disulfide bond formation protein D [Bacillus cereus F65185]
 gi|229077841|ref|ZP_04210463.1| disulfide bond formation protein D [Bacillus cereus Rock4-2]
 gi|229148882|ref|ZP_04277128.1| disulfide bond formation protein D [Bacillus cereus m1550]
 gi|229177071|ref|ZP_04304463.1| disulfide bond formation protein D [Bacillus cereus 172560W]
 gi|229188748|ref|ZP_04315785.1| disulfide bond formation protein D [Bacillus cereus ATCC 10876]
 gi|228594725|gb|EEK52507.1| disulfide bond formation protein D [Bacillus cereus ATCC 10876]
 gi|228606406|gb|EEK63835.1| disulfide bond formation protein D [Bacillus cereus 172560W]
 gi|228634581|gb|EEK91164.1| disulfide bond formation protein D [Bacillus cereus m1550]
 gi|228705471|gb|EEL57835.1| disulfide bond formation protein D [Bacillus cereus Rock4-2]
 gi|228714888|gb|EEL66758.1| disulfide bond formation protein D [Bacillus cereus F65185]
 gi|228726945|gb|EEL78154.1| disulfide bond formation protein D [Bacillus cereus AH676]
 gi|228808641|gb|EEM55140.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228840237|gb|EEM85511.1| disulfide bond formation protein D [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 210

 Score = 92.8 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 82/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          D LL++ K      +   F   L+ ++I + ++
Sbjct: 110 QDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQFKKDLHSKDIKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 210


>gi|229125977|ref|ZP_04255001.1| disulfide bond formation protein D [Bacillus cereus BDRD-Cer4]
 gi|229143268|ref|ZP_04271699.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST24]
 gi|228640075|gb|EEK96474.1| disulfide bond formation protein D [Bacillus cereus BDRD-ST24]
 gi|228657460|gb|EEL13274.1| disulfide bond formation protein D [Bacillus cereus BDRD-Cer4]
          Length = 210

 Score = 92.8 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          D LL++ K      +   F   L+ ++I + + 
Sbjct: 110 QDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQFKKDLHSKDIKEKVS 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 210


>gi|157961599|ref|YP_001501633.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
 gi|157846599|gb|ABV87098.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
          Length = 263

 Score = 92.8 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 67/188 (35%), Gaps = 15/188 (7%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
              +   +G   A + ++E++   C +C  F ++TF  L+  YI TGK++Y+ R+FPL  
Sbjct: 80  DDGRLPLLGDTAAQLAIIEFSDYQCPYCKRFIDQTFTKLKSNYIDTGKIQYLTRDFPLGF 139

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
                              YW     LF         +         A         F  
Sbjct: 140 HPKAKGAAIAANCSLQQNAYWPMRDSLFKN-----MQQLDDALYQQTASNLSLDMTMFAD 194

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFI----GG-----NLYLGDMSEGVFSKIID 223
           CL D+ +   +       S    I  TP F I     G      L +G  S   F+ +ID
Sbjct: 195 CLIDETVSSKVDQDVAYGSS-LGIRGTPSFVIGRVENGQLISPKLVVGAQSYQTFALLID 253

Query: 224 SMIQDSTR 231
            ++ +  +
Sbjct: 254 ELLANPQK 261


>gi|229159630|ref|ZP_04287642.1| disulfide bond formation protein D [Bacillus cereus R309803]
 gi|228623834|gb|EEK80648.1| disulfide bond formation protein D [Bacillus cereus R309803]
          Length = 210

 Score = 92.8 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 110 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVEKFKKDLHSKEITEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKKAIDKELKK 210


>gi|262197888|ref|YP_003269097.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
 gi|262081235|gb|ACY17204.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
          Length = 273

 Score = 92.4 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 61/196 (31%), Gaps = 7/196 (3%)

Query: 37  IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
            P            S +     ++G  DA VT+V+     C  C        +  E+   
Sbjct: 62  QPQRRPGPDPEKTYSVAVEGAPAVGPADAKVTVVKAFEFACPFCERARGTMDQIREEYGD 121

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
               +               A + A+ +      G W  +  L   +            +
Sbjct: 122 DVRIVY-----KHYIVHPGSATVPAQASCAAGMQGKWKAMEDLIWDKAFKAGRDLSEGKM 176

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
             +AK AG     +   + +    + ++   ++ ++   +  TP FFI G    G     
Sbjct: 177 EELAKEAGLDMAKYKADM-EGACKELVQKDHQQMAK-VGVTGTPGFFINGRFLRGAQPFP 234

Query: 217 VFSKIIDSMIQDSTRR 232
            F  +ID  ++ +  R
Sbjct: 235 AFKAVIDEEMKKADER 250


>gi|94967830|ref|YP_589878.1| vitamin K epoxide reductase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549880|gb|ABF39804.1| Vitamin K epoxide reductase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 553

 Score = 92.4 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 72/211 (34%), Gaps = 9/211 (4%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           + VL   V+L I ++ + +   +A  +  +     +  A L          + G  DAP+
Sbjct: 149 VAVLIICVVLAIPAFAWLSNHSAAEVKKQLDANSTEGPADLTRL-IRPDSHTAGPADAPI 207

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T+VE+    C  C        +   +   +   +            +  A   A CA+ +
Sbjct: 208 TIVEFGDFQCPSCIIAEATNRQIRRNYPKQVRFVFRQFPLAKFHVFAERAAEAAECADDQ 267

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
               +W     ++    +    +     L   A+  G     F+ CL        +KA  
Sbjct: 268 G--KFWQMHDRMYEADGELAPVQ-----LKYYAQDIGLDSAKFNACLESGEKEARVKADM 320

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
           +   +   + +TP F++    ++G +     
Sbjct: 321 EDG-KAVGVGATPTFWVNQVKHVGGLKLQDI 350


>gi|324324580|gb|ADY19840.1| putative thiol-disulfide oxidoreductase [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 216

 Score = 92.4 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 80/224 (35%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 9   LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 55

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 56  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 115

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 116 QDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVAQFKKDLHSKEIKEKVR 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +         ID  ++ 
Sbjct: 176 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKAAIDKELKK 216


>gi|227548589|ref|ZP_03978638.1| DSBA oxidoreductase [Corynebacterium lipophiloflavum DSM 44291]
 gi|227079312|gb|EEI17275.1| DSBA oxidoreductase [Corynebacterium lipophiloflavum DSM 44291]
          Length = 235

 Score = 92.4 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 67/226 (29%), Gaps = 9/226 (3%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
              +I V   + ++ IA    +    S     P P+ V      +    S +   +    
Sbjct: 18  RKAQIIVWALLAIVVIAGIVAFFLGRSDSASAPAPETVASDAGQVVRDNSRVLSQA---P 74

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +    +VE+    C  C   +    +   +       + ++ R FPL             
Sbjct: 75  NEKAVLVEFLDFECEACRAAYPFVEELRAEYSDT---VTFVNRYFPLPGHRNSMPAAVAV 131

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G Y      +F  Q +W  S           A+  G     FD  + D    + 
Sbjct: 132 EAAAQQGQYEAMYQRMFETQSEWGESAEDNSAVFRGFAEDLGLDMAAFDAAVADPATEER 191

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++      +    +  TP FF+ G L     S       +D+   D
Sbjct: 192 VRLDVADGT-ALGVRGTPTFFLDGQLLT-PDSLEQLRAEVDAAAAD 235


>gi|315498143|ref|YP_004086947.1| dsba oxidoreductase [Asticcacaulis excentricus CB 48]
 gi|315416155|gb|ADU12796.1| DSBA oxidoreductase [Asticcacaulis excentricus CB 48]
          Length = 231

 Score = 92.4 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 89/228 (39%), Gaps = 27/228 (11%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEY 72
            + +  +A         +A           D ++   A  + +K+++ G  +A VT+VEY
Sbjct: 21  AVAVFLLAVLATALFSVAA-----------DAQSAGKAKVAPLKEMTKGATNARVTVVEY 69

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGY 132
            S+TC HCA ++   +   E  YIKTGK++Y+ RE   +       +            +
Sbjct: 70  GSVTCTHCAHWYTTNWPKFERDYIKTGKVKYVYREVATNPAQMAFGVYMLGHCAAGKSNW 129

Query: 133 ----------WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                     +  +   F  Q     +        ++A  AG ++++ D CL ++++   
Sbjct: 130 LGQKGGTKAYFTVIDGFFAAQSKIYETGEAEPVFRSLAAKAGLNQSEADNCLKNEDLFKA 189

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           I A  +       ++ TP FF+ G     D         I++ I+   
Sbjct: 190 ISARMEANMNRDGVEGTPTFFVNGKRVESDYG------AIEAAIKAVK 231


>gi|309791025|ref|ZP_07685562.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
 gi|308226940|gb|EFO80631.1| DSBA oxidoreductase [Oscillochloris trichoides DG6]
          Length = 235

 Score = 92.4 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 79/203 (38%), Gaps = 12/203 (5%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  +++  I     ++  G    E+                 +       G  DA V ++
Sbjct: 25  IAAVLVFAIGFVGIFSSMGGFSREV--------TPVTAPMGRTADGYYYKGNPDAVVKVI 76

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE---FPLDSVSTVAVMLARCAEKR 127
           EYA   C  CAE+       ++  Y+ TGK+++I  E     +   + ++   ARCA  +
Sbjct: 77  EYADYQCPSCAEYDRNLAPLIDRDYVNTGKIQFIYHELPLTNIHRNAQISAEAARCAGDQ 136

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
               +W    +++  QD W +  + ++   + A   G  +N   +CL +      I+A  
Sbjct: 137 GVENFWKMHDMIYINQDQWASINSAQNVFASYASQLGMDRNALTSCLTNGTHKAPIEAAM 196

Query: 188 KRASEDFAIDSTPVFFIGGNLYL 210
           + A     + +TP F + G    
Sbjct: 197 QVAM-ATGVQATPTFEVNGQRVT 218


>gi|94496265|ref|ZP_01302843.1| dsbA-like thioredoxin domain protein [Sphingomonas sp. SKA58]
 gi|94424444|gb|EAT09467.1| dsbA-like thioredoxin domain protein [Sphingomonas sp. SKA58]
          Length = 234

 Score = 92.4 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/239 (12%), Positives = 78/239 (32%), Gaps = 20/239 (8%)

Query: 1   MVMSTTRIGVLGGIVLLFI-------ASYFFYTRKGSALNELPIPDGVVDFRALLAASPS 53
           MV++   +G+   +  +F+                 +      +    +  + L + +  
Sbjct: 9   MVLT---LGIAAFVAGIFLFNGSVGNVGASNVVAGNATAPGASVATSGLKAQGLPSETLV 65

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
                 IG ++APVT+VE+   +C  C  F+ +  + +     +   +          + 
Sbjct: 66  RAHSPVIGPRNAPVTIVEFFDPSCEACRAFYPEVKQIMARYPREVRLVVRYA-----PNH 120

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                 +      R    Y   +  +  +Q          ++  + A  AG +       
Sbjct: 121 PGSEEAVRILEAARAQNVYVPVLEAVLAQQPQ--WHDGNMESAWSAAAAAGLNVERARAA 178

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           LN   +  +++       +   +  TP +F+ G     +        +I + + ++ RR
Sbjct: 179 LNAPAVTANMQQDIADG-QALGVKGTPTYFVNGTPLT-EFGLPQLEALIRAEV-EARRR 234


>gi|229171326|ref|ZP_04298913.1| disulfide bond formation protein D [Bacillus cereus MM3]
 gi|228612145|gb|EEK69380.1| disulfide bond formation protein D [Bacillus cereus MM3]
          Length = 210

 Score = 92.4 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +GV+  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 3   LGVVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 49

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 50  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 109

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + + + ++
Sbjct: 110 QDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVEQFKKDLHSKEMKEKVR 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 170 KDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 210


>gi|196018402|ref|XP_002118796.1| hypothetical protein TRIADDRAFT_62803 [Trichoplax adhaerens]
 gi|190578190|gb|EDV18719.1| hypothetical protein TRIADDRAFT_62803 [Trichoplax adhaerens]
          Length = 247

 Score = 92.4 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 87/200 (43%), Gaps = 5/200 (2%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            +   + PI          L        D  IG   A VT++ Y+S++C  CA FH    
Sbjct: 53  SNVDADEPISYADNVESDKLEVLKLKDDDHYIGNTKAKVTIITYSSLSCPGCAYFHENLL 112

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN 148
             ++ +YI +GKL +I R++P +  +     LA C     +  Y+  + +LF  Q  W  
Sbjct: 113 PKIKKEYIDSGKLLFIFRDYPNNEPALYGATLANCF----ENSYFELIDILFKSQIKWAF 168

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
            K+++  L N+ + +GFS      C  D++  D ++    +  +   ++ TP  +I    
Sbjct: 169 RKDFKKMLKNIGRLSGFSAEKISKCFEDKSFSDQLQMKAFKDMKTLNLNQTPTIYINQEF 228

Query: 209 YLGDMSEGVFSKIIDSMIQD 228
            +   +   + KIID  +  
Sbjct: 229 II-ANNYDDYVKIIDKYLNK 247


>gi|89899228|ref|YP_521699.1| DSBA oxidoreductase [Rhodoferax ferrireducens T118]
 gi|89343965|gb|ABD68168.1| DSBA oxidoreductase [Rhodoferax ferrireducens T118]
          Length = 218

 Score = 92.4 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 61/224 (27%), Gaps = 12/224 (5%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M    I  L  ++L+       +  K     +            + A +PS       G 
Sbjct: 1   MKQKSIFTLAAVLLIAAFIVGAFFYKNQKTEQAAQLAAKNQTALVRADAPS------FGN 54

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPV +VE+    C  C EF+      +     K           P        +  AR
Sbjct: 55  ADAPVHIVEFFDPACGTCREFYPLVKNLMAAHPGKIRLTMRYAPFHPGSDQVVKVMEAAR 114

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
              +        F S     Q+   +       L       G       + +N   I   
Sbjct: 115 KQGQFQQTLEALFASQTVWVQNHTAHVDLIWSPL----GTLGLDMERVKSDMNSPEIART 170

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           I      A +   +  TP +F+ G              ++D  +
Sbjct: 171 IAQDLADA-KTMNVTMTPEYFVNGKPLP-SFGFEQLQTLVDEAL 212


>gi|91762756|ref|ZP_01264721.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718558|gb|EAS85208.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 196

 Score = 92.0 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/183 (21%), Positives = 72/183 (39%), Gaps = 2/183 (1%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
               LAA    +K +S G++ A +T++ Y S+TC HCA FH   +  L+  +I  G ++ 
Sbjct: 16  SAKALAADNEMVKRISEGEESAKITIIAYESLTCGHCANFHKDVYPELKKDFIDKGLVKI 75

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
             R FPLD                        +     K+     +       L     +
Sbjct: 76  EFRHFPLDLA--AFNASKIAQCNNDGNSNILNILYSGQKKWARGKTPEEATGYLKKFLES 133

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
                DF+ CL+D+ I D +   +    + F +++TP   I    +   ++     K ++
Sbjct: 134 ESVNLDFEKCLSDKAIEDYVLNDRIDGVKKFEVNATPTIIINDKKFDKALNYKNLKKYLE 193

Query: 224 SMI 226
            +I
Sbjct: 194 KLI 196


>gi|89071341|ref|ZP_01158486.1| 27 kDa outer membrane protein, putative [Oceanicola granulosus
           HTCC2516]
 gi|89043154|gb|EAR49395.1| 27 kDa outer membrane protein, putative [Oceanicola granulosus
           HTCC2516]
          Length = 249

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/213 (13%), Positives = 64/213 (30%), Gaps = 12/213 (5%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           +L  A      R  +A     +     +   L             G  D  VT+VE+   
Sbjct: 48  VLMEAIGVLEQRDQAAQAASDVDLARANLEELQN----DGYSFVGGNPDGDVTLVEFVDY 103

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C   H +  + L         ++         ++S+            +   +   
Sbjct: 104 RCGYCRRAHAEVEELLASDGNIRFVVKEFPILGEGSTLSS-------QFAIAVKQLHGDA 156

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
                +     + S     +L  +A+  G   ++    +    + D+I   +  A +   
Sbjct: 157 AYKNVHDALITLRSDADEPSLRRLAEGFGLEADEIFARMGSDEVADEINETRALA-QRLQ 215

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           I  TP F +   +  G +        +D++  +
Sbjct: 216 ITGTPTFVLEDQMLRGYLPLEQMQAFVDAVRAE 248


>gi|300779964|ref|ZP_07089820.1| DSBA oxidoreductase [Corynebacterium genitalium ATCC 33030]
 gi|300534074|gb|EFK55133.1| DSBA oxidoreductase [Corynebacterium genitalium ATCC 33030]
          Length = 308

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 63/194 (32%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
            P             A       +S G  DAPV + E+    C +C     +T + L D+
Sbjct: 110 GPGSPVTSPEEIANTARRDPADPMSQGALDAPVVIAEFTDWECPYCIRHAAETEQELIDE 169

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           Y+  G +R    + P    ++VA   A  A            + +    +   +     D
Sbjct: 170 YVDAGLVRIEWNDMPTQGPNSVAAAKAGRAAAEQGMFTEYKKAYMAEAAERGGHPGFSID 229

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
             +  A  AG           + +  D+        +++  I  TP F +      G + 
Sbjct: 230 DYVRFAGTAGVPDLAKFREDAESDKYDEALEKSLEYAQELGITGTPGFVVNTEFIGGALP 289

Query: 215 EGVFSKIIDSMIQD 228
              F  +I+  ++ 
Sbjct: 290 VQEFRYVINGELKK 303


>gi|71082821|ref|YP_265540.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|71061934|gb|AAZ20937.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 171

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 35/166 (21%), Positives = 64/166 (38%), Gaps = 2/166 (1%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G++ A +T++ Y S+TC HCA FH      L+  +I  G ++   R FPLD         
Sbjct: 8   GKESAKITIIAYESLTCGHCANFHKDVLPELKKDFIDKGLVKIEFRHFPLDLA--AFNAS 65

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                          +     K+     +       L     +     DF+ CL+D+ I 
Sbjct: 66  KIAQCNNDGNSNILHILYSGQKKWARGKTPEEATGYLKKFLESESVNLDFEKCLSDKAIE 125

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D +   +    + F +++TP   I    +   ++     K ++ +I
Sbjct: 126 DFVLNDRIDGVKKFEVNATPTIIINDKKFDKALNYKNLKKYLEKLI 171


>gi|23578007|ref|NP_702954.1| hypothetical protein CE3P021 [Corynebacterium efficiens YS-314]
 gi|23494833|dbj|BAC19796.1| putative membrane protein [Corynebacterium efficiens YS-314]
          Length = 235

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 70/226 (30%), Gaps = 9/226 (3%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
              +I V   + ++ I     +    +     P P+ VV     +    S +   +    
Sbjct: 18  RKAQIIVWALLAIVVITGIVAFLIGRADSTSAPAPETVVSDAGQVVRDNSRVLSQA---P 74

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +    +VE+    C  C   +    +  E+       + ++ R FPL             
Sbjct: 75  NEKAVLVEFLDFECEACRAAYPFVEELREEYSDT---VTFVNRYFPLQGHRNSMPAAVAV 131

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G Y      +F  Q +W  S   +       A+  G     +D  + D    + 
Sbjct: 132 EAAAQQGQYEAMYHRMFETQSEWGESAEDKSAVFRGFAEDLGLDMAAYDAAVADPATEER 191

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++      +    +  TP FF+ G L     S   F   +D+   D
Sbjct: 192 VRLDVADGT-ALGVGGTPTFFLDGQLLT-PDSLEQFRAEVDAAAAD 235


>gi|295841092|dbj|BAJ06931.1| disulfide isomerase [uncultured bacterium]
          Length = 179

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 79/175 (45%), Gaps = 4/175 (2%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
            ++VS+G   APVT++EY S+TC  C  FH   +  L+ +YI TG +R+I R FP    +
Sbjct: 8   SEEVSLGSNQAPVTIIEYGSLTCGKCLSFHRHVYPKLKKQYIDTGTVRFIFRHFPTGEAA 67

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                   C        Y+  +  LF+  D WI ++N     +  A     +   F TC+
Sbjct: 68  VYGARAVNCTG----DKYYEMLDKLFSTTDKWIRAENREAIFVKYATSLELNSEAFVTCI 123

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            ++  LD+I   +  A +   +  TP FFI   +  G  S      +I   I  S
Sbjct: 124 RNKKHLDNILLQQNAARKHLDVIGTPTFFINEKIVRGKRSFLEMEALISEAINKS 178


>gi|242279505|ref|YP_002991634.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
 gi|242122399|gb|ACS80095.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
          Length = 274

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 68/174 (39%), Gaps = 5/174 (2%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
             +G  +APVT+VEY    C +C++      K +     +  K R I +  P+   S   
Sbjct: 87  PMLGSPEAPVTIVEYTDFLCPYCSKGAKVVSKLV---AEQPEKYRLIFKHLPMHKNSREL 143

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
            ++     +      + F  L F +Q D          L  + +      +     L   
Sbjct: 144 ALVFEAIAQFDKERAYKFHDLAFERQKDL-YEDKEGIVLSKILEEVAVDPDLLQKHLRSP 202

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            +   + A +K A   F ID+TP F + G    G +    F +++D +++ S +
Sbjct: 203 KLQAFLLADEKEAG-AFGIDATPTFLVNGVSVRGYLPADRFEQMVDMIMEKSGK 255


>gi|84496045|ref|ZP_00994899.1| hypothetical protein JNB_00960 [Janibacter sp. HTCC2649]
 gi|84382813|gb|EAP98694.1| hypothetical protein JNB_00960 [Janibacter sp. HTCC2649]
          Length = 222

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 32/226 (14%), Positives = 73/226 (32%), Gaps = 8/226 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M   +   +   V++ + +            +   P      +              +G 
Sbjct: 1   MKPVKRNAIVSAVVVALFAAIVALAVAITPKDAD-PADAATTKEAGTGKLVRDDSHRLGA 59

Query: 63  K-DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
                V +VE+    C  C   +    +          K+ +++R FP+ S +       
Sbjct: 60  AGTGKVVLVEFLDFECESCLAAYPVVEELRTTYAG---KVDFVVRYFPIPSHANAMNAAV 116

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQNIL 180
                   G +      +++ Q+ W   ++ + +L    A+  G     +D  +  +   
Sbjct: 117 AVEAAAQQGKFEDMYKRMYDTQETWGEQQDSKASLFRGFAQELGLDMAAYDKAVAAKATT 176

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           D ++  +K   +   ++ TP FF+ G       S   F   ID+ +
Sbjct: 177 DRVERDRKDGID-LGVEGTPTFFLNGKKLQ-PSSVQDFRDQIDAAL 220


>gi|326332474|ref|ZP_08198748.1| Na+/H+ antiporter, NhaA family [Nocardioidaceae bacterium Broad-1]
 gi|325949728|gb|EGD41794.1| Na+/H+ antiporter, NhaA family [Nocardioidaceae bacterium Broad-1]
          Length = 204

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/192 (21%), Positives = 65/192 (33%), Gaps = 9/192 (4%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                 +LA      +D   G  DA VT++EY    C  CA     T    E +     +
Sbjct: 15  DAALPKVLATPVDPARDHIYGDVDAEVTLLEYLDYECPFCARA---TGTANEVRNYFGSR 71

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
           +RY++R  PL       +           G +W     LF+ Q++  +       L   A
Sbjct: 72  IRYVVRHLPLPQHPHAELAAVAAEAAARQGRFWEMHKHLFDHQNELEHKD-----LAGYA 126

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
              G     F   L D  + + ++     A  D     TP FF+G + + G         
Sbjct: 127 GVLGLDVEQFLRDLEDPALAEHVREDMASA-NDSGARGTPTFFVGSHRHEGRYDARTLIA 185

Query: 221 IIDSMIQDSTRR 232
            ++      T R
Sbjct: 186 ELERAATGETAR 197


>gi|262195056|ref|YP_003266265.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
 gi|262078403|gb|ACY14372.1| DSBA oxidoreductase [Haliangium ochraceum DSM 14365]
          Length = 306

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 55/188 (29%), Gaps = 7/188 (3%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
              L  + +     + G  +A VT+V+     C  C        +  E+       +   
Sbjct: 103 DPQLTYAVAVGDAPTWGPDNAKVTVVKAFEFACPFCERSRATMDQIREEYGKDVRIVYKH 162

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
                  +                  G W  +  L  ++         +D +L  AK AG
Sbjct: 163 YIVHHGQATIPAQAA-----CAAGLQGKWRTMEQLIWEKGFKAGRNLSQDNMLKQAKRAG 217

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
                F   +N      +I    ++      +  TP FFI G    G      F  +ID 
Sbjct: 218 LRMKKFRADMN--GACKEIVQNDQQQMAKVGVVGTPGFFINGRFLAGAQPFPAFKALIDE 275

Query: 225 MIQDSTRR 232
            +  +  R
Sbjct: 276 ELAKANER 283


>gi|328883897|emb|CCA57136.1| Protein-disulfide isomerase [Streptomyces venezuelae ATCC 10712]
          Length = 283

 Score = 92.0 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 70/199 (35%), Gaps = 3/199 (1%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
               GS       P   V       A       +++G+ DAPV ++EYA   C +C +F 
Sbjct: 55  AAGSGSVAEVSADPSAGVYAELEAYARRDAADKLALGRADAPVVLIEYADFKCGYCGKFA 114

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             T   L  KY+ +G LR   R FP+    + AV  A  A  +    +    +       
Sbjct: 115 RDTEPVLVKKYVDSGVLRIEWRNFPIFGEESEAVARASWAAGQQGRFWEFHKAAYAEGAK 174

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           +       +D L  +AK AG          ++        +  +         STP F I
Sbjct: 175 EKGFG---KDRLAALAKEAGVPDAARFAKDSEGAPARAAVSADQEQGYSLGATSTPSFLI 231

Query: 205 GGNLYLGDMSEGVFSKIID 223
            G    G      F++ I+
Sbjct: 232 NGRPIAGAQPLETFTETIE 250


>gi|149276047|ref|ZP_01882192.1| DSBA oxidoreductase [Pedobacter sp. BAL39]
 gi|149233475|gb|EDM38849.1| DSBA oxidoreductase [Pedobacter sp. BAL39]
          Length = 171

 Score = 91.6 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/162 (18%), Positives = 56/162 (34%), Gaps = 8/162 (4%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
              T  D   G   A +T+VEY    C HC + H    + L+    +   +         
Sbjct: 5   PAVTETDHRQGNGSASLTIVEYGDYQCPHCGKAHPVIKEILDTFGDQVLFVFRNFPLQES 64

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
              +T+A      A  +    YW     +F  Q          + L ++A+      + F
Sbjct: 65  HPYATIAARATEAAALQD--KYWEMHDAIFEFQSQLN-----EEFLFSLAERLELDLDQF 117

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
              +    + + ++   +       ++ TP FF+  N + GD
Sbjct: 118 REDITSAEVKEKVENDFESGV-RSGVNGTPSFFVNDNKFDGD 158


>gi|94987150|ref|YP_595083.1| protein-disulfide isomerase [Lawsonia intracellularis PHE/MN1-00]
 gi|94731399|emb|CAJ54762.1| Protein-disulfide isomerase [Lawsonia intracellularis PHE/MN1-00]
          Length = 275

 Score = 91.6 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 60/173 (34%), Gaps = 4/173 (2%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
              G   APVT+V ++  TC +C++      +           ++YI + FPL   +   
Sbjct: 100 PIRGNPKAPVTIVAFSDFTCLYCSQASKTVQQ---MLIDYKDNVKYIFKHFPLKGHTISQ 156

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                            +       Q      +N    L    K  G       + LN  
Sbjct: 157 QAAIYFIAASFQSNEKAWALYDLLFQKRDELLQNGEQTLKQAVKEVGLDIKKLMSDLNKA 216

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            + + +    K A++   I  TP F +   +  G +   +F++ I+  ++++ 
Sbjct: 217 EVNNILGQDIKDAAQ-LDISGTPYFIVNNLILRGALPPELFTEAINMALKNTK 268


>gi|213018735|ref|ZP_03334543.1| hypothetical protein C1A_508 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995686|gb|EEB56326.1| hypothetical protein C1A_508 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 230

 Score = 91.6 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 62/225 (27%), Positives = 93/225 (41%), Gaps = 14/225 (6%)

Query: 17  LFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMT 76
           L     F      +A+ +        D             D  +G   AP+ M+EYAS+T
Sbjct: 5   LLFLLIFISVSSYAAIEQNLPNTQKTDEITSKELLSLLPDDKLLGDPKAPILMIEYASLT 64

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C+HC+ FH K F  +++KYI TGK+ YI R FPLD                 +  Y+ F 
Sbjct: 65  CYHCSLFHKKVFPKIKEKYIDTGKMLYIFRHFPLDYRGL--KAAMLSYCYEKEEDYFNFN 122

Query: 137 SLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
             +FN  D W  S       L  +A  +   ++ F+ C+ND+ ++D I   K  A     
Sbjct: 123 KAVFNAIDSWNYSNFSDLTILQKIAALSNLKQDVFNQCINDKKMMDKIINDKSLAINKLD 182

Query: 196 IDSTPVFFI----------GGN-LYLGDMSEGVFSKIIDSMIQDS 229
           I +TPVF I           G   + G      F+ +ID +   +
Sbjct: 183 ITATPVFIIKINDDKSYVENGKIKHEGYRELEYFTNVIDELYGKA 227


>gi|328765882|gb|EGF75980.1| hypothetical protein BATDEDRAFT_28910 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 223

 Score = 91.6 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV-AV 118
           IG  DAPVT+VE+    C  C  +    +  L   Y+ TGK+++           +  A 
Sbjct: 51  IGDPDAPVTVVEFGDFKCPSCKAWGENIYPQLVSDYVDTGKVKFSFINVLFHGEESELAS 110

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY---RDALLNMAKFAGFSKNDFDTCLN 175
           + A    K+    YW F   LF +Q    +  ++      L   +  +G   +   + + 
Sbjct: 111 LAAESVYKQNPDSYWEFHKALFKEQPSENHDSSWVTIEKILEVASGVSGIDTDKLKSDIE 170

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             + +D++    +    +F +  TP   +   +             ID+ ++++
Sbjct: 171 SNSEIDEVNKDTEL-VTEFEVQLTPTIMVNETMIEDPFDYEAIKNAIDNALEEN 223


>gi|52144770|ref|YP_082059.1| thiol-disulfide oxidoreductase (disulfide bond formation protein D)
           (disulfideoxidoreductase D) [Bacillus cereus E33L]
 gi|51978239|gb|AAU19789.1| probable thiol-disulfide oxidoreductase (disulfide bond formation
           protein D) (disulfideoxidoreductase D) [Bacillus cereus
           E33L]
          Length = 219

 Score = 91.6 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 80/224 (35%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +G++  I +L +     Y+      ++          ++             +G+ DAPV
Sbjct: 12  LGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQS-------------LGKDDAPV 58

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VAVMLARCAEK 126
            +VE+    C  C  +       L+++YI  GK++     FP     + +         K
Sbjct: 59  KVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYK 118

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN--DFDTCLNDQNILDDIK 184
           +    +W F   ++  Q          + LLN+ K      +   F   L+ + I + ++
Sbjct: 119 QDKDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDIAQFKKDLHSKEIKEKVR 178

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
               RA +   +   P  ++ GNL   +         ID  ++ 
Sbjct: 179 KDSDRA-QKLKVQGAPSVYVNGNL--ANPDFDSMKAAIDKELKK 219


>gi|254419287|ref|ZP_05033011.1| hypothetical protein BBAL3_1597 [Brevundimonas sp. BAL3]
 gi|196185464|gb|EDX80440.1| hypothetical protein BBAL3_1597 [Brevundimonas sp. BAL3]
          Length = 200

 Score = 91.6 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 50/176 (28%), Positives = 82/176 (46%), Gaps = 4/176 (2%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
            T +D  +G+ DAPVT++EYAS TC HCA+FHN      + +YI TGK+R + R  P  +
Sbjct: 29  VTAQDHVLGRADAPVTVIEYASFTCSHCADFHNDVLPAFKARYIDTGKVRLVHRNLPT-A 87

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + VA   A  A     G Y+    +    Q +   +   +         +G ++   +T
Sbjct: 88  PANVAAAAAAVAICAAPGRYFDVAEVFMRDQANLRTTGA-KPWFDAGLAASGKTREQIET 146

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           CL D      ++A     +++  +  TP FF+ G     D S    S  +D +++ 
Sbjct: 147 CLGDPATGAALQAQI-EGAQEAGVAGTPSFFVNGKPVA-DHSLEALSAAVDPLLRR 200


>gi|220906646|ref|YP_002481957.1| DSBA oxidoreductase [Cyanothece sp. PCC 7425]
 gi|219863257|gb|ACL43596.1| DSBA oxidoreductase [Cyanothece sp. PCC 7425]
          Length = 263

 Score = 91.6 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 66/206 (32%), Gaps = 8/206 (3%)

Query: 19  IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
           +        +     E+      +  +       +       G   A + ++E++   C 
Sbjct: 66  VIIESVQAYQKQQQEEVRKNRQSLVQQLQANPRAAIGNSPRTGSSQAKMVLLEFSDFQCP 125

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
           +CA+      ++++    +   +        +   +  A   A  A ++    +W +   
Sbjct: 126 YCAQTVVMLKEFMQKYGNQVALVYKHYPLVSIHPQAMPAAKAAWAAAQQG--KFWPYHDA 183

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           LF +Q +        D  L +A+      + F+     Q     I+   K   E   I+ 
Sbjct: 184 LFAQQQELG-----EDLFLKIAQELQLDLSRFNRDRQSQAATTAIEQDMKMG-EALGIEG 237

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDS 224
           TP   + G L+ G        K + S
Sbjct: 238 TPFLVLNGRLFNGAPPLEELEKALQS 263


>gi|84684924|ref|ZP_01012824.1| 27 kDa outer membrane protein, putative [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667259|gb|EAQ13729.1| 27 kDa outer membrane protein, putative [Rhodobacterales bacterium
           HTCC2654]
          Length = 252

 Score = 91.6 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 32/200 (16%), Positives = 64/200 (32%), Gaps = 8/200 (4%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
               E    + V    A   +  +       G  D  VT+VE+    C +C +   +   
Sbjct: 61  QRQAEQAEANDVAMIAANEESIYNDGYSHVAGNPDGDVTLVEFVDYRCGYCRKAFPEINA 120

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            LE        +         +SV++    +A       +           +     + +
Sbjct: 121 LLESDGNIR-LIYKEFPILGQESVTSARFAIATKLAHGDEAYGE------MHDALMTLRA 173

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
               + L  MA   G+   +    + D  +   I+     A +   I  TP F +GG + 
Sbjct: 174 NATEEVLARMADDMGYDSQEILAKMEDPEVNRQIEENHLLA-QRLEISGTPTFVLGGQMI 232

Query: 210 LGDMSEGVFSKIIDSMIQDS 229
            G +      +++ +  +DS
Sbjct: 233 RGYVPLEAMQEMVAAEREDS 252


>gi|254797229|ref|YP_003082070.1| hypothetical protein NRI_0867 [Neorickettsia risticii str.
           Illinois]
 gi|254590459|gb|ACT69821.1| conserved hypothetical protein [Neorickettsia risticii str.
           Illinois]
          Length = 229

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 92/228 (40%), Gaps = 10/228 (4%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVT 68
             L G+  L   S  F        + L      V     L        D+ +G  DAP+T
Sbjct: 5   LFLCGLAALISFSLAFSAPSSLHSDALKFNPRTVRVSENLLFP----ADLPVGSTDAPIT 60

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS------VSTVAVMLAR 122
           +V+Y+S +C HC     K    + +KY++TGK+  I+R+FPLD       V         
Sbjct: 61  IVDYSSFSCTHCKAAFEKLILPVYEKYVRTGKVMLIMRDFPLDKLSFNASVFLGCYRKTI 120

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
             +          +  + +      +++   D +++ +   G +K  F +C+ D  + D+
Sbjct: 121 IPDDEHVIRLITKLFDIGSGAKSKEDAEKMFDGIVSDSNLQGSTKEKFLSCMEDLGVKDE 180

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           +   K    +   ID TP+ FI G  Y G      F + I+ ++ D  
Sbjct: 181 VLYSKLFGIKKIGIDGTPMIFINGERYTGPFKFSFFERKIEKILNDRK 228


>gi|111035806|emb|CAL29433.1| hypothetical protein OW1-K [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 231

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 61/233 (26%), Positives = 94/233 (40%), Gaps = 16/233 (6%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I  L    L+FI+   +   K    +              L +      D  +G   AP+
Sbjct: 2   IFRLMFFALIFISINSYTVVKEGLSDNQYTQKTSEITPKELLSP--LADDKLLGDPKAPI 59

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
            M+EYAS+TC+HC  FH + F  ++ KYI TGK+ YI R FP+D                
Sbjct: 60  LMIEYASLTCYHCYLFHKEVFPKIKKKYIDTGKMLYIFRHFPMDYRGL--KAAMLSHCYE 117

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
               Y+ F   +FN  D W  S       L  +A  +   ++ F+ C+ND+ I+D +   
Sbjct: 118 RTEDYFNFNKAVFNLIDSWNYSNLSDLTVLQKVAALSNLKQSTFNQCINDRKIMDKVIND 177

Query: 187 KKRASEDFAIDSTPVFFI-----------GGNLYLGDMSEGVFSKIIDSMIQD 228
           K  A     +  TP+FFI               + G  +    + IID  ++ 
Sbjct: 178 KSLAINKLGVTGTPIFFIKLNNDKSYVEHNKIKHEGYKTLEYLANIIDDYVKK 230


>gi|296162942|ref|ZP_06845720.1| Na+/H+ antiporter NhaA [Burkholderia sp. Ch1-1]
 gi|295886796|gb|EFG66636.1| Na+/H+ antiporter NhaA [Burkholderia sp. Ch1-1]
          Length = 621

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 70/225 (31%), Gaps = 16/225 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
             +GVL  ++L  +     +        E        D   +L        D   G +DA
Sbjct: 407 ATVGVLVSMMLATLLGRLIFKVAARRWGE-----ETADLPMVLEPPVDPEVDHIRGPEDA 461

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
            +T+VEY    C +CA                   +   L   P        +       
Sbjct: 462 QLTLVEYVDFECAYCAHATGSWEDLRAHFGDDLRYVVRQLPHHPHGP-----IAARASEA 516

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
               G +W ++  +F +Q         R+ L+  A   G   + F   L+   +++ ++ 
Sbjct: 517 ASNQGMFWPWLDFVFTRQHALE-----REDLIGYAVGLGLDVDRFIADLDSPAVIERVER 571

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
               A        TP FF+ G    G       +  +++  + + 
Sbjct: 572 DLASAV-ASGAHVTPTFFVEGRRLRGSYDARTLTAALEASRRGTR 615


>gi|260576051|ref|ZP_05844045.1| DSBA oxidoreductase [Rhodobacter sp. SW2]
 gi|259021750|gb|EEW25052.1| DSBA oxidoreductase [Rhodobacter sp. SW2]
          Length = 219

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 63/226 (27%), Gaps = 8/226 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R  +L G   L + ++       +   +           A+  A        S G +D
Sbjct: 1   MNRRTLLIGASALGLTAFGGGAFFLNRQRQAGAEAVAAATPAVDPALLVRPHSPSFGPED 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+   +C  C  +H    +       +   +                       
Sbjct: 61  APVTLVEFFDPSCEACRAYHPVVEEIRRMFPDQVRIV-----LRYALFHEGSDEAARILE 115

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQNILDDI 183
             RM   +   +  LF +Q  W    +    +               +T      I   +
Sbjct: 116 AARMQNKFEPVLDALFEEQPGWAVHGSPEMDVAWEIAANAGLDVERAETDKLFPGITGTL 175

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                   E   I  TP FF+ G     + S       +   ++++
Sbjct: 176 NQDMAD-VEALGIRQTPTFFLNGKRLE-NFSAESLIADVRFAVENA 219


>gi|305679792|ref|ZP_07402602.1| DsbA-like protein [Corynebacterium matruchotii ATCC 14266]
 gi|305660412|gb|EFM49909.1| DsbA-like protein [Corynebacterium matruchotii ATCC 14266]
          Length = 287

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 71/198 (35%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
            P  D   +   L     +     ++G  DAPV + E++   C  CA + N   K +  +
Sbjct: 86  GPGGDIKSENDVLNVHRRNAKDPFAVGAVDAPVVISEFSDFECPFCALYVNGARKQILSE 145

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
           Y+  G +R    +FP++  + VA   A  A       +    +L         + +N   
Sbjct: 146 YVDQGLVRLEWNDFPINGPNAVAAAKAGRAAAAQGKFHEFHDALYQASAGVKGHPENKTA 205

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
             +  AK AG             +  D++    +       ID  P   +G     G   
Sbjct: 206 DFVRFAKEAGVPDLAKFEEQATDSTYDEVIKKAQGYGSSLGIDGVPAALVGTQFVSGAQP 265

Query: 215 EGVFSKIIDSMIQDSTRR 232
             VF ++I++ +  +  +
Sbjct: 266 IEVFRQVIETELVKAKAK 283


>gi|121605311|ref|YP_982640.1| DSBA oxidoreductase [Polaromonas naphthalenivorans CJ2]
 gi|120594280|gb|ABM37719.1| DSBA oxidoreductase [Polaromonas naphthalenivorans CJ2]
          Length = 182

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 59/178 (33%), Gaps = 8/178 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P    D   G   APVT++EY    C  C + H      L     +   +        + 
Sbjct: 13  PDEATDAIRGPAGAPVTLIEYGDFECPSCVQAHGALNILLAHFGDQLRFVFRHFPLREIH 72

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             + +A   A  A  +    +W    LLF               LL+ A+  G     + 
Sbjct: 73  PHAEMAAEAAEAARAQG--KFWPMYDLLFTHSQHLK-----EKHLLDYARQVGLDIARYQ 125

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             +ND   L  ++   +  +    + STP F++ G L           + ID  +  S
Sbjct: 126 NEMNDHVYLQRVQEHIQ-GARHLGVRSTPAFYVNGVLTDVSFGLQHLHEAIDKALLRS 182


>gi|58697221|ref|ZP_00372621.1| DSBA oxidoreductase:Tat pathway signal [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225630789|ref|YP_002727580.1| hypothetical protein WRi_010920 [Wolbachia sp. wRi]
 gi|58536450|gb|EAL59860.1| DSBA oxidoreductase:Tat pathway signal [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592770|gb|ACN95789.1| hypothetical protein WRi_010920 [Wolbachia sp. wRi]
          Length = 228

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 60/226 (26%), Positives = 94/226 (41%), Gaps = 17/226 (7%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           LL ++ +            +      +  + LL+  P    D  +G   AP+ M+EYAS+
Sbjct: 5   LLLLSIFISVNSYAVVNQHIQKETNEITSKELLSLLP---DDKLLGNPKAPILMIEYASL 61

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
           TC+HC+ FH   F  +++KYI TGK+ YI R FPLD                    Y+ F
Sbjct: 62  TCYHCSLFHKNVFPKIKEKYIDTGKMLYIFRHFPLDYRGL--KAAMLSHCYEKQEDYFNF 119

Query: 136 VSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
              +FN  D W          L  +A  +   ++ F+ C+ND+ I+D I   K  A    
Sbjct: 120 NKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKIMDKIINDKSLAINKL 179

Query: 195 AIDSTPVFFI-----------GGNLYLGDMSEGVFSKIIDSMIQDS 229
            I +TP+FFI               + G       + +ID +   +
Sbjct: 180 GITATPIFFIKLNDGKSYIEHNKVKHEGYKELKYLTDVIDKLYGKA 225


>gi|40445317|ref|NP_954777.1| hypothetical protein pKB1_p037 [Gordonia westfalica]
 gi|40217347|emb|CAE09098.1| hypothetical protein [Gordonia westfalica]
          Length = 214

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 65/228 (28%), Gaps = 15/228 (6%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +    +I +   IV     +  F   +     +      +         S          
Sbjct: 1   MSRNVKISLAVVIVFCLALTVVFVVSRAGDSEQADAQASMTVRDDSPRLST--------- 51

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             ++  T VE+    C  C   +    +  +    +   + +++R FPL           
Sbjct: 52  PTESKATFVEFLDFECEGCGAAYPAVEQLRQTYGDQ---VTFVVRYFPLPGHFNADRAAR 108

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA-GFSKNDFDTCLNDQNIL 180
             A     G +      +F+ Q  W   +   D L        G   + F    N Q   
Sbjct: 109 AVAAAAEQGQFEPMYRKMFDTQRSWGEQRVPLDDLFFSYAQELGLDMDRFAADYNSQATR 168

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           + I        +   +  TP FFI   L     S    S  ++S ++ 
Sbjct: 169 ELIDRDVADG-KALGVTGTPTFFINDELIK-PESYDDLSSALESALRQ 214


>gi|226226132|ref|YP_002760238.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
 gi|226089323|dbj|BAH37768.1| putative oxidoreductase [Gemmatimonas aurantiaca T-27]
          Length = 263

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 66/165 (40%), Gaps = 2/165 (1%)

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY-ILREFPLDSVSTVAVMLARCAEKR 127
           +V  +   C +C  +H+ +   LE  YIKTGK+R+  L                      
Sbjct: 86  VVMISDYQCPYCKSWHDSSMANLERDYIKTGKIRFAYLHLPLEGIHPHARAESEAAMCAG 145

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
             G +W + + LF  Q       +    L  +A+        F+ C     I   ++A  
Sbjct: 146 AQGKFWPYSNALFAAQGTVRTMNDVSPLLTRIAREQSLDLTAFNACRQSPAIRSLVEADI 205

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           ++AS+   + STP F +G  +  G +    F+K ID+ +    +R
Sbjct: 206 RQASQA-NVQSTPSFVVGEFMLRGALPYPDFAKAIDTALVRFKQR 249


>gi|315498445|ref|YP_004087249.1| dsba oxidoreductase [Asticcacaulis excentricus CB 48]
 gi|315416457|gb|ADU13098.1| DSBA oxidoreductase [Asticcacaulis excentricus CB 48]
          Length = 212

 Score = 91.2 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 53/233 (22%), Positives = 89/233 (38%), Gaps = 32/233 (13%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
            ST R+ V   + L  +A     ++    ++EL                         G+
Sbjct: 5   FSTLRLTVAALLTLGLVACGQSGSKGAIKVDELSE-----------------------GK 41

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPVT+VEYAS+ C  CA+ + K     + KY++TGK+RY+ R     + +        
Sbjct: 42  ADAPVTVVEYASVACPICAQVNEKMMPVFKSKYVETGKVRYVYRPMMTGNAAVA-AAGHM 100

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA------LLNMAKFAGFSKNDFDTCLND 176
            A           +  +   Q +                LL +A+ AG  + DF+ C+ D
Sbjct: 101 LANCVSRDKALTVIDSIMRAQPEMDRGGAPEQYANARPVLLRVAQSAGLREADFNRCVTD 160

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL-GDMSEGVFSKIIDSMIQD 228
              L+ +    ++A +D  +  TP F I G             S  ID +++ 
Sbjct: 161 PAGLNALNELNQQALKD-GVTGTPTFLINGKTVQLSRYEIEELSAHIDPLLKK 212


>gi|196233901|ref|ZP_03132739.1| DSBA oxidoreductase [Chthoniobacter flavus Ellin428]
 gi|196222095|gb|EDY16627.1| DSBA oxidoreductase [Chthoniobacter flavus Ellin428]
          Length = 379

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/192 (19%), Positives = 64/192 (33%), Gaps = 9/192 (4%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
               G+                  +G  +APV +V Y+   C  C +           + 
Sbjct: 188 ATGKGMESQGPTGLQLVDLATAHRLGPANAPVQIVVYSDFQCGFCRQLAPVLQHL---ED 244

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
               K+  + R FPL                   G +W +   LFN+  D          
Sbjct: 245 NFPQKVAMLYRHFPLAGHPRAWPAAMASECAAEQGAFWKYHDKLFNEGGDLS-----DTK 299

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           LL +A   G     F  CL      + + AG + A++  A+   P  FI G    G ++ 
Sbjct: 300 LLELASSLGLDPQRFQACLQSDRPREIVAAGLREATD-LALPGAPGVFINGRRVEGPLTY 358

Query: 216 GVFSKIIDSMIQ 227
              +K +D+ ++
Sbjct: 359 EALAKRVDNALK 370


>gi|227495615|ref|ZP_03925931.1| DSBA oxidoreductase [Actinomyces coleocanis DSM 15436]
 gi|226830847|gb|EEH63230.1| DSBA oxidoreductase [Actinomyces coleocanis DSM 15436]
          Length = 275

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/273 (15%), Positives = 80/273 (29%), Gaps = 45/273 (16%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGS--------------------------ALNEL 35
           + +  R+ ++   V   +A    +                               +    
Sbjct: 4   METNKRLQLILVAVAAVLAIIIAFYMGMHFGKSSAEMTSQKPPSTAAMTAEKTEMSAESK 63

Query: 36  PIPDGVVDFRALLAASPSTMKDVSI-----------------GQKDAPVTMVEYASMTCF 78
             P    +  A    SPS      +                 G  DAPV +V Y   +C 
Sbjct: 64  DAPVADPNLVAGQDYSPSQTDPEVLKLMAAEIHRDKDDLRSLGSPDAPVVLVSYEDFSCP 123

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
            C  F+  T   L+    +  KLR   R+  +       +           G +W FV  
Sbjct: 124 MCGVFNTNTHPALKKLVDEG-KLRLEFRDMVIFPNYNSQLAHQGARAAAQQGKFWEFVDK 182

Query: 139 LFNKQDDWINSKNYRD-ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
            F +  +  +    ++  L    +    + + F+  L    I+  ++A  + A E   + 
Sbjct: 183 AFAQTANGNHPNYTKELVLDIAKQAGVENLSAFEKALESDEIVQAVQAETQHAREKLGLT 242

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            TP F I   +  G      F   I+    ++ 
Sbjct: 243 GTPFFIINNAVVSGAYPTEYFINTINQQAVEAK 275


>gi|303245704|ref|ZP_07331987.1| DSBA oxidoreductase [Desulfovibrio fructosovorans JJ]
 gi|302492967|gb|EFL52832.1| DSBA oxidoreductase [Desulfovibrio fructosovorans JJ]
          Length = 266

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 64/207 (30%), Gaps = 6/207 (2%)

Query: 22  YFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCA 81
           Y           +      V        +          G   AP+T+V Y+   C +CA
Sbjct: 50  YALVLAGQQENQDAARLAQVDAELKKPLSPVIDPARAMRGPATAPITVVVYSDFLCPYCA 109

Query: 82  EFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFN 141
                  K++E        +R + + +  D +S  A +L      +     + F   +F 
Sbjct: 110 RGAATLKKFMERHPDS---VRVLFKHYATDDLSRQAALLYEALAAQDPKLAFAFHDAVFA 166

Query: 142 KQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPV 201
            Q +   +     AL  +A   G         L +  +   I      A   F I++TP 
Sbjct: 167 AQQEIEQAG--EPALYALAVKLGADIPKLKRDLKNPALAKRIDDDVAEA-RAFGIEATPT 223

Query: 202 FFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F + G    G      F  ++  +   
Sbjct: 224 FLVNGVSVRGAAPLEDFENVLRKVAPK 250


>gi|94271342|ref|ZP_01291939.1| DSBA oxidoreductase [delta proteobacterium MLMS-1]
 gi|93450470|gb|EAT01644.1| DSBA oxidoreductase [delta proteobacterium MLMS-1]
          Length = 184

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 63/186 (33%), Gaps = 11/186 (5%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           +     A      +   +G +DA V +VE++   C HCA          E   +    L+
Sbjct: 8   ELALQFAVEIDISEAPFLGPEDASVVLVEFSDFQCPHCAR----VKPLTEQLLLNNDDLK 63

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
            + + FPL S              +  G +W     +F  Q D          L  +A+ 
Sbjct: 64  VVFKHFPLSSHEQAKPAALAAMAAQQQGKFWEMHDRIFAAQQDLSPRT-----LQEIARD 118

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G     F   +N + +   ++       +   +  TP  FI G       ++    ++I
Sbjct: 119 IGLDMERFQRDINSRELARRLEQDMADGQQA-GVRGTPALFINGIPVT-QRNQQGIQQMI 176

Query: 223 DSMIQD 228
           D  ++ 
Sbjct: 177 DRALER 182


>gi|120556184|ref|YP_960535.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
 gi|120326033|gb|ABM20348.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
          Length = 212

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 66/223 (29%), Gaps = 17/223 (7%)

Query: 6   TRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDA 65
           TR  V+  ++   +     +              G  +   +            IG +DA
Sbjct: 3   TRTLVISLLLFCLVVFAGAFVIY-------DRSQGTNEPAVVEKTPLVRDYSPVIGPEDA 55

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAE 125
           PVT+VE+   +C  C   H    +           +        +         +     
Sbjct: 56  PVTIVEFFDPSCEGCRAMHPYVKQIQAAYPDNVRLV-----LRYVLFHKGSEEAVRILET 110

Query: 126 KRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKA 185
            R  G Y   +  +   Q  W +      A  + A  AG         +N   I   I+ 
Sbjct: 111 AREQGIYEPVLDAVMEAQPKW-HDDPKVTAAWDAAASAGLDVEAARAGMNSPEIDGIIQQ 169

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYL--GDMS-EGVFSKIIDSM 225
                 +   I  TP F++ G++    G      + +  ++S+
Sbjct: 170 DAAD-VKAVGISGTPTFYVNGDILSRLGPQELYDLVTSKVESL 211


>gi|163735632|ref|ZP_02143063.1| DSBA oxidoreductase [Roseobacter litoralis Och 149]
 gi|161391060|gb|EDQ15398.1| DSBA oxidoreductase [Roseobacter litoralis Och 149]
          Length = 219

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 68/226 (30%), Gaps = 8/226 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R G++  ++ L +A +   T   +    +   + V    A     P +     +G  +
Sbjct: 1   MNRRGLILSVLALGVAGFGGATWFATRPGPVAEAEPVAPELADAMIRPYS---PILGPAE 57

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+    C  C  FH      + +       +            +     +    
Sbjct: 58  APVTIVEFFDPACEACRAFHPIVKDIMAEHGDAVRVVIRYTPF----HGAASEEAIRVLE 113

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             RM   Y   +  +  +Q  W +       L+           +          +  I 
Sbjct: 114 AARMQDVYVPVLEAVLREQPRWASHGAPAPGLILQIAATAGLDAEAARTQMLAPDVVAIL 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
              +   E   I  TP FF+ G        E    +++ + +  + 
Sbjct: 174 NQDRADVETVGIRQTPTFFVNGKPLD-PFGEAELRRLVAAEVAAAQ 218


>gi|295841118|dbj|BAJ06944.1| disulfide isomerase [uncultured bacterium]
 gi|295841176|dbj|BAJ06977.1| disulfide isomerase [uncultured bacterium]
          Length = 197

 Score = 90.8 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 53/186 (28%), Positives = 83/186 (44%), Gaps = 4/186 (2%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
             + L  S +  ++VS+G   APVT++EY S+TC  C  FH   +  L+ +YI TG +R+
Sbjct: 15  AASNLMVSSALSEEVSLGSNQAPVTIIEYGSLTCGKCLSFHRHVYPKLKKQYIDTGTVRF 74

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           I R FP    +        C        Y+  +  LF+  D WI ++N     +  A   
Sbjct: 75  IFRHFPTGEAAVYGARAVNCTG----DKYYEMLDKLFSTTDKWIRAENREAIFVKYATSL 130

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
             +   F TC+ ++  LD+I   +  A +   +  TP FFI   +  G  S      +I 
Sbjct: 131 ELNSEAFVTCIRNKKHLDNILLQQNAARKHLDVIGTPTFFINEKIVRGKRSFLEMEALIS 190

Query: 224 SMIQDS 229
             I  S
Sbjct: 191 EAINKS 196


>gi|226360820|ref|YP_002778598.1| Na(+)/H(+) antiporter [Rhodococcus opacus B4]
 gi|226239305|dbj|BAH49653.1| putative Na(+)/H(+) antiporter [Rhodococcus opacus B4]
          Length = 622

 Score = 90.8 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/224 (15%), Positives = 62/224 (27%), Gaps = 19/224 (8%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           +GVL   V+  +  +  +            P         L    +  +D   G  DAP+
Sbjct: 407 VGVLTAAVIATVLGWALFRLSDWRYPPTKAPG------LTLLRPVALTRDHVRGPADAPL 460

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T+VEY    C  C++              +   +   L    +                 
Sbjct: 461 TLVEYGDFECPFCSKATGSIRDVRAHFGDELRYVFRHLPLDEVHPH--ARFAAQASEAAA 518

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
             G +W     LF   D         D +   A   G   + F+  +     L  +    
Sbjct: 519 AQGRFWEMHDHLFANSDALA-----EDEIFGYAAELGLDTDRFEEDIRKGEYLHRVDDD- 572

Query: 188 KRASEDFAIDSTPVFFIG--G---NLYLGDMSEGVFSKIIDSMI 226
           +  +E      TP F++G  G     + G          ++   
Sbjct: 573 ELDAESSDFHGTPTFYLGATGTDLTRHTGPYDAATLIGRLEEAR 616


>gi|163839110|ref|YP_001623515.1| DsbA oxidoreductase [Renibacterium salmoninarum ATCC 33209]
 gi|162952586|gb|ABY22101.1| DsbA oxidoreductase [Renibacterium salmoninarum ATCC 33209]
          Length = 235

 Score = 90.4 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/238 (12%), Positives = 63/238 (26%), Gaps = 16/238 (6%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPI----------PDGVVDFRALLAAS 51
           ++    + + G    L IAS        +A  ++                 +  A     
Sbjct: 1   MLKRKTLCLAGLSAALLIASVASCASPEAASPDVNTGATSSTGITSAPIGPNASATALPL 60

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
                 +     +A  T+V +    C +CA+      K  ++   +   +          
Sbjct: 61  VRADSRIVNNPAEAKATLVLFTDYQCPYCAKMDTLINKARDEYSGQLKIVVRNFPLAM-- 118

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-LLNMAKFAGFSKNDF 170
                 +                    +F  Q  W  + + +   L   A+  G     F
Sbjct: 119 -HPNAPIAARAVEAAAEQNALTTMAEAVFKGQTTWAKATDGQAQLLAKYARGLGLDMTKF 177

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL-GDMSEGVFSKIIDSMIQ 227
           +       I D ++   + A+    +  TP   + G L              ID ++ 
Sbjct: 178 EQDFTSAKIGDRVERDLQDAT-ALGLRGTPSVVLNGKLLSVDSTDYSTLKTPIDRVLA 234


>gi|282863527|ref|ZP_06272586.1| DSBA oxidoreductase [Streptomyces sp. ACTE]
 gi|282561862|gb|EFB67405.1| DSBA oxidoreductase [Streptomyces sp. ACTE]
          Length = 255

 Score = 90.4 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 82/227 (36%), Gaps = 14/227 (6%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPD-----------GVVDFRALLAASPS 53
            +R  ++ G V++  A    +    +   + P  D             +       A   
Sbjct: 9   KSRKPLVFGTVVVLAAGLLGFVSYRATAPDTPSSDTSAVGTAAEEDAGIHPELAELARRD 68

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
               ++ G+ DAPV ++EYA   C +C +F   T   L +KY++ G LR   R FP+   
Sbjct: 69  AADKLAQGRTDAPVVLIEYADFKCGYCGKFARDTEPELVEKYVQDGTLRIEWRNFPIFGK 128

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
            + A   A  A  +    +    +   +   +    ++   AL +  +      + F   
Sbjct: 129 ESEAAARASWAAGQQGRFWEFHRAAYADGAKEKGFGEDRLRALAH--EAGIEDLDRFARD 186

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
                  D +   +++A       STP F I G    G     VF++
Sbjct: 187 TESTAATDAVARDQEQAY-GIGATSTPSFLINGRPVAGAQPLSVFTR 232


>gi|86139682|ref|ZP_01058249.1| dsbA-like thioredoxin domain protein [Roseobacter sp. MED193]
 gi|85823573|gb|EAQ43781.1| dsbA-like thioredoxin domain protein [Roseobacter sp. MED193]
          Length = 219

 Score = 90.4 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/223 (15%), Positives = 62/223 (27%), Gaps = 8/223 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R G++  ++ L +A +   T   +                 LA +        +G  D
Sbjct: 1   MNRRGLILSVLALGVAGFGGATWYATRPGPA---AEAKTVAPELADAMIRSYSPILGPAD 57

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+    C  C  FH      +         +                  +    
Sbjct: 58  APVTIVEFFDPACEACRAFHPIVKDIMAQHGDAVRVVIRYTAF----HGEASEEAIRVLE 113

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             RM G Y   +  +   Q  W +       L+           +          +  I 
Sbjct: 114 AARMQGVYEPVLEAVLRDQPRWASHGAPEPGLILQIAATAGLDAEAARTQMLAPDVVAIL 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              +   E   +  TP FF+ G        E    +++ + + 
Sbjct: 174 NQDRADVETVGVRQTPTFFVNGKSLD-PFGEAELRRLVAAEVA 215


>gi|114570747|ref|YP_757427.1| protein-disulfide isomerase-like protein [Maricaulis maris MCS10]
 gi|114341209|gb|ABI66489.1| Protein-disulfide isomerase-like protein [Maricaulis maris MCS10]
          Length = 257

 Score = 90.4 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 100/258 (38%), Gaps = 48/258 (18%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           MS TR       +   +A                   G  D      +      D  +G 
Sbjct: 1   MSLTRRLFSAAAMTAVLAVSAC---------------GSSDAPVDGQSRFERAGDRGLGS 45

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DAPVTM+EYAS+ C HCA +HN+ +  LE  YI+TG++R++LRE    S     +    
Sbjct: 46  PDAPVTMIEYASVACGHCATWHNEVYPMLESDYIETGQVRFVLREMITGSAQFA-IAGFS 104

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWIN----SKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
            A    +  Y+  V LLF +Q+          + R+  L +A+  G S+ DF  CL+D+ 
Sbjct: 105 LAHCVPEDRYYDMVDLLFQQQNAIFQAAQTQGSARNQYLAIARSMGMSEADFTQCLSDET 164

Query: 179 ILDDIKAGKKRASEDFAIDSTPVF---------------------------FIGGNLYLG 211
           I  DI     RA  +  I  TP F                            I G     
Sbjct: 165 ITQDILDANDRAGAE-GITGTPRFIFNGEMLDSRRAPGESAYTYFLGNEQLIIDGEPVPN 223

Query: 212 DMSEGVFSKIIDSMIQDS 229
                 F +I+D +I ++
Sbjct: 224 FSDAETFRRILDHLIAEN 241


>gi|251797331|ref|YP_003012062.1| DSBA oxidoreductase [Paenibacillus sp. JDR-2]
 gi|247544957|gb|ACT01976.1| DSBA oxidoreductase [Paenibacillus sp. JDR-2]
          Length = 224

 Score = 90.4 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 65/175 (37%), Gaps = 5/175 (2%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK--LRYILREFPLDSVST 115
              G  +APV +VE+    C  C  F       LE  +I TGK  L +    F     +T
Sbjct: 50  PVKGNAEAPVKIVEFGDYKCPICQYFAQNVEPQLEKDFIDTGKAALYFANYTFIGPDSTT 109

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF--SKNDFDTC 173
            A+      ++  D  +W +   +++ Q D        D L+ +AK A      +     
Sbjct: 110 AALAAEAVQQQGGDEAFWTYYKTIYDNQKDEKTKWATSDYLVQLAKDAKLTLDFDKLKKD 169

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++D+    ++     +      +  TP  FI G  Y G++        ID  +  
Sbjct: 170 IDDKTYQSEVNKDNAK-VGPLNVTGTPTLFINGVQYAGNLDYASIKAAIDEAVNK 223


>gi|303326120|ref|ZP_07356563.1| protein-disulfide isomerase [Desulfovibrio sp. 3_1_syn3]
 gi|302864036|gb|EFL86967.1| protein-disulfide isomerase [Desulfovibrio sp. 3_1_syn3]
          Length = 270

 Score = 90.4 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 59/184 (32%), Gaps = 4/184 (2%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
              S        +G   A V +V ++  TC  C +        L++       +   L  
Sbjct: 91  TPKSVRLEGRPVLGSPKAKVRIVAFSDFTCHFCQQASKTVDALLQEYGKDVSLVFKNLPL 150

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
                    A        ++ +   W F   LF  +D  +      D L   A+      
Sbjct: 151 DEKGPGGQAA-AYFVAVSQQSEEKAWKFYKALFADRDRLVTEG--EDFLKKTAQGLDVDM 207

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                 +  + + D +   ++ A +   ++ TP F +   +  G +   +F   +D  ++
Sbjct: 208 KKLGRDVRGKKVSDILAEDQQDA-QKLGVEGTPYFLVNNMVVRGALPLDLFKGAVDMALK 266

Query: 228 DSTR 231
            + +
Sbjct: 267 QNNK 270


>gi|294084667|ref|YP_003551425.1| hypothetical protein SAR116_1098 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664240|gb|ADE39341.1| hypothetical protein SAR116_1098 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 223

 Score = 90.4 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 58/225 (25%), Positives = 105/225 (46%), Gaps = 16/225 (7%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           +  S +R     G+    I     +     AL         +                 +
Sbjct: 11  ITTSISRRHFSSGLFGAAITVASPFVASMQALAADDDIIAHISAP------------RIM 58

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   AP+ +VEY SMTC HCA FHN TF  ++   I+ G +++ +R FPLD ++     L
Sbjct: 59  GNAKAPIKVVEYFSMTCGHCANFHNVTFPKVKSDMIERGLIQFEMRPFPLDGLALRGHAL 118

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           AR         Y+  V  L ++   W+ +++   AL+ +A+ AG S  +F+  ++++ +L
Sbjct: 119 ARSLP---ATRYFPMVKALMSQHKQWVRAEDPLAALMKIARLAGISGAEFNKIMSNRALL 175

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIG-GNLYLGDMSEGVFSKIIDS 224
           + +   ++ A +D+ + STP F I    L  G+M+   F++ I++
Sbjct: 176 EKLVEMRQAALDDWNVSSTPSFVINDDKLLSGNMNYETFAEEINA 220


>gi|258651138|ref|YP_003200294.1| DSBA oxidoreductase [Nakamurella multipartita DSM 44233]
 gi|258554363|gb|ACV77305.1| DSBA oxidoreductase [Nakamurella multipartita DSM 44233]
          Length = 188

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 52/194 (26%), Gaps = 9/194 (4%)

Query: 32  LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYL 91
            + +                   + D   G  DAPVT++EY    C +CA       + L
Sbjct: 2   TDPVTEVPDEPAAPDGDVPREDGLVDHVRGALDAPVTVIEYGDFECPYCAAAKPVLEEVL 61

Query: 92  EDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKN 151
                +   +         +                  G +W    +LF  Q    +   
Sbjct: 62  AGSAGRVRLIFRNFPL--YEVHPYALTAALAAEAAAAQGAFWPMHDMLFAHQTRLSDWDL 119

Query: 152 YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            + A       +    +        Q   D ++A    A     +  TP  FI G LY G
Sbjct: 120 AKYATKLGLDGSRVIGDP------AQPYGDKVEADFALAL-AAGVQGTPTVFINGVLYEG 172

Query: 212 DMSEGVFSKIIDSM 225
                   + +   
Sbjct: 173 RFDVTGLRRAVAQA 186


>gi|330469503|ref|YP_004407246.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
 gi|328812474|gb|AEB46646.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
          Length = 185

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 57/175 (32%), Gaps = 8/175 (4%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +P T  D   G  DAPVT+VEY    C  C + H    + L ++      +         
Sbjct: 17  TPVTEHDHVRGPTDAPVTIVEYGDYQCPFCGQAHASLQEVLRERADTVRLVYRHFPIA-- 74

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           +      +           G +W     L+  Q+        R  L+   +  G   N+ 
Sbjct: 75  NLHPYAEMAAEAAEAAGRRGRFWEMHDWLYEHQEQLD-----RVHLMLGVEQLGLPVNEV 129

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           D  +      D I+           +D++P  F+    + GD         +D+ 
Sbjct: 130 DAEIGRHAGGDRIRHDFVSGI-RSGVDASPTLFVNDTRHDGDFDLATLLATVDAA 183


>gi|289706169|ref|ZP_06502535.1| DSBA-like thioredoxin domain protein [Micrococcus luteus SK58]
 gi|289557113|gb|EFD50438.1| DSBA-like thioredoxin domain protein [Micrococcus luteus SK58]
          Length = 248

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 66/232 (28%), Gaps = 15/232 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNE--------LPIPDGVVDFRALLAASPSTM 55
              +I V   +  L +A    +    +                 G     A  AA     
Sbjct: 19  RRAKIIVWVVLAALVLAGVVAFFAARAPSTPEAAPAQAGQAASSGTGQTAASEAAPVVRP 78

Query: 56  KDVSI-GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
               +    +    +VE+    C  C   H    +   +       + ++ R FPL    
Sbjct: 79  DSRVLSQAPNEKAVLVEFLDFECEGCKAAHPVVEELRAEYADT---VTFVHRYFPLPGHP 135

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-LLNMAKFAGFSKNDFDTC 173
                          G Y      +F+ Q+ W ++   R       A+  G     +D  
Sbjct: 136 NSMTAAVAVEAAAQQGAYEAMYQKMFDTQEQWSHTGQDRSPVFRGYAEDLGLDMTAYDKA 195

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           + D      I+A          +  TP FF+ G +   + +   F   +D+ 
Sbjct: 196 VADPATRARIEADVADGV-ALGVQGTPTFFLDGQVLTLN-TLEQFRAEVDAA 245


>gi|84503206|ref|ZP_01001291.1| dsbA-like thioredoxin domain protein [Oceanicola batsensis
           HTCC2597]
 gi|84686772|ref|ZP_01014659.1| dsbA-like thioredoxin domain protein [Maritimibacter alkaliphilus
           HTCC2654]
 gi|114762621|ref|ZP_01442065.1| dsbA-like thioredoxin domain protein [Pelagibaca bermudensis
           HTCC2601]
 gi|159046162|ref|YP_001541834.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|159046497|ref|YP_001542167.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|84388447|gb|EAQ01396.1| dsbA-like thioredoxin domain protein [Oceanicola batsensis
           HTCC2597]
 gi|84665203|gb|EAQ11682.1| dsbA-like thioredoxin domain protein [Rhodobacterales bacterium
           HTCC2654]
 gi|114544876|gb|EAU47881.1| dsbA-like thioredoxin domain protein [Roseovarius sp. HTCC2601]
 gi|157913921|gb|ABV95353.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|157914256|gb|ABV95686.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
          Length = 219

 Score = 90.1 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/226 (14%), Positives = 69/226 (30%), Gaps = 8/226 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R G++  ++ L +A +       +  + +   D +    A     P +     +G +D
Sbjct: 1   MKRRGLILSVLALGVAGFGGAAWYATRPDPIAASDPIDPEMADALIRPYS---PILGPED 57

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+    C  C  F+      + +       +                  +    
Sbjct: 58  APVTIVEFFDPACEACRAFYPVVEDIMAEHGDAVRVVIRYTPF----HGEASVEAIRVLE 113

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             RM   +   +  +  +Q  W +       L+     +G    +          +  + 
Sbjct: 114 AARMQDVFEPVLEAVLREQPRWASHGTPAPGLILEIAASGGLDVEAARTQMLAPGVVAVL 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
              +   E   +  TP FF+ G        E    +++   +  S 
Sbjct: 174 NQDRADVETVGVRQTPTFFVNGKPLD-PFGEAELQRLVAVEVAASQ 218


>gi|254414867|ref|ZP_05028631.1| DSBA-like thioredoxin domain protein [Microcoleus chthonoplastes
           PCC 7420]
 gi|196178356|gb|EDX73356.1| DSBA-like thioredoxin domain protein [Microcoleus chthonoplastes
           PCC 7420]
          Length = 267

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 58/173 (33%), Gaps = 8/173 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
                   +  + G   + + MVE++   C +C   H    +++     +          
Sbjct: 82  TNPQAIIGESPTTGASQSKIVMVEFSDFQCPYCGRAHKTVQRFMAKHQDQVTLTYKHYPL 141

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
             +   +  A   A  A ++    +W +  +LF +Q+            +  AK    + 
Sbjct: 142 ASIHPQAISAAKAAWAAFQQG--KFWQYHDVLFTQQEKLG-----ESFYIETAKGLNLNV 194

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
           + F+   N Q     I    + A E   I  TP F + G ++ G +      K
Sbjct: 195 DQFNRDRNSQAAETAISQDIQLA-ESLGITGTPFFVMNGEVFTGAIELEEMEK 246


>gi|77454693|ref|YP_345561.1| putative oxidoreductase [Rhodococcus erythropolis PR4]
 gi|229493290|ref|ZP_04387081.1| dsba oxidoreductase [Rhodococcus erythropolis SK121]
 gi|77019693|dbj|BAE46069.1| putative oxidoreductase [Rhodococcus erythropolis PR4]
 gi|229319792|gb|EEN85622.1| dsba oxidoreductase [Rhodococcus erythropolis SK121]
          Length = 218

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/226 (12%), Positives = 67/226 (29%), Gaps = 13/226 (5%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           +  +  +    V   +        +                RA      +          
Sbjct: 5   TNAKFSIALVAVFAVVLGALLLGNRSGTGTTSAGASDATVLRADTHLLSTA--------P 56

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           D  V +VE+    C  C   +    +    +     ++ + +R FP+ S +   +     
Sbjct: 57  DNDVVLVEFLDFECEACLAMYPTMERI---RTEYADRITFGVRYFPIPSHTNSGLAARVV 113

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G +      +++ Q +W  S   ++ L    A+  G     F+  L D  + + 
Sbjct: 114 EAASRQGKFVEMYQRMYDTQTEWGESSESQEPLFRTFAQDLGLDMATFEADLKDPTVAER 173

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++       +   +  TP  F+ G       +    +  ID+ +  
Sbjct: 174 VERDFNEGID-LGVQGTPTLFLDGVQLPAMPTYEELTGRIDAALAR 218


>gi|226303668|ref|YP_002763626.1| oxidoreductase [Rhodococcus erythropolis PR4]
 gi|226182783|dbj|BAH30887.1| putative oxidoreductase [Rhodococcus erythropolis PR4]
          Length = 218

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 76/227 (33%), Gaps = 10/227 (4%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           MS + + +   ++ LF  +   +        +    D      A+L      +       
Sbjct: 1   MSRS-MKISAALIALFAVALITFITVDPIRADNESTDRAAQSTAVLTDDAYRLTS----A 55

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            D  V +VE+    C  C   +    +    +     ++ + +R FP+ S +   +    
Sbjct: 56  ADDKVNLVEFLDFECEACLALYPTMERI---RAEYEDRITFGIRYFPIPSHTNSTLAAQV 112

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQNILD 181
                  G +      ++  Q  W  S   ++AL  + A+  G     F++ L+ + + +
Sbjct: 113 VESASRQGKFVEMYQRMYETQSQWGESAESQEALFRSYAQDLGLDMTRFESDLSSRGVRE 172

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            ++       +   +  TP  F+         S       IDS ++ 
Sbjct: 173 RVERDFNEG-KRLGVQGTPTLFLNDVKLAQMPSYEDLKAQIDSALEQ 218


>gi|268590399|ref|ZP_06124620.1| suppressor [Providencia rettgeri DSM 1131]
 gi|291314312|gb|EFE54765.1| suppressor [Providencia rettgeri DSM 1131]
          Length = 243

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 63/207 (30%), Gaps = 13/207 (6%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +   E          +A   A  +      IG+KDA + +V +    C  C  F
Sbjct: 50  AIVALQAKQGEKQQAQMKETLKAEHDALFNDPTSPRIGKKDAKLVLVNFTDFNCPFCKRF 109

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
             +    ++        +  +++  P    +++          + D   +  +   F ++
Sbjct: 110 DPQLMDIVKKY---PNDVAVVIKYLPFKGQTSMDSAQLTMTLWQEDPKAFEALHHKFMQK 166

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
              ++  N +DAL              D         D I+     A E   ++ TP   
Sbjct: 167 QGMLSDANIKDALKATGN---------DKLKASDKSRDGIRTNMILA-EKLGVNGTPATL 216

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDST 230
           +G  +  G +    F  ++   +    
Sbjct: 217 VGDEMIPGAIDAQQFEAVVKEQLAKLK 243


>gi|322433276|ref|YP_004210497.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
 gi|321165668|gb|ADW71370.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
          Length = 178

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 58/175 (33%), Gaps = 8/175 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P + +D   G   A  ++VEY    C  C E              +   +        + 
Sbjct: 7   PVSTQDHLQGDPHAACSLVEYGDYECPSCGEVQPIIQSLQRHFGNQMSFVFRNFPLREIH 66

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
             +  A  +A  A  +    +W   +LLF  Q+D          L  +    G S+    
Sbjct: 67  PWAEAAAEVAELAGSQG--KFWEMHNLLFQHQEDLS-----EGGLQQLVSRMGLSEKKMQ 119

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
               +  +   I+A          ++ TP FF+ G+   G       + ++D ++
Sbjct: 120 QASMNGMLRKKIEADLAGGI-RSGVNGTPTFFLNGDRCDGPTDFNSLASLMDQVL 173


>gi|209964257|ref|YP_002297172.1| dsba oxidoreductase, putative [Rhodospirillum centenum SW]
 gi|209957723|gb|ACI98359.1| dsba oxidoreductase, putative [Rhodospirillum centenum SW]
          Length = 252

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 72/209 (34%), Gaps = 11/209 (5%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                     +      V   R+      ++     +G     + +VE+    C +C   
Sbjct: 53  AVQALEKKQQDESAAATVEAIRSNREQLTASKASPVLGNPKGDLVLVEFFDYQCGYCKHS 112

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
             +    L++      K++ +L+EFP+    +V    A  A +  D           ++ 
Sbjct: 113 QPERNAALKEDG----KVKLVLKEFPILGPGSVVATKAALAARAQDR------YAPLHEA 162

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
                 +   + ++ +A+ AG         +  +++  +I A    A +   I  TP F 
Sbjct: 163 LMQHQGRLDEETVMQIAEKAGLDMAKLRKDMESESVQAEIDANLALARQ-LGIQGTPAFV 221

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           IG  L  G + +  F ++  +    +  +
Sbjct: 222 IGDTLVPGAIEKDTFLELFKNARAAAKEK 250


>gi|116326879|ref|YP_796599.1| protein-disulfide isomerase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116119623|gb|ABJ77666.1| Protein-disulfide isomerase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 406

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 72/235 (30%), Gaps = 15/235 (6%)

Query: 8   IGVLGGIVLLF----IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           I +L   VL      I+        GSA  E  IP+ + +F               +G  
Sbjct: 174 IVILSFFVLGLYGGRISMGGTRLVSGSADGEKSIPEQLKEFETAQTVQIDLKDVPILGDL 233

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +AP+T+V+YA   C HC        K   ++Y    K+ Y       +    V       
Sbjct: 234 NAPITIVKYADFNCGHCMHTSK-ILKSFLNEYEGIIKVAYKNFPLDGNCNRLVGRKSPEA 292

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF-------SKNDFDTCLND 176
           +                          +    +++ A              + F  C++ 
Sbjct: 293 SSCIAASAALCANQQNKFYPVYTGLYDDNEAGVMHTAATVTRLAEKSGLKMDQFRACMSS 352

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL--GDMSEGVFSKIIDSMIQDS 229
             I D I      A E   I+STP  FI    +   G        ++I  +I  S
Sbjct: 353 TKIRDHINREVDEA-EKLKINSTPTLFINNKPFPKSGTPDVDFLRRLIYQLINQS 406


>gi|296130255|ref|YP_003637505.1| DSBA oxidoreductase [Cellulomonas flavigena DSM 20109]
 gi|296022070|gb|ADG75306.1| DSBA oxidoreductase [Cellulomonas flavigena DSM 20109]
          Length = 172

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/178 (19%), Positives = 61/178 (34%), Gaps = 10/178 (5%)

Query: 48  LAASPSTMKD-VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR 106
                 T  D   +G  DAPVT+V+Y  + C +C +      + +E+   +   +     
Sbjct: 3   TDEPVLTDPDRHVLGDPDAPVTVVQYGDLECPYCRDAEPVLRRLVEESDGRVRLVWRHFP 62

Query: 107 EFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFS 166
            F L   +  A +    A       +W    LL+  QD         D L   A+  G  
Sbjct: 63  LFQLHPHALAAALAVEAAGAHG--RFWEMQRLLYAHQDALT-----DDDLARYARELGLD 115

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
             +      D      ++A  +   E   +  TP   + G  Y G +       ++D+
Sbjct: 116 PEEVVGEPAD-RFARAVQADYEGGIE-LDVPGTPTLLVDGVPYRGRIELEALRAVVDA 171


>gi|86607424|ref|YP_476187.1| DSBA thioredoxin domain-containing protein [Synechococcus sp.
           JA-3-3Ab]
 gi|86555966|gb|ABD00924.1| DSBA thioredoxin domain protein [Synechococcus sp. JA-3-3Ab]
          Length = 264

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 59/178 (33%), Gaps = 8/178 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
                       +G     + +VE++   C  CA  H+   +++ +   +   +   L  
Sbjct: 91  ENPRAVIGDSPQLGSDALRLVLVEFSDFQCPFCARAHDTLKQFMAEHGNEVTLVYKHLPL 150

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
             +   +  A   A  A ++    +W F   LF  Q          +  +  A+  G + 
Sbjct: 151 TSIHPEAMAAARAAWAAHRQG--KFWEFHDELFANQSQLG-----DEFYVATAEKLGLNV 203

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
             F+     +     I+     AS+   I  TP F + G  + G     VF + +   
Sbjct: 204 EKFNRDRRSRAAERAIQRDMDLASQ-LGIGGTPHFILNGLSFSGAQPLEVFEQTLQQA 260


>gi|325277173|ref|ZP_08142817.1| outer membrane protein [Pseudomonas sp. TJI-51]
 gi|324097685|gb|EGB95887.1| outer membrane protein [Pseudomonas sp. TJI-51]
          Length = 214

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 75/230 (32%), Gaps = 18/230 (7%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           MS   I ++  I+     +   +     +++E   P   V    +   SP       IG 
Sbjct: 1   MSRRAIVLVISILTALGFTAAAFFYDRYSVSEETPPVAPVASSLVRFHSP------VIGT 54

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            +APVT+VE+   +C  C  F     + L D       +        +            
Sbjct: 55  ANAPVTIVEFFDPSCEACRAFFPVVKQILADNPNDVRLV-----LRYVLFHEGSETAARI 109

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
               R  G +   +  L   Q  W +S          A+ AG         +   +I + 
Sbjct: 110 LETARKQGVFEPVLEALMVAQPQW-HSDPLVQKAWEAAEAAGLDVEKARAEMMAGDITEA 168

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYL--GDMSEGVFSKIIDSMIQDST 230
           +K   + A +   +  TP FF+ G   L  G         ++ + ++ S 
Sbjct: 169 LKRDSQDA-QAAGVRQTPTFFVNGKPLLSFGAQP---LIDLVKAEVEQSK 214


>gi|329113342|ref|ZP_08242123.1| Putative protein-disulfide oxidoreductase [Acetobacter pomorum
           DM001]
 gi|326697167|gb|EGE48827.1| Putative protein-disulfide oxidoreductase [Acetobacter pomorum
           DM001]
          Length = 206

 Score = 89.7 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 83/224 (37%), Gaps = 20/224 (8%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           MS TR  +L    L   ++        +   +                  +      +G 
Sbjct: 1   MSFTRRSILAAGSLAVASTALRGISLAADATD------------------TRFTPRELGN 42

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            +A + + E+ S+TC HCA F   TF  ++ + I TGK+RY+  +FP D        +  
Sbjct: 43  PNAKIVVEEWFSLTCIHCAHFAENTFPQVQKELIDTGKIRYVFHDFPTDQ-LATVAAMVA 101

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                     +    L    +  +    N +D L  MA FAG   + F+  + DQ ++  
Sbjct: 102 RTLPPERYEPFCSSLLSSLDRWAYTKEGNPKDELKKMAAFAGMPGDTFEKAIADQQLMQF 161

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGN-LYLGDMSEGVFSKIIDSM 225
           I   +  A + F  DSTP F           ++   F+K +   
Sbjct: 162 ILNQQTEAQDKFHFDSTPTFRFNNKEQVSSALTYDDFAKYLAKA 205


>gi|86139719|ref|ZP_01058286.1| 27kDa outer membrane protein [Roseobacter sp. MED193]
 gi|85823610|gb|EAQ43818.1| 27kDa outer membrane protein [Roseobacter sp. MED193]
          Length = 243

 Score = 89.3 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 71/209 (33%), Gaps = 14/209 (6%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
           +     ++ +   EL     + D R L+   P+      +G  +  VT+VE+    C +C
Sbjct: 48  AVAILEQRQAQAQELSQAQVLNDQRDLIENDPNA---PVLGNAEGDVTVVEFFDYNCPYC 104

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
                +    +E+       +          SV      LA   + + +  +W       
Sbjct: 105 RRVKPEVRALIEEDPNIR-LVYREWPILGDGSVFAAKAALAARKQDKYEEFHWAM----- 158

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
                 +  +    ++L +A+  G         +    + + I    +  ++    + TP
Sbjct: 159 ----MGLEGRAEEASVLRVAEEIGLDIAQLRKDMEAPEVEEHIATSMQL-TQALGFNGTP 213

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            F IG  L  G + +   + +++   +D 
Sbjct: 214 SFVIGDALVPGFVEKAQLADLVEEARKDE 242


>gi|167461952|ref|ZP_02327041.1| disulfide dehydrogenase D [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322384658|ref|ZP_08058336.1| thiol-disulfide oxidoreductase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321150543|gb|EFX44024.1| thiol-disulfide oxidoreductase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 238

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 76/227 (33%), Gaps = 20/227 (8%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
              ++  L    L+ I          S        + +                  +G  
Sbjct: 27  RMRKVMWLTAFALIVIVFIAALAWPKSTKEASFNYENL----------------PVLGDP 70

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML-AR 122
           +APV +VE+    C  C  F+      ++  +I  GK+ +    + +    +    + A+
Sbjct: 71  NAPVKIVEFGDFKCPACMYFNQDVKPKIQKDFIDQGKVAFYFINYTIIGPDSETAAIAAQ 130

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN--MAKFAGFSKNDFDTCLNDQNIL 180
               +    YW +   ++  Q D   +    + L+     +      +     + ++  +
Sbjct: 131 SVFHQNKDEYWKYFESIYKNQQDENKTWATPEFLVELAKKEGIQVDYDKLKQDIENKTYV 190

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           +++K     A ++  ++STP  FI G          V  K I+  +Q
Sbjct: 191 NEVKEQYNVA-QNNKVNSTPTIFINGKQSKDLFKYEVVKKEIEDALQ 236


>gi|295841152|dbj|BAJ06962.1| disulfide isomerase [uncultured bacterium]
          Length = 197

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 4/177 (2%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           ++ ++VS+G   APVT++EY S+TC  C  FH   +  L+ +YI TG  R+I R FP   
Sbjct: 24  ASSEEVSLGSIQAPVTIIEYGSLTCGKCLSFHKYVYPELKKQYIDTGTARFIFRHFPTGE 83

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            +      A C        Y+  +  LF+  D W+ ++N     +  A     +   F T
Sbjct: 84  AAVYGARAANCTG----DKYYEMLDKLFSTTDTWVRAENREAIFVKYATSLELNSETFVT 139

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           C+ ++  LD+I   +K A ++  +  TP FFI G++  G+ S      +I   I  +
Sbjct: 140 CIRNEKHLDNILLQQKAARKELDVIGTPTFFINGSMVRGERSFPKMEALISEAINKA 196


>gi|240139210|ref|YP_002963685.1| hypothetical protein MexAM1_META1p2638 [Methylobacterium extorquens
           AM1]
 gi|240009182|gb|ACS40408.1| Conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 253

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/197 (13%), Positives = 60/197 (30%), Gaps = 8/197 (4%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
              E       V  R       ++  D  IG     VT+VE+    C +C +  +     
Sbjct: 59  RQQEAQKATQAVALREARGKLVNSANDYVIGNPAGDVTLVEFFDYNCPYCRKARSDVDAL 118

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           ++        L+         + ++   + A+          +       + +      +
Sbjct: 119 VKSDPKLRVVLKEFPVLGAASTDASRVAIAAKRGLPAGKLREF-------HDKLMETRGR 171

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
              +  L +AK  G         + D+ +   ++     A +   I  TP F +   +  
Sbjct: 172 ADGERALAVAKDFGLDPGKLRKDMQDEAVATVLRENAALA-DQLGITGTPAFVLNDGIIA 230

Query: 211 GDMSEGVFSKIIDSMIQ 227
           G +      + I ++ +
Sbjct: 231 GAVGVEALQRAIANIRE 247


>gi|229492854|ref|ZP_04386652.1| dsba oxidoreductase [Rhodococcus erythropolis SK121]
 gi|229320294|gb|EEN86117.1| dsba oxidoreductase [Rhodococcus erythropolis SK121]
          Length = 218

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 76/227 (33%), Gaps = 10/227 (4%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           MS + + +   ++ +F  +   +        +    D      A+L      +       
Sbjct: 1   MSRS-MKISSALIAVFAVALITFITVDPIRADNENADRAAQSTAVLTDDAYRLTS----A 55

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            D  V +VE+    C  C   +    +    +    G++ + +R FP+ S +   +    
Sbjct: 56  ADGKVNLVEFLDFECEACLALYPTMERI---RAEYEGRITFGIRYFPIPSHTNSTLAAQV 112

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQNILD 181
                  G +      ++  Q  W  S   ++AL  + A+  G     F++ L  + + +
Sbjct: 113 VESASRQGKFVEMYKQMYETQSQWGESAESQEALFRSYAQDLGLDMARFESDLGSRGVRE 172

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            ++   +       +  TP  F+         S       IDS + +
Sbjct: 173 RVERDFEEG-RRLGVQGTPTLFLNDVKLDQMPSYEQLKAQIDSALGE 218


>gi|161528163|ref|YP_001581989.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
 gi|160339464|gb|ABX12551.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
          Length = 219

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/189 (20%), Positives = 74/189 (39%), Gaps = 7/189 (3%)

Query: 42  VDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL 101
           V   A +          S+G  +AP+T++E+    C  C+E++ +T   L++KYI++G++
Sbjct: 32  VAEAARVDVENIKQYSHSLGNSNAPITIIEFGDFQCPFCSEWYKETAMPLKEKYIESGQV 91

Query: 102 RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAK 161
             +  ++P     +              G YW F  +L+  Q D  +     D + + A 
Sbjct: 92  ELVFVDYPFLGDDSYPTA-HASYCAEQQGMYWEFHEILYLNQGDTNDGWASADKIRDFAS 150

Query: 162 FAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG-----NLYLGDMSEG 216
                   +D C++       I    K   E   ++ TP F +           G     
Sbjct: 151 QINLDMEKYDECMSSSEFNQKIDQSLKLG-EVHEVNQTPTFIVVNERGEYQKIEGKQPLV 209

Query: 217 VFSKIIDSM 225
           VF +++  M
Sbjct: 210 VFEELMQKM 218


>gi|85374546|ref|YP_458608.1| protein-disulfide isomerase [Erythrobacter litoralis HTCC2594]
 gi|84787629|gb|ABC63811.1| protein-disulfide isomerase [Erythrobacter litoralis HTCC2594]
          Length = 256

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 76/214 (35%), Gaps = 19/214 (8%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
               +         +     + + ++   IG  DAP+ +VEY S+TC  CA F    F+ 
Sbjct: 40  EGEPVAEVPAPEGQQWADVTTVTDLQGHMIGNPDAPIKLVEYGSLTCGTCANFTQTGFEE 99

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVA-------------------VMLARCAEKRMDGG 131
           L  +YI TG++ + LR   L+ +  V                     M  +    +    
Sbjct: 100 LRSEYINTGRVSFELRPLVLNPLDLVMVNLARCSSDEAVVPLSEQVWMNFQEVMGQAQQA 159

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
              F   +   ++    +      LL+     G S++   TCL D   +  I     +  
Sbjct: 160 GQAFEQAIGLPEEQRYVAAAEATGLLDFFAARGLSRDQARTCLQDVEKVKAIAERSAQQG 219

Query: 192 EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           E+F +  TP FF+ GN      S      ++   
Sbjct: 220 EEFNVTGTPTFFVNGNKLADVYSWEALEPVLQRA 253


>gi|258542170|ref|YP_003187603.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633248|dbj|BAH99223.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636307|dbj|BAI02276.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639360|dbj|BAI05322.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642416|dbj|BAI08371.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645471|dbj|BAI11419.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648524|dbj|BAI14465.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651577|dbj|BAI17511.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654568|dbj|BAI20495.1| thiol:disulfide interchange protein [Acetobacter pasteurianus IFO
           3283-12]
          Length = 206

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 84/224 (37%), Gaps = 20/224 (8%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           MS TR  +L    L   ++        +   +                  +      +G 
Sbjct: 1   MSFTRRSILAAGSLAVASTALRGISLAADATD------------------TRFTPRELGN 42

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            +A + + E+ S+TC HCA F   TF  ++ + I TGK+RYI  +FP D        +  
Sbjct: 43  PNAKIVVEEWFSLTCIHCAHFAENTFPQVQKELIDTGKIRYIFHDFPTDQ-LATVAAMVA 101

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                     +    L    +  +I   + +D L  MA FAG   + F+  + DQ ++  
Sbjct: 102 RTLPPERYEPFCSSLLSSLDRWAYIKEGSPKDELKKMAAFAGMPGDTFEKAIADQQLMQF 161

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGN-LYLGDMSEGVFSKIIDSM 225
           I   +  A + F  DSTP F           +S   F+K +   
Sbjct: 162 ILNQQTEAQDKFHFDSTPTFRFNNKEQVSSALSYEDFTKYLAKA 205


>gi|322436094|ref|YP_004218306.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
 gi|321163821|gb|ADW69526.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX9]
          Length = 614

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 64/200 (32%), Gaps = 9/200 (4%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
            +   S    L   +        L A        + G   AP+T+VE+    C  C    
Sbjct: 212 ASTTPSIAPTLASGNDGTITDPTLLAQILAPTSPTQGPATAPLTIVEFTDFQCPFCRAA- 270

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
                  +    +  ++R+I R FPLD                  G +W    LLF  Q 
Sbjct: 271 --VAPMEQLMAARGQEVRWIFRAFPLDFHQFAEQSAEAALAAGEQGKFWPMHDLLFAHQS 328

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                      L   A+    +   FD  ++   +   + A +        +  TP F +
Sbjct: 329 ALTL-----ADLHTYAQQLNLNLPAFDEAMSTHRLAGQVAADRALGLRA-GVSGTPTFMV 382

Query: 205 GGNLYLGDMSEGVFSKIIDS 224
            G+L +G  S    + + D+
Sbjct: 383 DGHLMVGARSLTELAALADA 402



 Score = 66.6 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 39/158 (24%), Gaps = 9/158 (5%)

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T++ ++   C   A       K           L               A      A + 
Sbjct: 64  TLIVFSDFACPFSARTFFTLQKLSTRYPNSLHILYKQTPLPIHPDAPLAARAALAAARQN 123

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
                   +      QD            L+ A+        F    +   +   +    
Sbjct: 124 RYNAMAELLFANQTHQDLPT--------FLSFARQLHLDIPRFRRDYDSPAVAAQLATDL 175

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           +  S  F +  TP  F+ G L  G   E   + +ID  
Sbjct: 176 EE-SHAFGVIETPTSFLNGKLLSGLQDEPTLTALIDKA 212



 Score = 58.9 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 54/206 (26%), Gaps = 8/206 (3%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                                  A  A       + S GQ D P+T+  +  +     A 
Sbjct: 396 LAALADAHRNFAGIQNASARVPTAPAATHQVLGPEPSSGQPDTPITLTWFTDVRSPLAAH 455

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
                         +   L               +  L           +W         
Sbjct: 456 QAELLRTLTAHYEGRIRVLFKADPLVTHPDSRLASAALFAALALGGSDKFWPMFDA---- 511

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
                     R  LL +A     + + F+  L+     +D+ A ++ A+    I   PV 
Sbjct: 512 -LADRRDLLDRPKLLTIAAAMHLNASAFEKSLDQSE--NDVTADQQEATRR-GISGAPVL 567

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQD 228
           F+      G   E  ++ I+D  ++D
Sbjct: 568 FLNTERVDGLQREAFYTAILDRQLKD 593


>gi|197104047|ref|YP_002129424.1| hypothetical protein PHZ_c0581 [Phenylobacterium zucineum HLK1]
 gi|196477467|gb|ACG76995.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 214

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 77/189 (40%), Gaps = 5/189 (2%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
              LAA+     D+S+G   APV +VEY S+TC HCA F+   F  L+ KYI TG++R+ 
Sbjct: 29  PQALAAAEPAAGDISVGSPKAPVHVVEYLSVTCPHCAHFNADVFPTLKAKYIDTGQVRWT 88

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
            RE      +         A       Y   V  +   Q  W  S N +   L +A+  G
Sbjct: 89  FREMLTAPGNVA-AAGFLMARCAGPSKYVKVVDEVLRSQPRW-QSGNIKPIFLEIAQANG 146

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY--LGDMSEGVFSKII 222
            ++  F+ CL D    + ++     A +   +  TP FF+ G      G          I
Sbjct: 147 LTEAQFEACLTDPKGQEALQQRLMLA-QKDEVTGTPTFFVNGKRVGGPGVPDLADMEAAI 205

Query: 223 DSMIQDSTR 231
               +   R
Sbjct: 206 AQAAKGGRR 214


>gi|163848572|ref|YP_001636616.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222526507|ref|YP_002570978.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
 gi|163669861|gb|ABY36227.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|222450386|gb|ACM54652.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
          Length = 232

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 70/225 (31%), Gaps = 17/225 (7%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I V    V+         TR  + +     P G  +                 G  +A V
Sbjct: 24  IAVGVVAVIAITGLVVLLTRNNTEVKAPTAPVGRTEEGF-----------YYKGDPNAAV 72

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP-LDSVSTVAVMLARCAEK 126
            ++ +    C  CA F       LE  YI TG++++I  E P  +               
Sbjct: 73  KVIAFEDYQCPGCAYFSRNLAPILERDYINTGRVQFIYHELPLTNIHPNAVAAAEAARCA 132

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAG 186
              G YW     LF  Q  W    +  +     A   G  +  FD C+      +     
Sbjct: 133 GDQGKYWEMHDQLFANQSLWAQLSSPLNVFSGYAGRIGIDRAAFDACMQAGTHREA-ILA 191

Query: 187 KKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
             + +    + +TP F + G +             ID+ ++ + R
Sbjct: 192 AAQEAAALGVQATPSFSVNGQIVDSGR----LFTAIDAALRAAGR 232


>gi|209886445|ref|YP_002290302.1| twin-arginine translocation pathway signal [Oligotropha
           carboxidovorans OM5]
 gi|209874641|gb|ACI94437.1| twin-arginine translocation pathway signal [Oligotropha
           carboxidovorans OM5]
          Length = 241

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 67/215 (31%), Gaps = 10/215 (4%)

Query: 17  LFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD-VSIGQKDAPVTMVEYASM 75
           L        +   + +   P P    D             +   +G  D  VT+VE+   
Sbjct: 5   LLGLCAATLSLMLAVVAMAPPPASAQDDNVTSRERILRDPEIPPLGNPDGDVTIVEWFDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C     +  K +++      K+R +L+++P+    +     +R        G +  
Sbjct: 65  QCPYCKTLSPELEKIIKEDG----KVRLVLKDWPILGPPS--PEASRLVIAAKYQGKFEA 118

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
                  +   + S    +AL    K               +  +D + A     +E   
Sbjct: 119 AHKALMTRVGRLTSGTLEEAL---TKAGVDVARAKSDLEAHKADIDALLARNNEQAEALG 175

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            +STP F +G     G M   +F   I      + 
Sbjct: 176 FNSTPSFIVGTFRIPGVMKPELFKLAIADARAKAK 210


>gi|116329889|ref|YP_799607.1| protein-disulfide isomerase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116123578|gb|ABJ74849.1| Protein-disulfide isomerase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 406

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 72/235 (30%), Gaps = 15/235 (6%)

Query: 8   IGVLGGIVLLF----IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           I +L   VL      I+        GSA  E  IP+ + +F               +G  
Sbjct: 174 IVILSFFVLGLYGGRISMGGTRLVSGSADGEKSIPEQLKEFETAQTVQIDLKDVPILGDL 233

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +AP+T+V+YA   C HC        K   ++Y    K+ Y       +    V       
Sbjct: 234 NAPITIVKYADFNCGHCMHTSK-ILKSFLNEYEGIIKVAYKNFPLDGNCNRLVGRKSPEA 292

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF-------SKNDFDTCLND 176
           +                          +    +++ A              + F  C++ 
Sbjct: 293 SSCIAASAALCANQQNKFYPVYTGLYDDNEAGVMHTAATVTRLAEKSGLKMDQFRACMSS 352

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL--GDMSEGVFSKIIDSMIQDS 229
             I D I      A E   I+STP  F+    +   G        ++I  +I  S
Sbjct: 353 TKIRDHINREVDEA-EKLKINSTPTLFVNNKPFPKSGTPDVDFLRRLIYQLINQS 406


>gi|229194859|ref|ZP_04321643.1| disulfide bond formation protein D [Bacillus cereus m1293]
 gi|228588615|gb|EEK46649.1| disulfide bond formation protein D [Bacillus cereus m1293]
          Length = 197

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 68/173 (39%), Gaps = 6/173 (3%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST-VA 117
           S+G+ DAPV +VE+    C  C  +       L+++YI  GK++     FP     + + 
Sbjct: 28  SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSDLG 87

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLN 175
                   K+    +W F   ++  Q          + LLN+ K        + F   L+
Sbjct: 88  AAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVDQFKKDLH 147

Query: 176 DQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            + I + ++    RA +   +   P  +I GNL   +       K ID  ++ 
Sbjct: 148 SKEIKEKVRKDSDRA-QKLKVQGAPSVYINGNL--ANPDFDSMKKAIDKELKK 197


>gi|71279308|ref|YP_269413.1| dsbA-like thioredoxin domain-containing protein [Colwellia
           psychrerythraea 34H]
 gi|71145048|gb|AAZ25521.1| dsbA-like thioredoxin domain protein [Colwellia psychrerythraea
           34H]
          Length = 213

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 67/227 (29%), Gaps = 15/227 (6%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M+   I +     +  I        K    + +               +   +   S G 
Sbjct: 1   MNNKTIFISVAAFIGVIFIAAVGVYKSQQPSTVASEQ---------LPALERIGAPSKGG 51

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
           K A VT+VE+    C  C++F+      ++    K   +             +  V+   
Sbjct: 52  KQAKVTIVEFFDPACGTCSQFYPLINNLVKKYQGKVNVVMRYAPLHK----GSDNVVKML 107

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A       +     L  N+Q    +  +     L   K      +  DT     NI   
Sbjct: 108 EAAHLQGEFWPALELLFANQQRWVEHHVSNPTRALAGIKTLNVDHDQLDTDWQSSNIAKI 167

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           I    K   +   + +TP FF+ G   +          +++  + ++
Sbjct: 168 IAQDIKDG-QTLKVRATPQFFVNGKPLV-VFGYEELVYLVEEAVAEA 212


>gi|86739626|ref|YP_480026.1| DSBA oxidoreductase [Frankia sp. CcI3]
 gi|86566488|gb|ABD10297.1| DSBA oxidoreductase [Frankia sp. CcI3]
          Length = 270

 Score = 89.3 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 59/193 (30%), Gaps = 4/193 (2%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
            +           L A++  T   + +G+  APVT+  Y    C  C      T   +  
Sbjct: 80  AVQNSREESKPVVLPASATGTDHGIVVGKASAPVTVDLYEDFQCPICGTLEKTTGPTIGK 139

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
                     I                   A    +G +     +L+  Q +        
Sbjct: 140 LLDDGK--IKIDYHMMSFIGPESKRAANAAAAAANEGRFRQLHDVLYANQPEERTGGFTN 197

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
           D L+ +   AG +   +   +N+      +    + AS+   +  TP  F+ G    G+ 
Sbjct: 198 DTLITLGAKAGLTSQAYRKAVNEGTYDGYVAKVDEDASKA-GVTGTPTVFVNGKRLSGEQ 256

Query: 214 -SEGVFSKIIDSM 225
            +   F   +D+ 
Sbjct: 257 LTPEGFRAAVDAA 269


>gi|292655399|ref|YP_003535296.1| DSBA-like thioredoxin domain [Haloferax volcanii DS2]
 gi|291372167|gb|ADE04394.1| DSBA-like thioredoxin domain, putative [Haloferax volcanii DS2]
          Length = 227

 Score = 88.9 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 70/230 (30%), Gaps = 9/230 (3%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR   L                 G +          +        + S++    IG 
Sbjct: 1   MRNTRRAYLAATAGALTLGTA-GCLGGGSGGSGNDAVAAIGCEVPERDTVSSLPTPVIGS 59

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV---- 118
           +DA V +  +    C HCA F       L  +Y+  G +RY   +FP+      +     
Sbjct: 60  EDASVVVDVWEDFACPHCATFAVDVAPQLRSEYVSEGIVRYRHHDFPIPVDEWWSWKGAS 119

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR--DALLNMAKFAGFSKNDFDTCLND 176
                 ++  D  ++ F   L+  Q ++           L ++A  A           + 
Sbjct: 120 AARAVQDEADDETFFDFAHTLYENQSEFGGGDAEGSLSTLQSLAADADLDGCSVAAAASR 179

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +     ++A +  A ++     TP   I G             + +++  
Sbjct: 180 ERYRPLVEAERTEAVDERGFQGTPTVLIDGEQV--APRWSDLQRAVENAR 227


>gi|320334352|ref|YP_004171063.1| DSBA oxidoreductase [Deinococcus maricopensis DSM 21211]
 gi|319755641|gb|ADV67398.1| DSBA oxidoreductase [Deinococcus maricopensis DSM 21211]
          Length = 230

 Score = 88.9 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 24/231 (10%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           +  R+ +L G V+  +        +    N                 +        +G+ 
Sbjct: 13  NANRMALLIGTVIAAVLIALALFTRHGNGNTQAQ-------------TFDLTGRPVLGRA 59

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL--------DSVST 115
           DAPVTM+ +    C  C  F  +    L+ KYI TGK++ +   +P         D  ST
Sbjct: 60  DAPVTMIVFEDYKCPVCKGFDEEDLPTLKSKYIDTGKVKMVAMAYPFLAQNFGLSDDDST 119

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCL 174
            A + A+C  ++    +W +   LF  Q D        +AL ++A          F+TCL
Sbjct: 120 RASVAAKCMARQGTEKFWAYHHALFRGQQDEKTVWATEEALQDLAGTIDGVDTAAFNTCL 179

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            DQ  L ++   K +  +   ++ TP  ++ G     +       + I+  
Sbjct: 180 KDQATLKEVNDDKAQGDKA-GVNGTPSVYVNGRYIA-NFHADALGQAIEDA 228


>gi|291445961|ref|ZP_06585351.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291348908|gb|EFE75812.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 240

 Score = 88.9 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 48/217 (22%), Positives = 74/217 (34%), Gaps = 11/217 (5%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP--------STMKDVSIG 61
           V+    LL  ASY       +       P   V         P             ++IG
Sbjct: 2   VVVAAGLLGFASYKATAPDTAKDTTATGPAAEVSADPDAGVYPELAKLARRDADDKLAIG 61

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             DAPV ++EYA   C +C +F   T   L +KY+K G LR   R FP+    +      
Sbjct: 62  PADAPVVLIEYADFKCGYCGKFARDTEPELIEKYVKDGTLRIEWRNFPIFGEESENAARG 121

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
             A  + +  +    +       +    K+   AL    +      + F   L+      
Sbjct: 122 AWAAGQQNRFWEFHRAAYAEGAKEKGFGKDRVKALA--EEAGVKDLDRFMKDLDGDAARA 179

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
            +K  +++A       STP F I G    G   +  F
Sbjct: 180 SVKKDQEQAY-GIGATSTPSFLINGRPIAGAQPDETF 215


>gi|262202544|ref|YP_003273752.1| DSBA oxidoreductase [Gordonia bronchialis DSM 43247]
 gi|262085891|gb|ACY21859.1| DSBA oxidoreductase [Gordonia bronchialis DSM 43247]
          Length = 214

 Score = 88.9 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/227 (12%), Positives = 59/227 (25%), Gaps = 13/227 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +    R+ +    V     +  F   +     +      +         S          
Sbjct: 1   MSRNVRMSLAAVFVFCLALTVVFVVSRAGESEQSGDQASMTARPDSPRLSA--------- 51

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             ++  T VE+    C  C   +    +  +    +   + +++R FPL           
Sbjct: 52  PAESKATFVEFLDFECEGCGAAYPAVEQLRQTYGDQ---VTFVVRYFPLPGHFNADRAAR 108

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
             A     G +      +F+ Q  W   +   D L            +      D     
Sbjct: 109 AVAAAAEQGQFEPMYRKMFDTQRSWGEQRVPLDDLFFSYARELGLNMERFAAAYDSQATR 168

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++        +   +  TP FFI              S  ++S I+ 
Sbjct: 169 ELIDRDVADGKALGVTGTPTFFINDERIK-PEGYDDLSSALESAIRQ 214


>gi|239982296|ref|ZP_04704820.1| hypothetical protein SalbJ_22889 [Streptomyces albus J1074]
          Length = 194

 Score = 88.9 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 59/164 (35%), Gaps = 1/164 (0%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
              +++G  DAPV M+EY+   C +C  F  +T   L  + ++ G LR   R FPL    
Sbjct: 5   GDPMAVGDVDAPVVMIEYSDFQCPYCGRFARETKPALLREQVEEGVLRIEWRNFPLFGEE 64

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
           +    LA  A  +    +          +     + + +  +    K        F   L
Sbjct: 65  SERAALAAWAAGQQGKFWEFHDLAYAEPRKRNSGAFSEKAVVDMAEKAGVGDLEQFRKDL 124

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
                   ++  ++  S    + STP F + G   LG      F
Sbjct: 125 GGAEGRAALERDQQEGS-GLGVSSTPAFLVNGEPILGAQPGSTF 167


>gi|86136659|ref|ZP_01055238.1| 27 kDa outer membrane protein, putative [Roseobacter sp. MED193]
 gi|85827533|gb|EAQ47729.1| 27 kDa outer membrane protein, putative [Roseobacter sp. MED193]
          Length = 256

 Score = 88.9 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 64/201 (31%), Gaps = 8/201 (3%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
                      V    A L    +       G  D  +T+VE+    C +C +   +  K
Sbjct: 64  QQQATDEATRDVAMVAANLEELHNDGYSWVGGNPDGDITLVEFMDYRCGYCRKAAPEVAK 123

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            L+        ++           ++   +  +                  ++    + S
Sbjct: 124 LLQADGNIRLIVKEFPILGEASLFASRFAVATKQVAGND-------AYKQVHEALIEMTS 176

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
           +     +  +A       +     ++ + + D+++  +  A ++ AI  TP F +G  L 
Sbjct: 177 ELNEVTMRRLANGLSLDADAIWEAMDSEAVTDELRRTRALA-QNLAISGTPTFVLGNQLL 235

Query: 210 LGDMSEGVFSKIIDSMIQDST 230
            G +       I+D   ++++
Sbjct: 236 RGYLPADQLKIIVDEQREENS 256


>gi|295394315|ref|ZP_06804542.1| possible disulfide bond formation protein [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294972838|gb|EFG48686.1| possible disulfide bond formation protein [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 261

 Score = 88.9 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 64/210 (30%), Gaps = 2/210 (0%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
               G++  +                   T    +IG  +A V + E+    C  CA FH
Sbjct: 52  GATSGASSEDHANNGAQASGNEGEWVRRDTEDSAAIGDVNASVVITEWTDPRCPFCAHFH 111

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
           N     L+ KY+ TGK+R+           +     A  A  +         +L     +
Sbjct: 112 NDILPELKKKYVDTGKVRFEFITVAFFGEQSAVAGAAMEAAGKQGKYREFSDALYAAAPE 171

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                      +             F   +ND  ++D +      A + + I + P F  
Sbjct: 172 KGHPDLPEETLVKFAKTAGVEDIEQFRKDMNDSELIDAVGEATVTAQQYYGIQAVPFFAA 231

Query: 205 -GGN-LYLGDMSEGVFSKIIDSMIQDSTRR 232
             G     G      FS+ ID  +  +  +
Sbjct: 232 SDGESALRGAQPVENFSEFIDEQLSKAGAQ 261


>gi|311692983|gb|ADP95856.1| DSBA oxidoreductase [marine bacterium HP15]
          Length = 212

 Score = 88.9 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 66/223 (29%), Gaps = 15/223 (6%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR  V   ++   +     +              G+ +   +            IG +D
Sbjct: 2   RTRTLVTSLVLFCLVVFAAAFVYY-------DRSQGIDEPAVVEKTPLVRDYSPVIGPED 54

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+   +C  C   H    +           +        +         +    
Sbjct: 55  APVTIVEFFDPSCEGCRAMHPYVKQIQAAYPDNVRLV-----LRYVLFHKGSEEAVRILE 109

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             R  G Y   +  +   Q  W +      A  + A+ AG         +N Q I   I+
Sbjct: 110 TAREQGIYEPVLDAVMEAQPQW-HDDPKVAAAWDAAESAGLDLEAARAGMNSQEIDRIIQ 168

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                  +   I  TP F++ G+     +       ++ S ++
Sbjct: 169 QDAAD-VKAVGISGTPTFYVNGDTLS-RLGPQELYDLVTSKVE 209


>gi|148557585|ref|YP_001265167.1| protein-disulfide isomerase-like protein [Sphingomonas wittichii
           RW1]
 gi|148502775|gb|ABQ71029.1| Protein-disulfide isomerase-like protein [Sphingomonas wittichii
           RW1]
          Length = 241

 Score = 88.5 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 37/241 (15%), Positives = 67/241 (27%), Gaps = 18/241 (7%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
              I V   + L  ++         +                L   S +    + +G   
Sbjct: 1   MISILVRAALSLALLSPAALVAATPAKPAVAAKSGVAAKKNWLAMTSRTAEGAIVVGNPA 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A V +VEY S+TC HCA+   ++   L+  YI  G + + +R    D     A +L RC 
Sbjct: 61  AKVKLVEYLSLTCPHCADLSTQSMPALQRDYIAKGLVSFEVRHAVRDGYDFAASLLLRCE 120

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNY------------------RDALLNMAKFAGFS 166
                      +        +   +                                G +
Sbjct: 121 PPTRYLESLEALFATQGNWMEKALTAKDIPGFDGKSGDEKMAAVAKAAGFDAFFAKRGVT 180

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
              +  C+ D    + +      A +   I  TP+  I G              +I   +
Sbjct: 181 PKAYAACMADTKAKEQLGQMAGYAWQRDQIPGTPLVLINGQRQEAVHGWADLEPLIRGAL 240

Query: 227 Q 227
           +
Sbjct: 241 K 241


>gi|83952895|ref|ZP_00961624.1| dsbA-like thioredoxin domain protein [Roseovarius nubinhibens ISM]
 gi|83835686|gb|EAP74986.1| dsbA-like thioredoxin domain protein [Roseovarius nubinhibens ISM]
          Length = 219

 Score = 88.5 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 66/223 (29%), Gaps = 8/223 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R G++  ++ L +A +   T   +    L   + V    A     P +     +G  +
Sbjct: 1   MNRRGLILSVLALGVAGFGGATWFATRPGPLAEAEPVAPELADAMIRPYS---PILGPAE 57

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+    C  C  FH      + +       +            +     +    
Sbjct: 58  APVTIVEFFDPACEACRAFHPIVKDIMAEHGDAVRVVIRYTPF----HGAASEEAIRVLE 113

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             RM   Y   +  +  +Q  W         L+           D          +  I 
Sbjct: 114 TARMQDVYVPVLEAVLREQPRWAAHGAPEPGLILQIAATAGLDADAARTQMLAPDVVAIL 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
              +   E   I  TP FF+ G        E    +++ + + 
Sbjct: 174 NQDRADVETVGIRQTPTFFVNGTPLD-PFGEAELRRLVAAEVA 215


>gi|84499303|ref|ZP_00997591.1| dsbA-like thioredoxin domain protein [Oceanicola batsensis
           HTCC2597]
 gi|84392447|gb|EAQ04658.1| dsbA-like thioredoxin domain protein [Oceanicola batsensis
           HTCC2597]
          Length = 217

 Score = 88.5 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 64/222 (28%), Gaps = 13/222 (5%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           I  +  + L+  A   ++  +  A  E   P+                    +G+++APV
Sbjct: 7   ILSILALALVLFAGAAWFVSRSDAGAETVPPEVAEAL--------VRPWSPVLGREEAPV 58

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T+VE+    C  C  FH      + +       +                V +      R
Sbjct: 59  TIVEFFDPACEACRAFHPIVKDIMAEHGDAVRVVVRYTPFHGKI----SEVAIRVLEAAR 114

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
           M G +   +  L  +Q  W +    R  L+                      +  +    
Sbjct: 115 MQGVFEPVMDALMREQPRWASHGGMRPDLIMPIAGEAGLDVAAAETQIRAPDIVAVLNRD 174

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +   E   +  TP FF+          E     ++   ++ +
Sbjct: 175 RSDVEAVGVRQTPTFFVNERPLE-PFGEAELRALVAEEVRRA 215


>gi|317492668|ref|ZP_07951095.1| DSBA thioredoxin domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316919418|gb|EFV40750.1| DSBA thioredoxin domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 247

 Score = 88.5 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/207 (12%), Positives = 65/207 (31%), Gaps = 14/207 (6%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                     E               A  +      IG K+A +T+V +    C +C +F
Sbjct: 54  AVAAWQQQSAEQAGAQLGKVIEQNKDALFNDAASPRIGAKNAKLTLVSFTDYNCPYCKQF 113

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
             +  K ++        +  +++  P    ++ +         + +   +  +      +
Sbjct: 114 DPQLEKIVKKYP----DVAVVIKLLPFKGETSQSSAQYALTLWQQNPARFEALHQRLMSK 169

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
             +    +   AL +                 D   LD++++  + A +   +  TP   
Sbjct: 170 KGYHTEDSIASALKSTGNATLKV---------DDKTLDEVRSSLRLA-DILGVQGTPATL 219

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDST 230
           +G  +  G +S     ++I + +   +
Sbjct: 220 VGNQMIPGAISYEDLEQLIKAELARKS 246


>gi|319950808|ref|ZP_08024694.1| hypothetical protein ES5_14423 [Dietzia cinnamea P4]
 gi|319435522|gb|EFV90756.1| hypothetical protein ES5_14423 [Dietzia cinnamea P4]
          Length = 228

 Score = 88.5 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 67/212 (31%), Gaps = 4/212 (1%)

Query: 19  IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDV-SIGQKDAPVTMVEYASMTC 77
            A +       SA       + V        A      D  ++G  DAPV +V ++   C
Sbjct: 18  AAMWRTSFGGESATAAGQDSEQVQQQPDYSHAERRDPADPFALGPVDAPVGLVVFSDYQC 77

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS 137
             CA++   T   + D+         I                           +W +  
Sbjct: 78  PFCAQWSRDTLPSMVDRAEIGDL--RIEWRDVNVYGPDSRRAALASFAAAAQDRFWDYHD 135

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
            LF         +  R+ L+ +A   G   + F   +      ++I   ++   +     
Sbjct: 136 ALFADGRIRSGDELSREGLVALAGDLGLDTDRFAADMTSPAAEEEIARNEQLGID-HGAM 194

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +TPVF +GG   +G     VF +   S +  S
Sbjct: 195 ATPVFLLGGKPLVGAQPPEVFLEAYQSALDSS 226


>gi|54027690|ref|YP_121931.1| hypothetical protein pnf1420 [Nocardia farcinica IFM 10152]
 gi|54019198|dbj|BAD60567.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 225

 Score = 88.5 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 39/210 (18%), Positives = 65/210 (30%), Gaps = 6/210 (2%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI-GQ 62
           S +R   L   V+  +          +A  +   P   V+      A         + G 
Sbjct: 5   SVSRRTRLLTTVIAVLVIVVGAVVLAAARTDDNRPGNSVESTTGEPALAVRPDSHRLSGP 64

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            DA VT+VE+    C  C        +    +   + ++ +++R FP+ S          
Sbjct: 65  TDARVTLVEFLDFECEACRAMFPIMEQL---RADYSDRVAFVVRYFPIPSHFNSGRAARA 121

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWI-NSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                  G +      LF  Q DW        +    +A   G     +D   ND     
Sbjct: 122 AQAAADQGRFEQMYQRLFETQADWGEQRAPADEVFRGLAAELGLDLGAYDLAYNDPATAA 181

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLG 211
            ++A          +  TP FF+ G    G
Sbjct: 182 RVRADFDEGL-ALGVVGTPSFFLNGEKISG 210


>gi|83593763|ref|YP_427515.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
 gi|83576677|gb|ABC23228.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
          Length = 255

 Score = 88.5 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 23/204 (11%), Positives = 53/204 (25%), Gaps = 11/204 (5%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +              + L     S     ++G     VT++E++   C +C   
Sbjct: 61  AVQALQAKDEAEASAQQARAIKDLGPLLHSPEGLPALGNPKGDVTVIEFSDYNCGYCKRV 120

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
               +  +E        +              +    +  A +             F+K 
Sbjct: 121 FPVLWDEVEADGQIKLYVM----------EYPILGAESVMAARAALAAIGQDKYAEFHKA 170

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
                 K   +A+  +A+  G       T +  + +   +    +   +   I  TP F 
Sbjct: 171 LMAHKGKFTEEAIAGIARAQGLDAAKLKTAMAGKEVDAALARSFQIG-QALGISGTPAFI 229

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQ 227
           +   L  G +       ++     
Sbjct: 230 VADRLVPGALDPATLKALVKEARS 253


>gi|320009572|gb|ADW04422.1| DSBA oxidoreductase [Streptomyces flavogriseus ATCC 33331]
          Length = 263

 Score = 88.5 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 71/222 (31%), Gaps = 14/222 (6%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP-----------STMKDV 58
           V+ G V++  A    +    +   +           A                       
Sbjct: 25  VIFGAVVVLAAGLLGFVSYRATAPDGSASGTPAAVTATEEDPEVYRELAGLARRDAGDKQ 84

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           + G+ DAPV ++EYA   C +C +F   T   L  +Y+  G LR   R FP+   ++ A 
Sbjct: 85  AQGRTDAPVVLIEYADFQCGYCGKFARDTEPELIKRYVDDGTLRIEWRNFPIFGDASEAA 144

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQN 178
             A  A  R    +    +       +    K    AL   A       + F        
Sbjct: 145 ARASWAAGRQGRFWAFHRAAYAEDAKEKGFGKGRLRALARQAGVKDL--DRFTRDAGSAA 202

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
             + +   ++ A       STP F + G    G     VF++
Sbjct: 203 ATEAVGVDRQEAY-RIGATSTPSFLVNGRPLAGAQPTAVFTQ 243


>gi|212703777|ref|ZP_03311905.1| hypothetical protein DESPIG_01825 [Desulfovibrio piger ATCC 29098]
 gi|212672745|gb|EEB33228.1| hypothetical protein DESPIG_01825 [Desulfovibrio piger ATCC 29098]
          Length = 271

 Score = 88.5 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 26/208 (12%), Positives = 60/208 (28%), Gaps = 4/208 (1%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                  +            + +       S       G   APV +V ++  TC +C +
Sbjct: 68  IAQAGANARRKAALEAQWHKEVKNTPQKQISLAGRPVKGNAAAPVRIVAFSDFTCHYCQQ 127

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
             +   + ++        +   +           A         + +   W F   ++  
Sbjct: 128 ATHVLDEIMKKYGKNVSLVYKHMPLDEQGPGMLAAR-YFVAVAAQSESKAWKFYDAMYAD 186

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           +D  +         ++                   +    I A     ++   ID TP F
Sbjct: 187 RDRLLLEG---QKFVDEVCDKLGLDKARLQKDASSDKTARIIAQDLDDAKKLKIDGTPCF 243

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            + G +  G +SE +F   +D+ ++ + 
Sbjct: 244 LVNGLMVRGALSEPLFEAAVDTALEAAR 271


>gi|254389965|ref|ZP_05005187.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|197703674|gb|EDY49486.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
          Length = 225

 Score = 88.5 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 69/177 (38%), Gaps = 3/177 (1%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
                +++G+ DAPV ++EYA   C  C +F   T   L +KY+ +G LR   R FP+  
Sbjct: 8   DAADPLAVGRADAPVVLIEYADFKCGFCGKFARDTEPGLIEKYVDSGVLRIEWRNFPIFG 67

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             + A   A  A  R    +    +   +   +    +     L    +      + F  
Sbjct: 68  AESEAAARAAWAAGRQGRFWQFHAAAYADGSKEKGFGEERLKELA--EEAGVKDADRFAR 125

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            L+       ++  ++ A +     STP F + G    G      F++ I++  + +
Sbjct: 126 DLDSAEAKAAVRKDQEEAYQ-LGASSTPSFLVNGRPIAGAQPMETFTEAIEAAHRAA 181


>gi|86608307|ref|YP_477069.1| DSBA thioredoxin domain-containing protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556849|gb|ABD01806.1| DSBA thioredoxin domain protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 264

 Score = 88.5 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 59/178 (33%), Gaps = 8/178 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
                       +G     + +VE++   C  CA  H+   +++ D   +   +   L  
Sbjct: 91  ENPRAVIGDSPRLGSDALRLVLVEFSDFQCPFCARAHSTLKQFMADHGDEVTLVYKHLPL 150

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
             +   +  A   A  A+++    +W F   LF  Q             +  A+  G + 
Sbjct: 151 TSIHPEAMSAARAAWAAQRQG--KFWEFHDELFANQSQLG-----DGFYVATAEKLGLNI 203

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
             F+     +     I+     AS+   I  TP F + G  + G     VF + +   
Sbjct: 204 EKFNRDRRSRAAERAIQRDIDLASQ-LGIGGTPHFILNGIAFSGAQPLEVFEQTLQQA 260


>gi|300777598|ref|ZP_07087456.1| thioredoxin domain protein [Chryseobacterium gleum ATCC 35910]
 gi|300503108|gb|EFK34248.1| thioredoxin domain protein [Chryseobacterium gleum ATCC 35910]
          Length = 172

 Score = 88.1 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 62/174 (35%), Gaps = 10/174 (5%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
              +  D + G  DA + +VEY    C +C   +    + +++   +   +        +
Sbjct: 5   PSVSNADHTQGNSDASLVIVEYGDYQCPYCGAAYPVLKELMKEFGNQIRFVFRNFPLSEM 64

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
              +  A + A  A  +    +W     ++  Q+            L +A+  G +   F
Sbjct: 65  HQYARTAALAAEAAALQG--KFWEMHDAIYENQEYLNADLP-----LKLAEKLGLNIPQF 117

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
              ++ + + + +    +       ++ TP FFI GN + G        +++  
Sbjct: 118 KADIHKKELAEKVDTDFESGI-ISGVNGTPSFFINGNKFNG--GAEDLFQLVRE 168


>gi|99034733|ref|ZP_01314664.1| hypothetical protein Wendoof_01000524 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 234

 Score = 88.1 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 64/241 (26%), Positives = 102/241 (42%), Gaps = 22/241 (9%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           M+       +L  ++ + + SY    +  S    +      +    LL+  P+   D  +
Sbjct: 1   MIFR-----LLFLLIFISVNSYAVVKQDLSDNQYIQKKTNEITSNELLSPLPN---DKLL 52

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD         
Sbjct: 53  GDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGL--KAA 110

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNI 179
                      Y+ F   +FN  D W          L  +A  +   ++ F+ C+ND+ I
Sbjct: 111 MLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKI 170

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFI-----------GGNLYLGDMSEGVFSKIIDSMIQD 228
           +D I   K  A     I +TP+FFI               + G      F+ +ID +   
Sbjct: 171 MDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGK 230

Query: 229 S 229
           +
Sbjct: 231 A 231


>gi|94984799|ref|YP_604163.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
 gi|94555080|gb|ABF44994.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
          Length = 228

 Score = 88.1 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 67/183 (36%), Gaps = 12/183 (6%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
                  +GQ++APVT+V +    C +C  F  +    L  KYI TGK + I   FP  +
Sbjct: 46  DLTGQPVLGQENAPVTLVVFEDFKCPNCKRFEEEFMPELRSKYIDTGKAKLISMNFPFIA 105

Query: 113 VST---------VAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN-MAKF 162
             +          A        +     Y     +LF  Q         +  L +     
Sbjct: 106 AMSNLPVDDSKLAAQAAECAYLQGGSEAYDRMKQILFRAQGAESEVWASKSRLKDLAGSV 165

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G  +  F+TCL++      ++A K++A +   +  TP  F+ G L             I
Sbjct: 166 EGIDQAKFNTCLDNDETAAAVEADKQQAEKA-GVSGTPSVFVNGKLVS-SYDAATVGAAI 223

Query: 223 DSM 225
           D+ 
Sbjct: 224 DAA 226


>gi|271966324|ref|YP_003340520.1| protein-disulfide isomerase-like protein [Streptosporangium roseum
           DSM 43021]
 gi|270509499|gb|ACZ87777.1| Protein-disulfide isomerase-like protein [Streptosporangium roseum
           DSM 43021]
          Length = 224

 Score = 88.1 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 61/205 (29%), Gaps = 5/205 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
               +       P+                          D  VT+VE+    C  C   
Sbjct: 23  VLFGRPEGSATEPVTGTASGQPVPAEYLVRADSHKLSTAADNKVTLVEFLDFECESCGAA 82

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                +    +    GK+ +++R FPL       +             +    + LF  Q
Sbjct: 83  FPHMERI---RAEYDGKINFVVRYFPLPGHRNGELAARVAEAAGKQDRFEAMYAKLFQTQ 139

Query: 144 DDWIN-SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
             W   S++  +  L++AK  G     F   L      + +K  +       +I  TP  
Sbjct: 140 SQWGEASESKEEFFLDLAKQTGLDMAAFQKDLKAPETAERVKKDQDDGF-ALSIQGTPTV 198

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQ 227
           F  G L  G+ S       ID+ + 
Sbjct: 199 FFNGALLDGEPSYENLKAKIDAALA 223


>gi|84686742|ref|ZP_01014629.1| 27kDa outer membrane protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84665173|gb|EAQ11652.1| 27kDa outer membrane protein [Rhodobacterales bacterium HTCC2654]
          Length = 229

 Score = 88.1 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 68/207 (32%), Gaps = 14/207 (6%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
           +     ++ +   EL     + D R L+   P+      +G  +  VT+VE+    C +C
Sbjct: 34  AVAILEQRQAQAQELSQAQVLNDQRDLIENDPNA---PVLGNLEGDVTVVEFFDYNCPYC 90

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
                +      +       +          SV      LA   + + +  +W       
Sbjct: 91  RRVKPEVRAL-IEDDPNIRLVYREWPILGDGSVFAAKAALAARKQDKYEEFHWAM----- 144

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
                 +  +    ++L +A+  G         +    + + I    +  ++    + TP
Sbjct: 145 ----MGLEGRAEEASVLRVAEEIGLDIAQLRKDMEAPEVEEHIATSMQL-TQALGFNGTP 199

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            F IG  L  G + +   + +++   +
Sbjct: 200 SFVIGDALVPGFVEKAQLADLVEEARK 226


>gi|300865534|ref|ZP_07110319.1| DSBA oxidoreductase [Oscillatoria sp. PCC 6506]
 gi|300336477|emb|CBN55469.1| DSBA oxidoreductase [Oscillatoria sp. PCC 6506]
          Length = 257

 Score = 88.1 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 61/180 (33%), Gaps = 8/180 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +       +     + G     + ++E++   C  C+  HN   +++     K       
Sbjct: 83  QVKNNPQAAIADSPTTGSPSQKIVLIEFSDFQCPFCSRAHNTVNQFMAKHQDKVTLAFKH 142

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
                +   +  A   A  A+++    +W + + LF +Q          +    +AK   
Sbjct: 143 FPLVQIHPQALPAAKAAWAAQQQG--KFWEYHNALFEQQQQLS-----EELYSAIAKNLN 195

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
            +   F++  N       I+   + A +   ID TP F + G  + G +       I+  
Sbjct: 196 LNLEKFNSDRNSPAAAAAIQKDIQIA-QTLGIDGTPFFILKGETFSGAVELSEMESILAK 254


>gi|254392758|ref|ZP_05007930.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|197706417|gb|EDY52229.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
          Length = 249

 Score = 88.1 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 78/227 (34%), Gaps = 12/227 (5%)

Query: 5   TTRIGVLGGIVLLFIASYFFY-----TRKGSALNELPIPDGVVDFRALLAASPSTMKDVS 59
             +  V+  +VLL + + F       T      +E   P G                 ++
Sbjct: 30  RAQSAVIAIVVLLALGAVFALFVRDRTDPAQRPDENAWPGGGFHPEEYNRRR--AADPLA 87

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DAPV M+EY  + C  C  F  +T   L +KY+ TG LR   R  P     ++ + 
Sbjct: 88  LGSPDAPVVMIEYVDLRCSPCGAFVRETETELIEKYVDTGILRIEWRNAPAPGEDSMNLA 147

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
            A  A  +                          D L  +A  AG    +  +      +
Sbjct: 148 RAAWAAGQQGRFR-----QFRALVHARAADTLSEDGLKKLAAKAGVRDPERFSIDFHARL 202

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            D      +  +E+  I STP F I G    G      F++ ID  +
Sbjct: 203 ADVAILEDQTEAEEIGIPSTPYFLINGQPVKGIHPLDTFTEAIDKAL 249


>gi|301058679|ref|ZP_07199680.1| DsbA-like protein [delta proteobacterium NaphS2]
 gi|300447243|gb|EFK11007.1| DsbA-like protein [delta proteobacterium NaphS2]
          Length = 282

 Score = 88.1 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 63/177 (35%), Gaps = 10/177 (5%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
           T    S+G ++APV +  ++   C +CA    +  + L+        +R + + FPL S 
Sbjct: 116 TADTPSMGPQNAPVVLAVFSDFQCPYCARLAPRLEQVLKQYPKS---VRVVYKNFPLSSH 172

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                  A        G +W +   L                 + +A+  G  +  F+  
Sbjct: 173 KFAKQAAAAALAAERQGKFWEYHDELHKY-----YRNLSDKKFIEIAQQLGLDEAKFNKD 227

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            +D  IL+ I    +   E   I   P  F+ G     +   G    IID  ++ + 
Sbjct: 228 RHDPAILEKINLDHEEG-EALEIRGIPALFMNGRRIQ-NRDLGNLQDIIDKQLKKAQ 282


>gi|114330112|ref|YP_746334.1| DSBA oxidoreductase [Nitrosomonas eutropha C91]
 gi|114307126|gb|ABI58369.1| DSBA oxidoreductase [Nitrosomonas eutropha C91]
          Length = 219

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/227 (12%), Positives = 61/227 (26%), Gaps = 8/227 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R  ++  I +L +  +          N            A   A+        IG+ D
Sbjct: 1   MNRRLLVISICVLSLIVFTVAAFLLRPANSPVPASVQTPIAAQDLATLVRFHSPVIGRLD 60

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           AP+T+VE+   +C  C  F+    + L         +        +         +    
Sbjct: 61  APITIVEFFDPSCEGCRAFYPHVKQILSKYPNDVRLV-----LRYVLFHEGSEQTVRMLE 115

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             R  G +   +  +   Q +     + +      A                +  +  + 
Sbjct: 116 AARKQGLFQPVLEAILEAQPE--WHDDPKVTAAWRAAVRVGLNEGRARTDIQEAAISALI 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
              +       I  TP FF+ G      ++       ++  +    +
Sbjct: 174 KMDEADVNAVGIKGTPTFFVDGKRLA-KLNPQDLLNAVEGALVLQRK 219


>gi|42520863|ref|NP_966778.1| hypothetical protein WD1055 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410603|gb|AAS14712.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 234

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 64/241 (26%), Positives = 101/241 (41%), Gaps = 22/241 (9%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           M+       +L  ++ + + SY    +  S    +      +    LL   P+   D  +
Sbjct: 1   MIFR-----LLFLLIFISVNSYAVVKQDLSDNQYIQKKPNEITSNELLLPLPN---DKLL 52

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD         
Sbjct: 53  GDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRGL--KAA 110

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNI 179
                      Y+ F   +FN  D W          L  +A  +   ++ F+ C+ND+ I
Sbjct: 111 MLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQCINDKKI 170

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFI-----------GGNLYLGDMSEGVFSKIIDSMIQD 228
           +D I   K  A     I +TP+FFI               + G      F+ +ID +   
Sbjct: 171 MDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVIDKLYGK 230

Query: 229 S 229
           +
Sbjct: 231 A 231


>gi|329888148|ref|ZP_08266746.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846704|gb|EGF96266.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 201

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 58/226 (25%), Positives = 91/226 (40%), Gaps = 26/226 (11%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +M+  R  V+G      I S         A                         D+++G
Sbjct: 1   MMN--RAAVVGMAATALILSACNQGGGSGAATTQ--------------------GDMAMG 38

Query: 62  QKD-APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
             + A VT+VEYAS TC  CA ++   +   + KY+   K+R++ REFP        V  
Sbjct: 39  AAEGAKVTVVEYASTTCAGCAAWNETVWPDFKAKYVDNNKVRFVFREFPTPPQDIA-VAG 97

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
              A    D  Y+  V  L   Q +  N    R+ LL  A+ AG S+  F+ C  D+  +
Sbjct: 98  FLIARCAGDDKYFEVVDHLMRAQTEMRNGVPPREILLRTAQAAGLSETQFEECTTDKAAV 157

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             ++   K+AS    +  TP F + G +   + S    S  ID ++
Sbjct: 158 AALEQRIKQAS-AAGVTGTPTFMVNGQIVTDN-SLSGLSASIDPLL 201


>gi|297193464|ref|ZP_06910862.1| DSBA oxidoreductase [Streptomyces pristinaespiralis ATCC 25486]
 gi|297151790|gb|EDY62169.2| DSBA oxidoreductase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 172

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 61/170 (35%), Gaps = 3/170 (1%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G+ DAPV M+EYA   C +C +F   T   L  KY++ G LR   R FP+    +    
Sbjct: 1   MGRADAPVVMIEYADFQCGYCGKFARDTEPELIKKYVEDGTLRIEWRNFPIFGEES--EA 58

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
            AR A      G +         Q                 +        F   L+    
Sbjct: 59  AARAAWAAGRQGRFWEFHAAAYAQGAKEKGFGEDRLQALAREAGVADPGRFAEDLDSDAA 118

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
              ++  ++ A       STP F I G    G      F++ I++  Q +
Sbjct: 119 RQAVRKDQEEAY-GLGATSTPSFLINGRPVAGAQPMETFTEAIEAAKQAA 167


>gi|296119152|ref|ZP_06837723.1| putative Thioredoxin domain protein [Corynebacterium ammoniagenes
           DSM 20306]
 gi|295967873|gb|EFG81127.1| putative Thioredoxin domain protein [Corynebacterium ammoniagenes
           DSM 20306]
          Length = 208

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 64/215 (29%), Gaps = 9/215 (4%)

Query: 15  VLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYAS 74
            ++ IA    +    S     P P+ V      +    S +   +    +    +VE+  
Sbjct: 2   AIVVIAGIVAFFLGRSDSASAPAPETVTSDAGQVVRDNSRVLSQA---PNEKAVLVEFLD 58

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
             C  C   +    +   +       + ++ R FPL                     Y  
Sbjct: 59  FECEACRAAYPFVEELRAEYSDT---VTFVNRYFPLPGHRNSMPAAVAVEAAAQQDQYEA 115

Query: 135 FVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASED 193
               +F  Q +W  S   +       A+  G     FD  + D    + ++      +  
Sbjct: 116 MYHRMFETQSEWGESAEDKSAVFRGFAEDLGLDMAAFDAAVADPATEERVRLDVADGT-A 174

Query: 194 FAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             +  TP FF+ G L     S   F   +D+   D
Sbjct: 175 LGVRGTPTFFLDGQLLT-PDSLEQFRAEVDAAAAD 208


>gi|167648326|ref|YP_001685989.1| DSBA oxidoreductase [Caulobacter sp. K31]
 gi|167350756|gb|ABZ73491.1| DSBA oxidoreductase [Caulobacter sp. K31]
          Length = 211

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 50/203 (24%), Positives = 84/203 (41%), Gaps = 21/203 (10%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M      +L  + L                                        D+S+G 
Sbjct: 1   MRPLTRRLLTAVALTASLGVALAGCDKKDAATA--------------------DDMSLGN 40

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            +A VT++EYAS +C HC  ++N+ F   + KYI TGK+ Y+ REF    V   A     
Sbjct: 41  ANAKVTVIEYASASCVHCGRWNNEVFPAFKAKYIDTGKVHYVYREFLTPPVQVAA-ASFL 99

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A       Y+  +  +++ Q++  ++ +YR  LL +A+ AG ++  F+ C+ND+  +  
Sbjct: 100 LARCAGKDKYFSVIDSVYHSQEEMFSTGDYRGVLLRIAQSAGLNEEQFNACVNDEKAIKA 159

Query: 183 IKAGKKRASEDFAIDSTPVFFIG 205
           +     +   D  I  TP F I 
Sbjct: 160 LNDRVAKYEADAKITGTPTFVIN 182


>gi|114764673|ref|ZP_01443858.1| 27 kDa outer membrane protein, putative [Pelagibaca bermudensis
           HTCC2601]
 gi|114542873|gb|EAU45894.1| 27 kDa outer membrane protein, putative [Roseovarius sp. HTCC2601]
          Length = 257

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/205 (11%), Positives = 56/205 (27%), Gaps = 8/205 (3%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +   E               A          G  D  +T+VE++   C +C   
Sbjct: 60  AVNALENRQAEQQAVADQQIVSDNADALFRDGYSYVGGNPDGDITIVEFSDYRCGYCRRA 119

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
             +  + +         ++           S+   +                     +  
Sbjct: 120 FPEVEELISSDGNIRFIMKEFPILGEASVTSSRFAIATLMEAG-------DEAYKAVHDA 172

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
              +  +     L  +A   G         ++D+ +   I+  ++ A+    I+ TP F 
Sbjct: 173 LITLEGEPSEPVLRRLADTLGLDAEAIIARMSDEEVTRRIQETRELAT-RLQINGTPSFV 231

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQD 228
            G  +  G +      +++D +  +
Sbjct: 232 FGDQMLRGYVPLDGMRQLVDQIRSE 256


>gi|67921403|ref|ZP_00514921.1| DSBA oxidoreductase [Crocosphaera watsonii WH 8501]
 gi|67856515|gb|EAM51756.1| DSBA oxidoreductase [Crocosphaera watsonii WH 8501]
          Length = 245

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 61/180 (33%), Gaps = 8/180 (4%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
             +             S G     + ++E++   C +C + +    ++++    +   + 
Sbjct: 74  ASQLKSKPQTIIADSPSTGSLSEKIILLEFSDFQCPYCEKAYETVKEFMDKHGDEVTLVY 133

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
                F +                +  G +W +   LF +QD+        D  + +A+ 
Sbjct: 134 KHFPLFTI--HPQALPAAKASWAAQQQGKFWDYYDALFEQQDNLG-----EDFYIELAED 186

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
                  F+   N +N    I+   + A ++  I  TP+F   G ++ G +      + +
Sbjct: 187 LDLDMEQFERDRNSRNADLAIEKDMELA-QEIGIQGTPLFIFNGQVFSGAIPLSTLEEAL 245


>gi|83955860|ref|ZP_00964402.1| 27kDa outer membrane protein [Sulfitobacter sp. NAS-14.1]
 gi|83839865|gb|EAP79042.1| 27kDa outer membrane protein [Sulfitobacter sp. NAS-14.1]
          Length = 239

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 52/176 (29%), Gaps = 11/176 (6%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
                 +G  D  VT+VE+    C +C     +    L            ++        
Sbjct: 75  DPNAPVLGNPDGDVTVVEFFDYNCPYCRRVKPEMEALLAADPNV-----RVVYREWPILG 129

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                        R  G Y  F   +   ++          ++L  A+  G       + 
Sbjct: 130 DGSVFAARAALASRNQGKYEEFHWAMMQLKERAE-----EASILRTAEDIGLDVAQLRSD 184

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +N   I + I+   + A +      TP F IG +L  G +      +++D      
Sbjct: 185 MNGPEIEEHIQTSMRLA-QSLGFSGTPSFVIGDSLAPGLIQADQMIELVDQARAAE 239


>gi|324997934|ref|ZP_08119046.1| DSBA oxidoreductase [Pseudonocardia sp. P1]
          Length = 235

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 56/166 (33%), Gaps = 6/166 (3%)

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
             + V +VE+    C  C   +    +    +     ++  +LR FP+ S +        
Sbjct: 74  PGSTVDLVEFLDFECEACRAAYPAVEQL---RAEYGDRVDVVLRYFPVPSHANAERAARA 130

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSK-NYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                  G +    +L+F  Q +W   +    D     A+  G     +D    D    +
Sbjct: 131 AEAAARQGRHEAMYALMFETQTEWGEQQVPMDDRFRGYAERIGLDMGRYDADYTDPATAE 190

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            ++A ++       +  TP FF+ G +     S       +D  + 
Sbjct: 191 RVEADRRDGL-ALGVRGTPTFFVNGRILE-PRSLDDLRAALDEALA 234


>gi|291454141|ref|ZP_06593531.1| DSBA oxidoreductase [Streptomyces albus J1074]
 gi|291357090|gb|EFE83992.1| DSBA oxidoreductase [Streptomyces albus J1074]
          Length = 187

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 59/161 (36%), Gaps = 1/161 (0%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
           +++G  DAPV M+EY+   C +C  F  +T   L  + ++ G LR   R FPL    +  
Sbjct: 1   MAVGDVDAPVVMIEYSDFQCPYCGRFARETKPALLREQVEEGVLRIEWRNFPLFGEESER 60

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
             LA  A  +    +          +     + + +  +    K        F   L   
Sbjct: 61  AALAAWAAGQQGKFWEFHDLAYAEPRKRNSGAFSEKAVVDMAEKAGVGDLEQFRKDLGGA 120

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
                ++  ++  S    + STP F + G   LG      F
Sbjct: 121 EGRAALERDQQEGS-GLGVSSTPAFLVNGEPILGAQPGSTF 160


>gi|332701795|ref|ZP_08421883.1| DSBA oxidoreductase [Desulfovibrio africanus str. Walvis Bay]
 gi|332551944|gb|EGJ48988.1| DSBA oxidoreductase [Desulfovibrio africanus str. Walvis Bay]
          Length = 264

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 52/199 (26%), Gaps = 4/199 (2%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
              +      +  I       +            + +G   APVT+VEY+   C +C   
Sbjct: 61  VLQQAALKKRQQEIQQEQEREKQNPLKPVVDPSRILVGSAQAPVTIVEYSDFQCPYCERL 120

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
             +  K L     +   +          S  +            M               
Sbjct: 121 ALELDKALARLGTQARMVFKHNPLR---SHESAMTAAKLFEAVSMQDKQAARKLYHLLFA 177

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
           +     +     LL++A  AG  +      +    +   I+A        F     PV  
Sbjct: 178 NQDRLDELGEKGLLDLAVQAGAKREATLKAMQSPEVQKRIEADMAE-FRSFGFSGVPVLV 236

Query: 204 IGGNLYLGDMSEGVFSKII 222
           I G    G +      +I+
Sbjct: 237 INGVSVRGAVPAEEILQIV 255


>gi|154253719|ref|YP_001414543.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
 gi|154157669|gb|ABS64886.1| DSBA oxidoreductase [Parvibaculum lavamentivorans DS-1]
          Length = 263

 Score = 87.7 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 55/193 (28%), Gaps = 11/193 (5%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
                  +           A   +   D   G     VT+VE+    C +C +       
Sbjct: 76  QREQNAALASRREAIEKRHADIYNDPGDFVAGNPKGDVTIVEFFDYRCGYCKQSFKPLMD 135

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
           +++        L+      P              A K           L  ++       
Sbjct: 136 FVKADGNIRLILKEFPILGPASLE----------ASKAAIAAKKQNRYLEMHRALYEHKG 185

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
           +   +A+  +A   G         + D  I   +      A E   +D TP F +GG LY
Sbjct: 186 QLDSEAIFGIATSLGLDTAKLRKDMEDPEIAKMVSRHYDLA-EALGVDGTPAFIVGGELY 244

Query: 210 LGDMSEGVFSKII 222
            G   +   ++I+
Sbjct: 245 PGAADKERLTEIV 257


>gi|159035860|ref|YP_001535113.1| DSBA oxidoreductase [Salinispora arenicola CNS-205]
 gi|157914695|gb|ABV96122.1| DSBA oxidoreductase [Salinispora arenicola CNS-205]
          Length = 220

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/194 (19%), Positives = 72/194 (37%), Gaps = 6/194 (3%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQK-DAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
            IP        +  A     +   +    D  VT+VE+    C  CA  +    +     
Sbjct: 30  AIPTAETAGGTVDPAVLVRDESHRLATATDGKVTLVEFLDFECEACAAAYPAVKEI---L 86

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR- 153
               G++ +++R FP+ S     +           G + G   +LF  Q  W + +  + 
Sbjct: 87  TAYEGQITFVVRYFPIPSHPNAELAAHTAQAAANQGHFRGMYQMLFENQSVWGHKEEPQT 146

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
           +  L+ A+  G   + F   L+D   +  +   +    E   +  TP FF+ G+      
Sbjct: 147 EVFLDYARALGLDMDRFQRDLDDPATVARVARDRADG-EAVGVQGTPTFFLNGSPLTDLR 205

Query: 214 SEGVFSKIIDSMIQ 227
           S+   + +ID+ + 
Sbjct: 206 SKDDLTAMIDAALA 219


>gi|254488289|ref|ZP_05101494.1| dsba oxidoreductase [Roseobacter sp. GAI101]
 gi|214045158|gb|EEB85796.1| dsba oxidoreductase [Roseobacter sp. GAI101]
          Length = 252

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/203 (11%), Positives = 56/203 (27%), Gaps = 8/203 (3%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
              +      E              AA          G  +  +T+VE+    C +C + 
Sbjct: 57  AVNKLQQRDAEAQAQADFTLVSDNAAAIFDDGFSYVGGNPEGDITIVEFMDYRCGYCKKA 116

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
            ++  K +         ++ +        V++   +  +                  +  
Sbjct: 117 FSEVEKLVNGDGNIRFIVKELPILGEQSMVASRFAIATKLVAGDEGYKS-------VHDA 169

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
               N      +L  +A+      +     ++   + ++I   +  A +   I  TP F 
Sbjct: 170 LMTFNGDITPTSLGRLAESFDLDADAITEKMDSAEVTEEIAKTRALA-QVMNISGTPTFV 228

Query: 204 IGGNLYLGDMSEGVFSKIIDSMI 226
           +   L  G +       I++   
Sbjct: 229 MDDELLRGYLPYDQMKAIVEEKR 251


>gi|84503176|ref|ZP_01001261.1| 27kDa outer membrane protein [Oceanicola batsensis HTCC2597]
 gi|159046326|ref|YP_001541998.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|159046601|ref|YP_001542271.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|84388417|gb|EAQ01366.1| 27kDa outer membrane protein [Oceanicola batsensis HTCC2597]
 gi|157914085|gb|ABV95517.1| oxidoreductase [Dinoroseobacter shibae DFL 12]
 gi|157914360|gb|ABV95790.1| DsbA oxidoreductase [Dinoroseobacter shibae DFL 12]
          Length = 243

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 68/207 (32%), Gaps = 14/207 (6%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
           +     ++ +   EL     + D R L+   P+      +G  +  VT+VE+    C +C
Sbjct: 48  AVAILEQRQAQAQELSQAQVLNDQRDLIENDPNA---PVLGNLEGDVTVVEFFDYNCPYC 104

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
                +      +       +          SV      LA   + + +  +W       
Sbjct: 105 RRVKPEVRAL-IEDDPNIRLVYREWPILGDGSVFAAKAALAARKQDKYEEFHWAM----- 158

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
                 +  +    ++L +A+  G         +    + + I    +  ++    + TP
Sbjct: 159 ----MGLEGRAEEASVLRVAEEIGLDIAQLRKDMEAPEVEEHIATSMQL-TQALGFNGTP 213

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            F IG  L  G + +   + +++   +
Sbjct: 214 SFVIGDALVPGFVEKAQLADLVEEARK 240


>gi|51245459|ref|YP_065343.1| 27kDa outer membrane protein [Desulfotalea psychrophila LSv54]
 gi|50876496|emb|CAG36336.1| related to 27kDa outer membrane protein [Desulfotalea psychrophila
           LSv54]
          Length = 293

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 73/230 (31%), Gaps = 13/230 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS--TMKDVS 59
           VM  +R G L G + +              +  L      V             T     
Sbjct: 72  VMVYSREGKLQGFIPVAPGVSSIDIAPQGEIIYLLDSTNNVFSAVRTDFVVEFNTKGSPF 131

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
            G+ DAPVT+  +    C +C++      +        +  ++ + +  PL+        
Sbjct: 132 KGKADAPVTIAVFTDFECPYCSKLVPLIDQI---YEANSKNVKIVFKNMPLNFHKAAEPA 188

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
                     G +W +   +F  ++        R  L+  AK        F   ++   +
Sbjct: 189 ARAGLAAEAQGKFWPYHDKIFAIKN------LKRSDLIKTAKELELDIPLFKKDMDSNAV 242

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
              ++     A +   +  TP  FI G+       +  F  +ID+ ++ +
Sbjct: 243 RAQVRQDIIDA-KSAGVTGTPTVFINGHKLK-QREQRTFQTMIDAELRKA 290


>gi|220903305|ref|YP_002478617.1| DSBA oxidoreductase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219867604|gb|ACL47939.1| DSBA oxidoreductase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 276

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/190 (13%), Positives = 64/190 (33%), Gaps = 4/190 (2%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
           +                +G K+A V +V ++  TC  C +        +++       + 
Sbjct: 88  NQEMKTPKPVKVEGRPVLGAKNAKVRIVAFSDFTCHFCQQAAGTVSGIMKEYGKDVSLV- 146

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
           +          +++A        ++ +   W F   LF  ++  +        L   A+ 
Sbjct: 147 FKNLPLDEKGPASIASRYFLAVAQQSEEKAWKFHDALFADRNRLVTEG--ETFLKKTAQD 204

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            G         ++ + I D +   ++ A +   ++ TP F +   +  G +   +F + +
Sbjct: 205 LGVDMKRLAKDVHSKKISDIMDEDQQDA-QKLGVEGTPYFLVNDLVVRGALPPDLFKRAV 263

Query: 223 DSMIQDSTRR 232
           D     +  +
Sbjct: 264 DMAKNQADNK 273


>gi|326445250|ref|ZP_08219984.1| hypothetical protein SclaA2_29487 [Streptomyces clavuligerus ATCC
           27064]
          Length = 227

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 78/227 (34%), Gaps = 12/227 (5%)

Query: 5   TTRIGVLGGIVLLFIASYFFY-----TRKGSALNELPIPDGVVDFRALLAASPSTMKDVS 59
             +  V+  +VLL + + F       T      +E   P G                 ++
Sbjct: 8   RAQSAVIAIVVLLALGAVFALFVRDRTDPAQRPDENAWPGGGFHPEEYNRRR--AADPLA 65

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DAPV M+EY  + C  C  F  +T   L +KY+ TG LR   R  P     ++ + 
Sbjct: 66  LGSPDAPVVMIEYVDLRCSPCGAFVRETETELIEKYVDTGILRIEWRNAPAPGEDSMNLA 125

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNI 179
            A  A  +                          D L  +A  AG    +  +      +
Sbjct: 126 RAAWAAGQQGRFR-----QFRALVHARAADTLSEDGLKKLAAKAGVRDPERFSIDFHARL 180

Query: 180 LDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            D      +  +E+  I STP F I G    G      F++ ID  +
Sbjct: 181 ADVAILEDQTEAEEIGIPSTPYFLINGQPVKGIHPLDTFTEAIDKAL 227


>gi|227818318|ref|YP_002822289.1| hypothetical protein NGR_b00650 [Sinorhizobium fredii NGR234]
 gi|227337317|gb|ACP21536.1| membrane protein, putative [Sinorhizobium fredii NGR234]
          Length = 180

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 48/172 (27%), Gaps = 8/172 (4%)

Query: 52  PSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           P   +D   G  +A VT+VEY    C  CA  +                +        ++
Sbjct: 7   PINPRDHRRGGTNATVTLVEYGDYQCPVCAIANPVVRSLENRYGQALSVVFRH--FPMIE 64

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
                             G +W     +F+ Q        +  A        G   +   
Sbjct: 65  VHPFAGTAAETAEFAGDHGLFWEMHDAIFSNQHRLSIQLLFAIASTLQLSQIGLRDSIAR 124

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           +   D+   D I            ++ TP FF+ G  + G  +    +  I 
Sbjct: 125 SLHADKIQADFI------GGVRSGVNGTPTFFVNGLRHEGGFTAPELAASIQ 170


>gi|296532649|ref|ZP_06895348.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
 gi|296267020|gb|EFH12946.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
          Length = 214

 Score = 87.4 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 63/223 (28%), Gaps = 12/223 (5%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R  +  G   L +A +          +         D R +   SP       IG+ D
Sbjct: 1   MNRRFLTLGTGALALAGFGAGALLWPGTDLAGPVPAGQDDRFVRPHSP------VIGKPD 54

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           A VT+VE+   +C  C  FH    + L     +   +                  +    
Sbjct: 55  AAVTLVEFFDPSCEACRAFHPLLNRMLAQHAGQLRMV-----LRYAPFHEGSDEAVRILE 109

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             R+   +   +  LF +Q DW                              +  +  + 
Sbjct: 110 AARLQDRFEPVLDALFARQPDWAMHGAPDLEAAWRIAGIAGLDLPRARRDARRPEIGRVL 169

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           A      +   +  TP FF+ G   L         ++I S I+
Sbjct: 170 AIDGEDLQALQVRQTPTFFVNGKPLL-SFGPRQLYELILSEIE 211


>gi|83951919|ref|ZP_00960651.1| 27 kDa outer membrane protein, putative [Roseovarius nubinhibens
           ISM]
 gi|83836925|gb|EAP76222.1| 27 kDa outer membrane protein, putative [Roseovarius nubinhibens
           ISM]
          Length = 248

 Score = 87.4 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/199 (12%), Positives = 56/199 (28%), Gaps = 8/199 (4%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
               +  +            A  +       G  +  +T+VE+    C +C     +  +
Sbjct: 58  QRQQQDQVSADQEMVSRNSDAIFNDDHSWVGGNPEGDITIVEFLDYRCGYCKRAFGEVKE 117

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            LE        ++          +++   +  +                  +      N 
Sbjct: 118 LLETDGNIRFIVKEFPILGEASVMASRFAIATKLEAGDE-------AYESLHDGLMAFNG 170

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
                AL  +A   G   +     + D+ + + I      A     I  TP F +G  + 
Sbjct: 171 DITEAALKRLATSFGLDADAIAARMEDEEVSEAIAQNHALAG-ALQITGTPTFVMGDQMV 229

Query: 210 LGDMSEGVFSKIIDSMIQD 228
            G +      +I+  + ++
Sbjct: 230 RGYVPLEGMEQIVAELRKE 248


>gi|312887092|ref|ZP_07746696.1| DSBA oxidoreductase [Mucilaginibacter paludis DSM 18603]
 gi|311300404|gb|EFQ77469.1| DSBA oxidoreductase [Mucilaginibacter paludis DSM 18603]
          Length = 174

 Score = 87.4 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 61/176 (34%), Gaps = 8/176 (4%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
           +P T +D  +G + AP+ ++EY    C  C + +      ++   +    +         
Sbjct: 7   NPITKRDHMLGIQAAPLVLLEYGDYQCSSCGDSYMAVNNVIQ--AMGEDIVFVFRNFPLT 64

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D                +   +W    LLF  Q          + L + A+  G   + F
Sbjct: 65  DIHPDAFDAALAAEAAALQNKFWEMYDLLFQNQAYLS-----ENELFSYARRIGLDMDRF 119

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
              +  Q ++  I A  +       +  TP F+I G  + GD +     + +  ++
Sbjct: 120 GQDIQSQALISKIDADIESGL-RSGVSGTPTFYINGEKFDGDWTGSGLVQYLRELL 174


>gi|323463203|gb|ADX75356.1| protein-disulfide isomerase, putative [Staphylococcus
           pseudintermedius ED99]
          Length = 229

 Score = 87.4 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 74/237 (31%), Gaps = 18/237 (7%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           ++   +  ++  +V+L    +F      ++          +                + G
Sbjct: 1   MLKKNKWLIIFIVVILVAGIFFSLATFKTSKKGNSGSGETLAAETQKQ--------PTQG 52

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
           +KD+ V +VE+    C +C +F       LE +YI   K+ +      +    +     A
Sbjct: 53  KKDSKVLLVEFGDFKCPYCGDFERNIKPKLEKEYIDNNKVEFRYVNVLIHGEESELGAKA 112

Query: 122 RCAEKR-MDGGYWGFVSLLFNKQDDWINSKNYRDALLNM------AKFAGFSKNDFDTCL 174
             A  +     YW F   LF +Q +  +    +  L +        K     +      +
Sbjct: 113 ALAVNQYAPDKYWQFHHALFEQQPNNKDDVGSQHWLTDDLIQQQLQKLDLSEQERKQITV 172

Query: 175 NDQNILDDIKAGKKR---ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             ++    I    +     ++   +   P  ++ G     +         ID  ++ 
Sbjct: 173 AYRDEKGAIAKRAQEDHTLAKKEEVPYVPALYVNGKQVEDETDFDAIKNEIDKALEQ 229


>gi|156741356|ref|YP_001431485.1| protein-disulfide isomerase-like protein [Roseiflexus castenholzii
           DSM 13941]
 gi|156232684|gb|ABU57467.1| protein-disulfide isomerase-like protein [Roseiflexus castenholzii
           DSM 13941]
          Length = 275

 Score = 87.4 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 68/226 (30%), Gaps = 29/226 (12%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
               LLF+           A  +                         +G  +AP+ ++E
Sbjct: 17  AAAALLFLFMVIAALMTDHAQAQNDADPRG------------------LGDPNAPIVIIE 58

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           Y+   C  CA F       L  +YI+TGK+ Y+ R+ PL       +           G 
Sbjct: 59  YSDYECPACASFVRDAKPQLIAEYIETGKVYYLYRDNPLPQHPAGRIAAIYAHCAVRQGQ 118

Query: 132 YWGFVSLLFNKQDDWINSKNY---RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK 188
           +W     LF    D     +               G        C+ D      I A  +
Sbjct: 119 FWPMHRRLFQGYIDGEWGGDPSASERVFRRYGDELGLDSGALQECVRDPTTEQAIAADIE 178

Query: 189 RASEDFAIDSTPVFFI-------GGNLYLGDMSEGVFSKIIDSMIQ 227
            A     +  TP + +        G++  G  S G +  ++D  + 
Sbjct: 179 EARNR-GLRGTPAYILRWPGGPERGDVLTGAQSFGTWRALLDERLS 223


>gi|239942505|ref|ZP_04694442.1| hypothetical protein SrosN15_16018 [Streptomyces roseosporus NRRL
           15998]
 gi|239988969|ref|ZP_04709633.1| hypothetical protein SrosN1_16785 [Streptomyces roseosporus NRRL
           11379]
          Length = 266

 Score = 87.4 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 46/194 (23%), Positives = 70/194 (36%), Gaps = 3/194 (1%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
            T  G A      PD  V       A       ++IG  DAPV ++EYA   C +C +F 
Sbjct: 51  TTATGPAAEVSADPDAGVYPELAKLARRDADDKLAIGPADAPVVLIEYADFKCGYCGKFA 110

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
             T   L +KY+K G LR   R FP+    +        A  + +  +    +       
Sbjct: 111 RDTEPELIEKYVKDGTLRIEWRNFPIFGEESENAARGAWAAGQQNRFWEFHRAAYAEGAK 170

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           +    K+   AL    +      + F   L+       +K  +++A       STP F I
Sbjct: 171 EKGFGKDRVKALA--EEAGVKDLDRFMKDLDGDAARASVKKDQEQAY-GIGATSTPSFLI 227

Query: 205 GGNLYLGDMSEGVF 218
            G    G   +  F
Sbjct: 228 NGRPIAGAQPDETF 241


>gi|158422975|ref|YP_001524267.1| hypothetical protein AZC_1351 [Azorhizobium caulinodans ORS 571]
 gi|158329864|dbj|BAF87349.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 176

 Score = 87.4 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 47/177 (26%), Gaps = 9/177 (5%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
                   D  +G     VT+VEY    C +C E +                +       
Sbjct: 4   PIPSLAADDHILGTPSFSVTLVEYGDYQCPYCGEAYPVLKAVQRAMGADLRFVFRNFPLV 63

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
            + + +  A   A  A +     +W    +L+  QD   +        L           
Sbjct: 64  EVHAHALRAAQFAEAAAEAG--LFWEAHDMLYENQDALGDRH------LEAYADQLGIDR 115

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
                  +    + I+           ++ TP  FI G LY G         ++   
Sbjct: 116 AILAAAFEGRHDEKIQRDF-LGGVRGGVNGTPSLFINGQLYEGPPEPESLISVLSRA 171


>gi|324999105|ref|ZP_08120217.1| cyclic nucleotide-binding protein [Pseudonocardia sp. P1]
          Length = 175

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 55/178 (30%), Gaps = 8/178 (4%)

Query: 50  ASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFP 109
             P    D  +G  DA +T+VEY    C +C +      +       +            
Sbjct: 5   DPPLGPYDHVLGPPDAELTLVEYGDYECPYCRDAAPVIDEVRARFGDRLRFAFRHFPLHE 64

Query: 110 LDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND 169
           +   +  A + A  A              +          +  +D L   A   G     
Sbjct: 65  VHPHALAAAVAAEMAGLEGRFW------EMHASLFAPGPPRLRQDDLREHAAAIGVPPER 118

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                  Q + D ++AG   A     +  TP  ++ G  Y GD++    +  +D ++ 
Sbjct: 119 VVW-PATQVVEDRVEAGFNAAV-RSGVRGTPTLYVRGERYRGDVTVAALTAALDPVVS 174


>gi|114762591|ref|ZP_01442035.1| 27kDa outer membrane protein [Pelagibaca bermudensis HTCC2601]
 gi|114544846|gb|EAU47851.1| 27kDa outer membrane protein [Roseovarius sp. HTCC2601]
          Length = 210

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 68/207 (32%), Gaps = 14/207 (6%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
           +     ++ +   EL     + D R L+   P+      +G  +  VT+VE+    C +C
Sbjct: 15  AVAILEQRQAQAQELSQAQVLNDQRDLIENDPNA---PVLGNLEGDVTVVEFFDYNCPYC 71

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
                +      +       +          SV      LA   + + +  +W       
Sbjct: 72  RRVKPEVRAL-IEDDPNIRLVYREWPILGDGSVFAAKAALAARKQDKYEEFHWAM----- 125

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP 200
                 +  +    ++L +A+  G         +    + + I    +  ++    + TP
Sbjct: 126 ----MGLEGRAEEASVLRVAEEIGLDIAQLRKDMEAPEVEEHIATSMQL-TQALGFNGTP 180

Query: 201 VFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            F IG  L  G + +   + +++   +
Sbjct: 181 SFVIGDALVPGFVEKAQLADLVEEARK 207


>gi|88856671|ref|ZP_01131327.1| hypothetical protein A20C1_10830 [marine actinobacterium PHSC20C1]
 gi|88814132|gb|EAR23998.1| hypothetical protein A20C1_10830 [marine actinobacterium PHSC20C1]
          Length = 221

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 64/220 (29%), Gaps = 10/220 (4%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIP---DGVVDFRALLAASPSTMKDVSIGQK-DAPVTM 69
           + L               +                    AS +      +    D  VT+
Sbjct: 7   VALATTGGLILVVIAVIVVLLAQAQQSRPTAESDPMTGIASATRGDSHILDNAGDGAVTV 66

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           VE+    C  CA  +    +    +   +G++ ++LR FPL                   
Sbjct: 67  VEFLDFECEACAAAYPVVEEL---RQEFSGQVTFVLRYFPLPGHFNSTNAAVAVEAAAQQ 123

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQNILDDIKAGKK 188
           G        +F  Q +W  ++  +  L              +D  + D      +++  K
Sbjct: 124 GELEAMYKQMFATQSEWGEAQQSQAPLFRKFAEDLGLDLAQYDAAVADPATTARVESDFK 183

Query: 189 RASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
                  ++STP FF+   +     S G     ID+ +  
Sbjct: 184 DGV-ALGVNSTPTFFVNDQIVE-LRSFGDLRTAIDAELSR 221


>gi|158317383|ref|YP_001509891.1| DSBA oxidoreductase [Frankia sp. EAN1pec]
 gi|158112788|gb|ABW14985.1| DSBA oxidoreductase [Frankia sp. EAN1pec]
          Length = 238

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 64/221 (28%), Gaps = 13/221 (5%)

Query: 8   IGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPV 67
           IG +    L+ I    F  +                   L A++      + +G+ DAPV
Sbjct: 29  IGSVVAAALVLIGVIGFAVQNSRE---------ESKPVVLPASATGPDNAIVVGKADAPV 79

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           T+  Y    C  C    + T   + D          I                   A   
Sbjct: 80  TLDFYEDFQCPACGSLESTTGSTISDLIDSGD--IKINYHVMSFLGDESKRAANAGAAAA 137

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
            +G +  F   LF  Q +        D L+      G + + F + + D      +    
Sbjct: 138 NEGKFKEFHDALFADQPEEHTGGYQTDTLIQKGASVGLTSDAFVSAVRDGKYDGYVAKVD 197

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDM-SEGVFSKIIDSMIQ 227
           + AS    + STP   + G     D  +       + +  +
Sbjct: 198 EDAS-RSGVTSTPTVLVDGKQLSADQLTPDGLRAAVSAAAK 237


>gi|269961195|ref|ZP_06175563.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834146|gb|EEZ88237.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 294

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/251 (12%), Positives = 65/251 (25%), Gaps = 36/251 (14%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS-- 59
           +M  TR  +   I L+ +  +     K S      I   + +   +L +    ++D    
Sbjct: 56  IMKFTRTLLTVAIALVPL--FSHAAEKTSEEKLQEITQLLKENPQILDSLHQNLQDYVAY 113

Query: 60  ----------------------IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
                                  G ++  +T++     +C  C     +  K  ++    
Sbjct: 114 QKTFNATLDEARAYLNDGKHSYFGAENPELTIINVTDYSCPFCKRLEGELVKVEKEYPQV 173

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
                 +  +   +     +   A    +     Y     LL  K      S   +    
Sbjct: 174 KVLNMTVSFKEQYEKNGYNSASYALNVWQNQHDKYKEVHDLLVKKPGPHDASSLQK---- 229

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
                    K   +  L D      +            +  TP   I   +  G +    
Sbjct: 230 ------IAKKTGTEAQLVDDKETKALLDKNYEYFTRLGLRGTPAIIINDQVIPGYVPFEE 283

Query: 218 FSKIIDSMIQD 228
             K+ID  ++ 
Sbjct: 284 LEKVIDQELKK 294


>gi|170749110|ref|YP_001755370.1| DSBA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
 gi|170655632|gb|ACB24687.1| DSBA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
          Length = 260

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 55/204 (26%), Gaps = 8/204 (3%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                     E          +    A  +   DV  G     VT+VE+    C +C + 
Sbjct: 59  ALAEAEKQQAETQRLAQAAALKESREALINGPHDVVAGNPTGDVTLVEFFDYNCGYCRKA 118

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                  ++        ++      P    ++   +  R   K      +       +++
Sbjct: 119 LGDVQALIKSDPKLRVVIKDFPVLGPESLEASQVAVAVRQQLKGDKLFEF-------HQK 171

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
                 +      + +AK  G         +    +   +   +    +   +  TP F 
Sbjct: 172 LLETKGRVNGARAIQVAKDMGVDTAKLQKDMASPEVKAALSENRGLG-DRLGLSGTPAFI 230

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQ 227
           IG  +  G +      K I  + Q
Sbjct: 231 IGDEVIPGAVGVEPMRKTIADVRQ 254


>gi|90419266|ref|ZP_01227176.1| putative protein disulfide isomerase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336203|gb|EAS49944.1| putative protein disulfide isomerase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 221

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/225 (13%), Positives = 63/225 (28%), Gaps = 6/225 (2%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
            TR  ++  I+++ +A +   +   +    +              A         +G + 
Sbjct: 1   MTRRPLILSILVVGLAVFAAASWFATRPAAITATATGTLPPEQAEAL-LRPYSPILGPEQ 59

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+    C  C  F+    + + +       +                  +    
Sbjct: 60  APVTIVEFFDPACEACRAFYPTVKQIIAEHGAAVRVVLRYTPFHGEG----SEEAIRVLE 115

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             RM G +   +  +  +Q  W +       L+     +     D             I 
Sbjct: 116 AARMQGVFEPVLQAIMREQPQWASHGAPEPGLVLQIAASAGLDADAARTQMQAPQTTAIL 175

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
              +   E   +  TP FF+ G        +      +   +  S
Sbjct: 176 NQDRADVETMGVSQTPTFFVNGRPLA-PFGKAELRTRVAEEVAAS 219


>gi|239906944|ref|YP_002953685.1| DSBA oxidoreductase family protein [Desulfovibrio magneticus RS-1]
 gi|239796810|dbj|BAH75799.1| DSBA oxidoreductase family protein [Desulfovibrio magneticus RS-1]
          Length = 259

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/203 (19%), Positives = 71/203 (34%), Gaps = 7/203 (3%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS-IGQKDAPVTMVEYASMTCFH 79
           +        +   +  +             +P        +G ++APVT+VEY+   C  
Sbjct: 50  AVLEVIETTARARQKDLERARFSQALAKPLTPVMEAGRVALGPQNAPVTIVEYSDFLCHF 109

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           C +        +     +   +R + + F     S  A +      ++     W F+  +
Sbjct: 110 CGQASGTVKSVM---EKRPDDVRLVFKHFATGKNSVRAALYFEAIAQQDAKKAWNFMDKV 166

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F +Q D        + L  +AK  G         +  + + D + A  K A  DF  + T
Sbjct: 167 FARQKDVAEKG--DEVLDAIAKEVGADAKKLAEDVKSKALADRVAADTKEA-RDFGFEGT 223

Query: 200 PVFFIGGNLYLGDMSEGVFSKII 222
           PVF I G    G +   VF + +
Sbjct: 224 PVFLINGAPVRGAVPYEVFDEFV 246


>gi|197284340|ref|YP_002150212.1| metal resistance protein [Proteus mirabilis HI4320]
 gi|194681827|emb|CAR41092.1| putative metal resistance protein [Proteus mirabilis HI4320]
          Length = 243

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 58/203 (28%), Gaps = 14/203 (6%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            +   +           +   A  +      IG KDA + +V +    C +C  F     
Sbjct: 55  QTKKADEQQAQFRQALASEHDALYNDAASPRIGAKDAKLVLVSFTDYNCPYCKRFDPLLE 114

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN 148
           K  E        +  I++  P    S+     A  +  + D   +  +     ++   ++
Sbjct: 115 KITEQYP----DVAVIIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLMQKKTMLD 170

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           + +  DA+ +         +D                     S    I  TP   IG  +
Sbjct: 171 NASIEDAMKSTNTSKIKLTDDSLKT----------LQNNLELSRKLGIQGTPATVIGDTI 220

Query: 209 YLGDMSEGVFSKIIDSMIQDSTR 231
             G +       I+   +    +
Sbjct: 221 LPGAVDYDQLEIIVKEQLAKVKK 243


>gi|153833443|ref|ZP_01986110.1| copper sensitivity protein ScsC [Vibrio harveyi HY01]
 gi|148870218|gb|EDL69153.1| copper sensitivity protein ScsC [Vibrio harveyi HY01]
          Length = 238

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/250 (12%), Positives = 65/250 (26%), Gaps = 36/250 (14%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS--- 59
           M  TR  +   I L+ I  +     K S      I   + +   +L +    ++D     
Sbjct: 1   MKFTRTLLTVAIALVPI--FSHAAEKTSEEKLQEITQLLKENPQILDSLHQNLQDYVAYQ 58

Query: 60  ---------------------IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
                                +G ++  +T++     +C  C     +  K  ++     
Sbjct: 59  KTFNATLDEARAYLNDGKHSYLGAENPELTIINVTDYSCPFCKRLEGELVKVEKEYPQVK 118

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
                +  +   +     +   A    +     Y     LL  K      S   +     
Sbjct: 119 VLNMTVSFKEQYEKNGYNSASYALNVWQNQHDKYKEVHDLLVKKPGPHDASSLQK----- 173

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
                   K   +  L D      +            +  TP   I   +  G +     
Sbjct: 174 -----IAKKTGTEAQLVDDKETKALLDKNYEYFTRLGLRGTPAIIINDQVIPGYVPFEEL 228

Query: 219 SKIIDSMIQD 228
            K+ID  ++ 
Sbjct: 229 EKVIDQELKK 238


>gi|227358516|ref|ZP_03842841.1| DSBA oxidoreductase [Proteus mirabilis ATCC 29906]
 gi|227161227|gb|EEI46301.1| DSBA oxidoreductase [Proteus mirabilis ATCC 29906]
          Length = 243

 Score = 87.0 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 58/203 (28%), Gaps = 14/203 (6%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            +   +           +   A  +      IG KDA + +V +    C +C  F     
Sbjct: 55  QTKKADEQQAQFRQALASEHDALYNDAASPRIGAKDAKLVLVSFTDYNCPYCKRFDPLLE 114

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN 148
           K  E        +  I++  P    S+     A  +  + D   +  +     ++   ++
Sbjct: 115 KITEQYP----DVAVIIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLMQKKTMLD 170

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           + +  DA+ +         +D                     S    I  TP   IG  +
Sbjct: 171 NASIEDAMKSTNTSKIKLTDDSLKT----------LQNNLELSRKLGIQGTPATVIGDTI 220

Query: 209 YLGDMSEGVFSKIIDSMIQDSTR 231
             G +       I+   +    +
Sbjct: 221 LPGAVDYDQLEIIVKEQLAKVKK 243


>gi|148557586|ref|YP_001265168.1| protein-disulfide isomerase-like protein [Sphingomonas wittichii
           RW1]
 gi|148502776|gb|ABQ71030.1| Protein-disulfide isomerase-like protein [Sphingomonas wittichii
           RW1]
          Length = 247

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 83/247 (33%), Gaps = 30/247 (12%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDF----RALLAASPSTMKDVSI 60
             ++  +  I L    +        +A      P                  +      +
Sbjct: 1   MKKLLPVAAIGLALALTACGKKDADNAATNTVAPAAPSAPYTGKDWTATLVKTPEGGFRM 60

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPV +VEYAS+TC HC +F       L   Y++TGK+ +  R F L+    + V  
Sbjct: 61  GNPDAPVKLVEYASITCPHCRDFSKVGGDPLRQTYVRTGKVSWEYRNFVLN---PLDVAA 117

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA-----------------------LL 157
              A  +    ++ F+  L+  Q +W+   N  D                        L 
Sbjct: 118 TLVARCQGAETFFPFIDQLYATQTEWVGKFNSVDEATLRSVGGLPQQEQFTKLIELSGLG 177

Query: 158 NMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
           +  K  G   +    CL+D+  L ++   +   + +  +D TP F I G    G      
Sbjct: 178 DFFKERGVPADRIQACLSDKAALAELLKIRDHGANEDKVDGTPNFLINGERQEGVYDWPG 237

Query: 218 FSKIIDS 224
               +  
Sbjct: 238 LEAKLRE 244


>gi|326383328|ref|ZP_08205016.1| hypothetical protein SCNU_10339 [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326198078|gb|EGD55264.1| hypothetical protein SCNU_10339 [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 234

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 69/229 (30%), Gaps = 5/229 (2%)

Query: 3   MSTTRIG-VLGGIVLLFIASYFFYTRKGSALNELP-IPDGVVDFRALLAASPSTMKDVSI 60
              +R+  +L  +V +   ++      G   ++    P            +      ++ 
Sbjct: 7   FRQSRLVPLLAVLVGITAIAFVVVQASGRGTDQAEHQPTPHSTPVRSKWENRDPTDPMAF 66

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPV +V +    C +CA++   T   L            I                
Sbjct: 67  GPVDAPVGLVVFTDFQCPYCAKWSYDTLPKLLPFADSGKL--RIELRDMNIFGDESERAA 124

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                    G    + + LF        S+   DAL+ +A         F T    + +L
Sbjct: 125 RAAYAAAGQGRLRDYHAALFADGRPRPKSELSDDALVTLADRLHLDVPRFRTDYESRTVL 184

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
             ++             STP F +GG   LG     VF   + S +  S
Sbjct: 185 SAVRNKASDGFTA-GTYSTPAFILGGQPILGAQPTRVFLDKLQSALDAS 232


>gi|94496122|ref|ZP_01302700.1| protein-disulfide isomerase [Sphingomonas sp. SKA58]
 gi|94424301|gb|EAT09324.1| protein-disulfide isomerase [Sphingomonas sp. SKA58]
          Length = 243

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 73/239 (30%), Gaps = 26/239 (10%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPS--------TMKDVSIGQKD 64
               L IA+        ++  E   P G         A  +           +  +G  D
Sbjct: 3   AFTGLAIAALSLSLTACNSSEEAAKPSGTPIAAVPAPAGTTWSATVNETPEGNFVMGNPD 62

Query: 65  APVTMVEYASMTCFHCAEFH----NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           A + +VEY S TC HCAEF      +  K ++   +      Y+     L +        
Sbjct: 63  AKLKLVEYGSFTCSHCAEFAETASPEIRKLVDTGKMNYEFRTYVRDPIDLTTALLARCGG 122

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR--------------DALLNMAKFAGFS 166
                   +  +    ++    Q +    K                   L++ AK  G S
Sbjct: 123 KDVFYPLSEQFFANQGAMFEKVQGNDDAFKGVEQLSPAQRPVAIAQIAGLIDFAKQRGIS 182

Query: 167 KNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           ++    CL D    + +  G + A+  + I  TP F I G L     +       +   
Sbjct: 183 EDQARQCLADTATAEKLAKGVEAANNQYQITGTPSFLINGVLVDDAANWASLEPKLKEA 241


>gi|88797508|ref|ZP_01113097.1| 27kDa outer membrane protein [Reinekea sp. MED297]
 gi|88779680|gb|EAR10866.1| 27kDa outer membrane protein [Reinekea sp. MED297]
          Length = 245

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/197 (13%), Positives = 50/197 (25%), Gaps = 9/197 (4%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
                             L  A  +   D   G  D  +T+VE+    C +C   ++   
Sbjct: 57  QERAENEQAAQQAAALTELQGALFTNDLDPIGGNPDGSLTLVEFFDYNCGYCKRSNSVLQ 116

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN 148
             + D                 +                             ++     +
Sbjct: 117 ALIADNPNLRVV--------YKEWPILSETSALAARVALAVNLKQPEYYEALHRAFLEAS 168

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
           S      + N+ K  G  +   +  L    +   ++     A +   I  TP F +G  +
Sbjct: 169 SLRSEKDVWNVVKKVGADRAIIEPALRAPEVEQHLQQTSVLA-QQLGITGTPAFIVGDQV 227

Query: 209 YLGDMSEGVFSKIIDSM 225
             G   +    + IDS 
Sbjct: 228 LKGAYPQEQIQQAIDSQ 244


>gi|212712953|ref|ZP_03321081.1| hypothetical protein PROVALCAL_04051 [Providencia alcalifaciens DSM
           30120]
 gi|212684431|gb|EEB43959.1| hypothetical protein PROVALCAL_04051 [Providencia alcalifaciens DSM
           30120]
          Length = 934

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/207 (11%), Positives = 60/207 (28%), Gaps = 14/207 (6%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +   E          +    A  +      IG KDA + +V +    C +C  F
Sbjct: 742 AIVALQAKQGEKQQAQMKQVLKDQHDALFNDPTSPRIGSKDAKLVLVNFTDFNCPYCKRF 801

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                + ++        +  +++  P    +++          + +   +  +      +
Sbjct: 802 DPLLEEMVKKNP----DVAVVIKYLPFKGETSLESSQLAMTLWQENPKAFLALHQKLMAK 857

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
              ++  N ++AL                          I+   + A     ++ TP   
Sbjct: 858 QGMLSDSNIKEALQATGNG---------KLKASDKSRAAIRKNLELA-NMLGVNGTPATL 907

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDST 230
           +G  +  G +    F +I+   +  + 
Sbjct: 908 VGDEMIPGAVDAQEFERIVKEQLSKAK 934


>gi|319893738|ref|YP_004150613.1| Protein-disulfide isomerase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317163434|gb|ADV06977.1| Protein-disulfide isomerase [Staphylococcus pseudintermedius
           HKU10-03]
          Length = 229

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 75/237 (31%), Gaps = 18/237 (7%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           ++   +  ++  +V+L    +F      ++          +     +          + G
Sbjct: 1   MLKKNKWLIIFIVVILVAGIFFSLATFKTSKKGNSGSGETLAAETQMQ--------PTQG 52

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
           +KD+ V +VE+    C +C +F       LE +YI   K+ +      +    +     A
Sbjct: 53  KKDSKVLLVEFGDFKCPYCGDFERNIKPKLEKEYIDNNKVEFRYVNVLIHGEESELGAKA 112

Query: 122 RCAEKR-MDGGYWGFVSLLFNKQDDWINSKNYRDALLNM------AKFAGFSKNDFDTCL 174
             A  +     YW F   LF +Q +  +    +  L +        K     +      +
Sbjct: 113 ALAVNQYAPDKYWQFHHALFEQQPNNKDDVGSQHWLTDDLIQQQLQKLDLSEQERKQITV 172

Query: 175 NDQNILDDIKAGKKR---ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             ++    I    +     ++   +   P  ++ G     +         ID  ++ 
Sbjct: 173 AYRDEKGAIAKRAQEDHALAKKEEVPYVPALYVNGKQVEDETDFDAIKNEIDKALEQ 229


>gi|167957040|ref|ZP_02544114.1| DSBA oxidoreductase [candidate division TM7 single-cell isolate
           TM7c]
 gi|169836144|ref|ZP_02869332.1| hypothetical protein cdivTM_03353 [candidate division TM7
           single-cell isolate TM7a]
          Length = 227

 Score = 86.6 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 74/231 (32%), Gaps = 4/231 (1%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           MV+  +R+  +  I++  +A             E      +    + +      +  VS 
Sbjct: 1   MVVPKSRVVFVTLILIFLVAVGVLILNNFFFRGENRNQTSIRSTSSSITKENPNLGSVS- 59

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
             + A ++++ Y  + C  C   H +    +   Y+ T K +   +        +++   
Sbjct: 60  -NQKA-ISIIVYLDLLCPDCERAHREILPRIIKDYVDTNKAKVSYKILGTYGPESMSAGN 117

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A               +           S      L N+A+       ++  C++     
Sbjct: 118 ATYCADEQGKMLDFIKNAYEIAARSNNVSPFSNIGLTNIARKTSLKIPEWQDCVSKSKYT 177

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
             I   K+   +      TP F I G  Y G     +F  +I+S I +  +
Sbjct: 178 SKINKNKQEVLDTGG-YGTPHFIIEGKGYNGAPPYDIFVPVIESAIAEKVK 227


>gi|53803235|ref|YP_115007.1| thiol:disulfide interchange protein DsbA [Methylococcus capsulatus
           str. Bath]
 gi|53756996|gb|AAU91287.1| thiol:disulfide interchange protein DsbA [Methylococcus capsulatus
           str. Bath]
          Length = 216

 Score = 86.6 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/223 (13%), Positives = 59/223 (26%), Gaps = 17/223 (7%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEY 72
           G+ + F+A +        A  E        D+  +    P+T            V ++E+
Sbjct: 5   GLGVAFLALFSSLLSAAPAPAETQEYTAGKDYEVINPPQPTTDPS--------KVEVLEF 56

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGY 132
               C HC  F      +      K   + +I +    +                  G  
Sbjct: 57  FWYGCPHCYHFEPDLNAW---LKTKPDNVVFIRQPAVFNERWAAHAK--MFYTAEALGVL 111

Query: 133 WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASE 192
                  +        +    D         G +K+ F        +   ++  +   + 
Sbjct: 112 DKLHPQFYEAIQVKKLALASEDEQAKFFTEHGVTKDAFQKAYKSFAVDAKMRQAEGMGA- 170

Query: 193 DFAIDSTPVFFIGGNL-YLG--DMSEGVFSKIIDSMIQDSTRR 232
            + I  TP   + G     G    S      I + +I   + +
Sbjct: 171 RYGISGTPTLVVNGKYRVSGSLAKSYPNMIAITNYLIAKESGK 213


>gi|307701545|ref|ZP_07638562.1| DsbA-like protein [Mobiluncus mulieris FB024-16]
 gi|307613224|gb|EFN92476.1| DsbA-like protein [Mobiluncus mulieris FB024-16]
          Length = 308

 Score = 86.6 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/208 (14%), Positives = 64/208 (30%)

Query: 18  FIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTC 77
             A              LP+ +                   ++G+  APVT+   +  +C
Sbjct: 95  LAAFVAETGLAPGQDFALPLSEENGRKALKQTQKDLDAPTRTLGKDSAPVTLTVMSDFSC 154

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS 137
             C  +  +T   LE+           +            +           G  W FV 
Sbjct: 155 PMCTRWEQQTLPALEELAAAGDVKLQWVNLVIFAEQYRSDIAAHGAIAAGKQGKLWEFVH 214

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
             +    +  +++  ++++  MAK AG    +        +  +     + R++    I+
Sbjct: 215 AAYGAAGEGNHAEYTKESVTEMAKAAGVPDIEKFKTDLTSDETEKQMQDESRSARRLGIN 274

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            TP F +G ++  G      F+  I   
Sbjct: 275 GTPFFIVGDSVISGAYPTEYFANTIKYQ 302


>gi|227876800|ref|ZP_03994909.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35243]
 gi|269976327|ref|ZP_06183323.1| dsba thioredoxin domain-containing protein [Mobiluncus mulieris
           28-1]
 gi|306817747|ref|ZP_07451489.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239]
 gi|227842697|gb|EEJ52897.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35243]
 gi|269935656|gb|EEZ92194.1| dsba thioredoxin domain-containing protein [Mobiluncus mulieris
           28-1]
 gi|304649561|gb|EFM46844.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239]
          Length = 308

 Score = 86.6 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/208 (14%), Positives = 64/208 (30%)

Query: 18  FIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTC 77
             A              LP+ +                   ++G+  APVT+   +  +C
Sbjct: 95  LAAFVAETGLAPGQDFALPLSEENGRKALKQTQKDLDAPTRTLGKDSAPVTLTVMSDFSC 154

Query: 78  FHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS 137
             C  +  +T   LE+           +            +           G  W FV 
Sbjct: 155 PMCTRWEQQTLPALEELAAAGDVKLQWVNLVIFAEQYRSDIAAHGAIAAGKQGKLWEFVH 214

Query: 138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
             +    +  +++  ++++  MAK AG    +        +  +     + R++    I+
Sbjct: 215 AAYGAAGEGNHAEYTKESVTEMAKAAGVPDIEKFKTDLTSDETEKQMQDESRSARRLGIN 274

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            TP F +G ++  G      F+  I   
Sbjct: 275 GTPFFIVGDSVISGAYPTEYFANTIKYQ 302


>gi|163847385|ref|YP_001635429.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
 gi|163668674|gb|ABY35040.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
          Length = 242

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 84/233 (36%), Gaps = 16/233 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP----------- 52
           S  R  +L  IVLL   S        +  + +P            +              
Sbjct: 10  SMVRRLILSFIVLLTACSAPAAMSPTATPSPVPTRAPTSTPTTADSTPVVAGYFPDLPRG 69

Query: 53  -STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
            +      +G+ DAPVTMV Y+   C  CA         L + ++ TG++R + R     
Sbjct: 70  RTPEGYHYLGRPDAPVTMVIYSDFLCTSCAIHTLDVEPRLIEAFVATGQMRLVYRHLLQL 129

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
              +  +  A          +     +            N R+ ++++A   G  ++ F 
Sbjct: 130 GERSQILAEASECASDFGYFWELRREIYARY---NQLYFNTRETVIDLAAGLGIPRDAFT 186

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           TCL+       ++A    A E+  + + PVF IG  + +G      F+++I+ 
Sbjct: 187 TCLDSHTYQAQVQADYAAAIEE-GVYARPVFRIGTEVIVGSQRFETFAQVIER 238


>gi|119485197|ref|ZP_01619582.1| DSBA oxidoreductase [Lyngbya sp. PCC 8106]
 gi|119457425|gb|EAW38550.1| DSBA oxidoreductase [Lyngbya sp. PCC 8106]
          Length = 263

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/182 (13%), Positives = 57/182 (31%), Gaps = 8/182 (4%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
              +       + G     + ++E++   C  C+  H    ++++    +   +   L  
Sbjct: 90  TDPAAIIGSSPTTGASSQEIVLLEFSDFQCPFCSRAHQTIKQFMDKHQGQVTLVYKHLPL 149

Query: 108 FPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK 167
             +                +  G +W +   LF +Q+         D  + +A       
Sbjct: 150 SQIHPE--ALPSAKASWAAQQQGKFWEYQDALFTQQEQLG-----EDLYIEIANNLNLDL 202

Query: 168 NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             F+     Q     I+   + A +   I  TP F + G  + G +      +++  +  
Sbjct: 203 EQFNRDRQSQEAATSIQKDLELA-QALGISGTPFFVMNGETFSGAVELSKMEEVLAQVSS 261

Query: 228 DS 229
            S
Sbjct: 262 KS 263


>gi|24212827|ref|NP_710308.1| hypothetical protein LA_0127 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24193480|gb|AAN47326.1| hypothetical protein LA_0127 [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 404

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 76/232 (32%), Gaps = 15/232 (6%)

Query: 8   IGVLGGIVLLF----IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           I +L   VL      I++       G+A  E  I + + +F  +   S        +G  
Sbjct: 174 IVILSFFVLGLYGGKISTGGARLVSGAANGEKSISEQLKEFGTIPTVSIDLKDVPVVGDP 233

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +AP+T+V+YA   C HC        K    +Y    K+ Y       +    V       
Sbjct: 234 NAPITIVKYADFNCGHCMHTSK-ILKSFLSEYNGIIKVAYKNFPLDGNCNRLVGRKSPEA 292

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM-------AKFAGFSKNDFDTCLND 176
           +                          +    +++        A+  G + N F +C++ 
Sbjct: 293 SSCVAASAALCANEQKKFYPIYTGLYDDNEAGVMHTAVTVTRLAEKNGLNMNQFRSCMSS 352

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL--GDMSEGVFSKIIDSMI 226
             I D I      A E   I+STP  FI        G  +     ++I  +I
Sbjct: 353 TKIRDQINREVDEA-EKLKINSTPTLFINSKPLPKSGTPNVDFLHQLIRQLI 403


>gi|163747588|ref|ZP_02154936.1| DSBA oxidoreductase [Oceanibulbus indolifex HEL-45]
 gi|161379113|gb|EDQ03534.1| DSBA oxidoreductase [Oceanibulbus indolifex HEL-45]
          Length = 220

 Score = 86.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 59/211 (27%), Gaps = 12/211 (5%)

Query: 17  LFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMT 76
           +F+A  +F +R          P    D                +G++DAPVT+VE+    
Sbjct: 17  VFVAGAWFVSRPDPTPVATAAPLEQQD-------RLVRSYSPILGREDAPVTIVEFFDPA 69

Query: 77  CFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV 136
           C  C  FH    + L         +                + +      R+   +   +
Sbjct: 70  CEACRAFHPIVKQILTQYPDDVRVVMRYTPFHGEG----SELAIKVLEAARLQDVFVPVL 125

Query: 137 SLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAI 196
             L   Q  W +        +     A                +  +    +   E   I
Sbjct: 126 EALLENQPAWASHGAPAAERIMEIAGAAGLDTAAAADQIRSPSIVGVLNQDRADVEAVGI 185

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
             TP FF+ G     +        ++ + ++
Sbjct: 186 QGTPTFFVNGKPLP-EFGAEQLLSLVQAEVE 215


>gi|283853886|ref|ZP_06371100.1| DSBA oxidoreductase [Desulfovibrio sp. FW1012B]
 gi|283570728|gb|EFC18774.1| DSBA oxidoreductase [Desulfovibrio sp. FW1012B]
          Length = 262

 Score = 86.2 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 73/196 (37%), Gaps = 7/196 (3%)

Query: 28  KGSALNELPIPDGVVDFRALLAASPSTMKDV-SIGQKDAPVTMVEYASMTCFHCAEFHNK 86
             +   +  +              P+      S+G ++APVT+VEY+   C  CA+    
Sbjct: 58  NAARARQRTLERARFASELAKPLKPAMDPGRASLGPQNAPVTIVEYSDFLCHFCAQAAGT 117

Query: 87  TFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW 146
             K         G++R + + F        A +       +     W F+ + F++Q D 
Sbjct: 118 VQKL---LERHPGEVRLVFKHFATGKNDVRAALYFEALNLQDPKKAWAFMEMAFSRQKDV 174

Query: 147 INSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                  +AL  MAK  G  +      L  +++ D I +  K A  +F  + TPVF + G
Sbjct: 175 AEKG--EEALAAMAKELGADQKRLAEDLKRKDLADRIDSDVKEA-RNFGFEGTPVFLVNG 231

Query: 207 NLYLGDMSEGVFSKII 222
               G +      + +
Sbjct: 232 APVRGAVPLEALEEYV 247


>gi|45656025|ref|YP_000111.1| hypothetical protein LIC10115 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45599258|gb|AAS68748.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 404

 Score = 86.2 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 75/232 (32%), Gaps = 15/232 (6%)

Query: 8   IGVLGGIVLLF----IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
           I +L   VL      I++       G+A  E  I + + +F      S        +G  
Sbjct: 174 IVILSFFVLGLYGGKISTGGARLVSGAANGEKSISEQLKEFGTTPTVSIDLKDVPVVGDP 233

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           +AP+T+V+YA   C HC        K    +Y    K+ Y       +    V       
Sbjct: 234 NAPITIVKYADFNCGHCMHTSK-ILKSFLSEYNGIIKVAYKNFPLDGNCNRLVGRKSPEA 292

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNM-------AKFAGFSKNDFDTCLND 176
           +                          +    +++        A+  G + N F +C++ 
Sbjct: 293 SSCVAASAALCANEQKKFYPVYTGLYDDNEAGVMHTAVTVTRLAEKNGLNMNQFRSCMSS 352

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL--GDMSEGVFSKIIDSMI 226
             I D I      A E   I+STP  FI        G  +     ++I  +I
Sbjct: 353 TKIRDQINREVDEA-EKLKINSTPTLFINSKPLPKSGTPNVDFLHQLIRQLI 403


>gi|254293429|ref|YP_003059452.1| DsbA oxidoreductase [Hirschia baltica ATCC 49814]
 gi|254041960|gb|ACT58755.1| DsbA oxidoreductase [Hirschia baltica ATCC 49814]
          Length = 236

 Score = 85.8 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 48/215 (22%), Positives = 82/215 (38%), Gaps = 9/215 (4%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           LL   +    T   S  +  P+    V   ++         DV +G  DA V +VEYAS 
Sbjct: 6   LLSAIAIAALTVGCSQADSKPVAANDVKGSSVS----YVAGDVILGNADAKVQIVEYAST 61

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C HC  FH      ++  +I+ G +  I R+ P       A   A       D  Y   
Sbjct: 62  ACGHCRTFHKTILPNIKKDFIENGSVSLIYRDLPTPPAQLAAAGAALARCAGKDEYYKVL 121

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAK---FAGFSKNDFDTCLNDQNILDDIKAGKKRASE 192
             +  ++ + +  +++   AL    +     G S+     C+    +L++I      A +
Sbjct: 122 DDVFTSQGEIFDAARSAGGALPAYNEIGARHGMSEETVKACVTSTEVLNEISRTSDLA-Q 180

Query: 193 DFAIDSTPVFFIGGNLYLG-DMSEGVFSKIIDSMI 226
              + STP  FI G      DMS    + +++  +
Sbjct: 181 AAGVTSTPTLFIDGVKVEAKDMSNEGIAALLNDAL 215


>gi|192289624|ref|YP_001990229.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
 gi|192283373|gb|ACE99753.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
          Length = 217

 Score = 85.8 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 74/230 (32%), Gaps = 18/230 (7%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR      +      +      K  A    P  + V+   A+L  +         G 
Sbjct: 1   MMITRRS---AVTAALALAPTLVAAKAWAAPTAPDAEDVLSTDAVLYDAEI----PVAGN 53

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
               +T+VE++   C +C +      + +++       +R +L+++P+    +V      
Sbjct: 54  PKGDITIVEWSDYRCPYCKKVAPDLTQVVKEDGN----IRLVLKDWPIFGGVSVDAAKMV 109

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC-LNDQNILD 181
                     +    L  ++      SK     L    K  G   +        ++  ++
Sbjct: 110 L------ASKYQGKFLQAHEALIGSTSKLTETTLNETLKAGGIDVDRATKDLDANRATIE 163

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            I       ++ F    TP F +G     G +   +F + I    + + +
Sbjct: 164 AILKRNDTQAKAFGFQGTPSFIVGRFRVPGVLDVALFKQAIKDAREAAKK 213


>gi|90417709|ref|ZP_01225621.1| outer membrane protein, putative [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337381|gb|EAS51032.1| outer membrane protein, putative [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 265

 Score = 85.8 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/198 (11%), Positives = 57/198 (28%), Gaps = 9/198 (4%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
           +                +  A   T +   +G  D  VT+VE+    C  C +       
Sbjct: 71  AKRTADQSAAQKAAVAEVGPALFETPEGTVLGNPDGDVTVVEFFDYNCGFCKKAMQDMDS 130

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            +         L+ I    P    +    +                    +++       
Sbjct: 131 LIAADPNIRFVLKEIPVLGPQSLEAARVSL--------AFREIAPNEYAAYHRALLGSRG 182

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
                + + +A+  G  +    T +    + + ++   + A+    I+ TP + +G  + 
Sbjct: 183 TADEASAIAVAQDFGVEEAALRTAMQSSAVTEALRQSNEMAT-RLGINGTPSYVVGEEVV 241

Query: 210 LGDMSEGVFSKIIDSMIQ 227
            G +        I ++ +
Sbjct: 242 SGAVGLDNLQASIANVRE 259


>gi|77454799|ref|YP_345667.1| putative disulfide bond formation protein [Rhodococcus erythropolis
           PR4]
 gi|77019799|dbj|BAE46175.1| putative thiol-disulfide oxidoreductase [Rhodococcus erythropolis
           PR4]
          Length = 244

 Score = 85.8 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 74/199 (37%), Gaps = 1/199 (0%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
            T   ++  E  +            +  +    ++IG  DAPV M+ ++   C  CA+F 
Sbjct: 42  ATAGATSSAEPEVGATPATGPLGDLSRRTVDDPMAIGAVDAPVVMIAFSDFRCPFCAQFS 101

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
            +T   L D+Y+  G LR   R+ P+    +                +W F + ++    
Sbjct: 102 RETEPQLIDRYVDEGTLRIEWRDLPIFGQQS-FDAARAGRAAAAQDKFWEFTNAVYAGAP 160

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
           +  ++    +AL   A+ AG    +  T        D         ++   I +TP F +
Sbjct: 161 ETGHADLTIEALEAYAQQAGVPDLERFTTEATGTSFDSAITSDSDEAQSLGIPATPAFSV 220

Query: 205 GGNLYLGDMSEGVFSKIID 223
            G+  LG      F  +ID
Sbjct: 221 NGDPVLGAQPLSTFVDLID 239


>gi|332528887|ref|ZP_08404857.1| disulfide isomerase-like protein [Hylemonella gracilis ATCC 19624]
 gi|332041644|gb|EGI78000.1| disulfide isomerase-like protein [Hylemonella gracilis ATCC 19624]
          Length = 223

 Score = 85.8 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 32/220 (14%), Positives = 63/220 (28%), Gaps = 14/220 (6%)

Query: 12  GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVE 71
             +V +F+     Y R     +   +        A+ +     M     G +DAPVT+VE
Sbjct: 18  ITVVAVFVLGVITYQRHERDASSRLL--------AVHSQRLVRMHAAVAGPQDAPVTIVE 69

Query: 72  YASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGG 131
           +    C  C  FH      L     +   +                 ++      +  G 
Sbjct: 70  FFDPACETCRAFHPIVKDLLRQYPKEVRLVVRYA-----PFHPGSDDVVRLLEAAKRQGK 124

Query: 132 YWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRAS 191
           YW  + ++   Q  W +           A        +          ++ +        
Sbjct: 125 YWEVLDMVLAAQPLWADHGQPDVGKAYAAAAQTGLNLEQALADAASAGIESVLRQDIEDL 184

Query: 192 EDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
               ++ TP FF+ G        E    +++   +  + R
Sbjct: 185 TALGVNKTPTFFVNGQSLP-SFGEEPLRRLVAEEVARAQR 223


>gi|15805779|ref|NP_294477.1| hypothetical protein DR_0753 [Deinococcus radiodurans R1]
 gi|6458464|gb|AAF10332.1|AE001931_3 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 262

 Score = 85.8 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 62/178 (34%), Gaps = 9/178 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKL-------RYILREFPL 110
              GQ +APV ++      C +C  F       L  KY+ TGK+        ++    P 
Sbjct: 85  PYAGQANAPVNVLVVEDFKCPNCKSFEETVAPELRTKYVGTGKVKMYSLVYPFLADRLPE 144

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
           D     A        +  +  +  +  +LF  Q         +  L  +A      +  F
Sbjct: 145 DDSKYAAQAARCVYAQGKNDAFNTYKEILFRAQGPETEVWATKSRLKELATSLDIDQAKF 204

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE-GVFSKIIDSMIQ 227
            TCL++      ++  K+ A +   +  TP  F+ G L           S  ID  ++
Sbjct: 205 ATCLDNDETAAQVETDKQEALKA-GVGGTPTVFVNGKLVNVQSDYVKDISAAIDEALK 261


>gi|289628806|ref|ZP_06461760.1| hypothetical protein PsyrpaN_27325 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|330869792|gb|EGH04501.1| hypothetical protein PSYAE_21605 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 227

 Score = 85.8 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 67/230 (29%), Gaps = 15/230 (6%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +MS TR  +L GI  + +A   F       L ++     +++  +  +           G
Sbjct: 1   MMSPTRRQILYGIGAVALAILAF-----ECLPDVRQAMQMLNTVSQTSKQTKHNGAWVYG 55

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
              A  T+VEYA + C +C ++  +   +++        +       PL      A   A
Sbjct: 56  SSSARFTIVEYADLECPYCKDYFPQLKAWVDQHP----DVNLQWHHLPLPMHEPTASYEA 111

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
           R AE            L          S     A           ++  D C +      
Sbjct: 112 RWAECAGIERGNDAFWLAVELIYQRTRSNGAGTAGNPQIPGLEDRQHFVDNCASSNPAAR 171

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIIDSM 225
                +   +    I +TP   I            G     V    ID +
Sbjct: 172 QTVVSQAHKASLDGITATPTLVIKDKHSGRTIKLQGAPDGDVLLSAIDWL 221


>gi|302383807|ref|YP_003819630.1| disulfide isomerase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194435|gb|ADL02007.1| putative disulfide isomerase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 205

 Score = 85.4 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 80/199 (40%), Gaps = 3/199 (1%)

Query: 34  ELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLED 93
            L +       +   A    T  D  +GQ +APVT++EYAS+ C HC ++H   +   + 
Sbjct: 10  ALTMAPMAAVAQTPGALPAVTASDRILGQANAPVTVIEYASLVCSHCGDWHRTVYPEFKR 69

Query: 94  KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR 153
           ++I TG++R + R+ P       A              ++  +   F  Q+         
Sbjct: 70  QFIDTGRVRMVFRDLPTAPAPVAARAAGIA-RCAAPNRFYEVIGTFFRGQEALFAGGPVA 128

Query: 154 DALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
               +    +G ++ + D CL D   L+ ++A     +    ++ TP FF+ G     D+
Sbjct: 129 PWFASGVAASGRTQAEIDACLADPATLEGLRASIA-GATAAGVEGTPTFFVNGRRVT-DI 186

Query: 214 SEGVFSKIIDSMIQDSTRR 232
           S    +  I      + RR
Sbjct: 187 SLAGLTAAITPSPTPARRR 205


>gi|225631144|ref|ZP_03787856.1| hypothetical protein WUni_003070 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225591158|gb|EEH12328.1| hypothetical protein WUni_003070 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 203

 Score = 85.4 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 83/187 (44%), Gaps = 14/187 (7%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD   
Sbjct: 16  PDDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRG 75

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTC 173
                            Y+ F   +FN  D W          L  +A  +   ++ F+ C
Sbjct: 76  L--KAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQC 133

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFI-----------GGNLYLGDMSEGVFSKII 222
           +ND+ I+D I   K  A     I +TP+FFI               + G      F+ +I
Sbjct: 134 INDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVI 193

Query: 223 DSMIQDS 229
           D +   +
Sbjct: 194 DKLYGKA 200


>gi|153206717|ref|ZP_01945558.1| putative disulfide bond formation protein D [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154706029|ref|YP_001424334.1| thiol:disulfide interchange protein [Coxiella burnetii Dugway
           5J108-111]
 gi|165918535|ref|ZP_02218621.1| putative disulfide bond formation protein D [Coxiella burnetii RSA
           334]
 gi|120577080|gb|EAX33704.1| putative disulfide bond formation protein D [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154355315|gb|ABS76777.1| thiol:disulfide interchange protein [Coxiella burnetii Dugway
           5J108-111]
 gi|165917781|gb|EDR36385.1| putative disulfide bond formation protein D [Coxiella burnetii RSA
           334]
          Length = 218

 Score = 85.4 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 84/233 (36%), Gaps = 17/233 (7%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           M  +  +  VL  +V+  I S         A              AL A +  T    ++
Sbjct: 1   MQKTFVKPLVLITVVIALIMSAIALALSKPA--------------ALKATTIDTKGQPTL 46

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G   APV +V +  + C +CA F+ +    ++ KYI TG  +YIL        S  A   
Sbjct: 47  GNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYILITLAFLPGSPPAGNA 106

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQN 178
           A C  K+    ++ FVS L+  Q D   +      LL  A+      +      C+    
Sbjct: 107 ALCLYKQNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVPQANMKQLSNCIFSSR 166

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
               ++   K A +     +TP  ++ G      +++     +I      +  
Sbjct: 167 YSGALQKNLKIAEKTMNPVATPAVYVNGVNVE-PLTQKRLEALIKGARSRAKN 218


>gi|262202577|ref|YP_003273785.1| DSBA oxidoreductase [Gordonia bronchialis DSM 43247]
 gi|262085924|gb|ACY21892.1| DSBA oxidoreductase [Gordonia bronchialis DSM 43247]
          Length = 214

 Score = 85.4 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/227 (12%), Positives = 58/227 (25%), Gaps = 13/227 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +    ++ +    V     +  F   +     +      +         S          
Sbjct: 1   MSRNVKMSLAAVFVFCLALTVVFVVSRAGEGEQSGDHASMTARPDSPRLSA--------- 51

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             ++  T VE+    C  C   +    +  +    +   + +++R FPL           
Sbjct: 52  PSESKATFVEFLDFECEGCGAAYPAVEQLRQTYGDQ---VTFVVRYFPLPGHFNADRAAR 108

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
             A     G +      +F  Q  W   +   D L            +      D     
Sbjct: 109 AVAAAAEQGQFEPMYRKMFVTQRSWGEQRVPLDDLFFSYAQELGLNMERFAAAYDSQATR 168

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
           ++        +   +  TP FFI              S  ++S I+ 
Sbjct: 169 ELIDRDVADGKALGVTGTPTFFINDERIT-PEGYDNLSSALESAIRQ 214


>gi|37521061|ref|NP_924438.1| hypothetical protein glr1492 [Gloeobacter violaceus PCC 7421]
 gi|35212057|dbj|BAC89433.1| glr1492 [Gloeobacter violaceus PCC 7421]
          Length = 261

 Score = 85.4 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 60/185 (32%), Gaps = 9/185 (4%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
           +             ++G  DA +T+VE++   C +C+   +     LE    +   +   
Sbjct: 85  QLENPVKVDLQGAPTLGPADAALTLVEFSDFQCPYCSRAQSTVKALLEKYKGRIRLVYLH 144

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
           L           A+      E+     Y   +  L  +           ++   +A+   
Sbjct: 145 LPLPVHSQAKAAALAAFAAGEQGKFFAYHDRLFALGEQ--------LVPESFEQIARELN 196

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
                F+        L  ++A   +A     +D+TP F + G +  G +    F + I  
Sbjct: 197 LDVARFNRDRESPQALARLEADLAQA-RRLELDATPSFVLNGIVLKGALPIEEFEEAIKL 255

Query: 225 MIQDS 229
           +   S
Sbjct: 256 LQSKS 260


>gi|317486445|ref|ZP_07945271.1| DSBA-like thioredoxin domain-containing protein [Bilophila
           wadsworthia 3_1_6]
 gi|316922301|gb|EFV43561.1| DSBA-like thioredoxin domain-containing protein [Bilophila
           wadsworthia 3_1_6]
          Length = 294

 Score = 85.4 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 66/181 (36%), Gaps = 4/181 (2%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
                       G  DAPVT+V Y+  TC +C +      K         GK++Y+ + F
Sbjct: 113 PKEVDIKDRPFRGAADAPVTIVAYSDFTCPYCQQAAGTMEKV---LKENLGKIKYVFKHF 169

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
           PL++     +                +              K+   A++N AK AG +  
Sbjct: 170 PLETTGAARLAAEYHVAAARQDPELAWKFYDLLFARRADVLKDGEPAIVNAAKDAGLNMK 229

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
                +  +++  ++ A      +   +  TP F I   +  G +S  +F + I+  +Q 
Sbjct: 230 KLAADVKRKDVRAEVDADIAEG-QRIGVQGTPYFLINNLVARGALSSDLFKEAINMALQA 288

Query: 229 S 229
           +
Sbjct: 289 A 289


>gi|163759366|ref|ZP_02166452.1| putative outer membrane protein [Hoeflea phototrophica DFL-43]
 gi|162283770|gb|EDQ34055.1| putative outer membrane protein [Hoeflea phototrophica DFL-43]
          Length = 266

 Score = 85.4 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 58/204 (28%), Gaps = 9/204 (4%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +  +E      +        A  +  +D++IG  +  +T+VE+    C  C   
Sbjct: 66  VQQVLQAKRDEEAQKLALAAIDENREAIFNAPEDMTIGNPNGDITLVEFFDYNCGFCKRA 125

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                K LE        L+      P            + +          +        
Sbjct: 126 MEDVVKILEADNNVRVVLKEFPILGPDSL------AAHQVSMAFRKLAPEQYGDYHMA-- 177

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
               + +      + +A   G  +      + D  I D I+     A +   I  TP F 
Sbjct: 178 LLGADVRATEALAIELALEYGVEEEALRAGIADPAIGDSIRKAYTLA-DALGISGTPSFV 236

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQ 227
           IG     G +        I++M Q
Sbjct: 237 IGDETVFGAVGSDTLLAKINNMRQ 260


>gi|312198725|ref|YP_004018786.1| DSBA oxidoreductase [Frankia sp. EuI1c]
 gi|311230061|gb|ADP82916.1| DSBA oxidoreductase [Frankia sp. EuI1c]
          Length = 357

 Score = 85.0 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 49/186 (26%), Gaps = 9/186 (4%)

Query: 37  IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
                 D    LAA        S G+  APV +VEY    C +CA+      + +E    
Sbjct: 73  AAPVDRDGANGLAAPVRLDDRPSRGELTAPVVLVEYGDFECPYCAQAAPVLHELVETCGG 132

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
               +         +                    +W     LF  Q         +D  
Sbjct: 133 LVRHVFRHFPL--FEVHPYALTAALAAEVAHAHDRFWPMHDQLFAYQSRL------KDID 184

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
           L M         +       Q     ++A  +       +  TP  FI G  Y G     
Sbjct: 185 LRMRAERLGLDPELVVGAAAQPYGAAVEADYEHGV-GVGVRGTPTIFINGQAYRGRTELP 243

Query: 217 VFSKII 222
              + +
Sbjct: 244 ALRRAV 249


>gi|170783454|ref|YP_001741947.1| putative oxidoreductase [Arthrobacter sp. AK-1]
 gi|150034941|gb|ABR66952.1| putative oxidoreductase [Arthrobacter sp. AK-1]
          Length = 229

 Score = 85.0 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 64/223 (28%), Gaps = 14/223 (6%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
                 +LG  V   +  Y  +T        L         R       S   +      
Sbjct: 18  RMITWVILGIAVAAGLIWYAVFTANKPEPAALQPVGDAQLVREDSHRVTSPAVE------ 71

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
                +VE+    C  C        +    K     ++ ++ R FPL   +         
Sbjct: 72  --KAQLVEFLDFECESCRAAEPLVQEL---KQEYGDRITFVHRYFPLPGHANSGPAALAV 126

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQNILDD 182
                 G Y    + LF  Q  W   ++ +  L            + +D  + D+   + 
Sbjct: 127 EAAARQGKYEQMAAKLFESQPQWGEKQDSQATLFRTYAQELGLDLSQYDATIADEATKER 186

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           I        +   +  TP FF+ G     + SE  F +++D  
Sbjct: 187 ILQDVADG-KALGVTGTPTFFLNGQKLTLN-SEEQFRQLLDEA 227


>gi|23501795|ref|NP_697922.1| outer membrane protein [Brucella suis 1330]
 gi|148559988|ref|YP_001258886.1| putative outer membrane protein [Brucella ovis ATCC 25840]
 gi|161618867|ref|YP_001592754.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
 gi|225852421|ref|YP_002732654.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
 gi|254689158|ref|ZP_05152412.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|254693641|ref|ZP_05155469.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|254704216|ref|ZP_05166044.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|254706882|ref|ZP_05168710.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|254710010|ref|ZP_05171821.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|256031505|ref|ZP_05445119.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|256044582|ref|ZP_05447486.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113455|ref|ZP_05454296.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|256159630|ref|ZP_05457392.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|256254910|ref|ZP_05460446.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|256257408|ref|ZP_05462944.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|256264081|ref|ZP_05466613.1| DSBA oxidoreductase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369337|ref|YP_003106845.1| outer membrane protein, putative [Brucella microti CCM 4915]
 gi|260563933|ref|ZP_05834419.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|260566536|ref|ZP_05837006.1| DSBA oxidoreductase [Brucella suis bv. 4 str. 40]
 gi|260754657|ref|ZP_05867005.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260883683|ref|ZP_05895297.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|261213907|ref|ZP_05928188.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|261222092|ref|ZP_05936373.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|261314347|ref|ZP_05953544.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|261317558|ref|ZP_05956755.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261754884|ref|ZP_05998593.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|265988592|ref|ZP_06101149.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|265991006|ref|ZP_06103563.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994843|ref|ZP_06107400.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|265998057|ref|ZP_06110614.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|294852264|ref|ZP_06792937.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|297248257|ref|ZP_06931975.1| outer membrane protein [Brucella abortus bv. 5 str. B3196]
 gi|23347726|gb|AAN29837.1| outer membrane protein, putative [Brucella suis 1330]
 gi|148371245|gb|ABQ61224.1| putative outer membrane protein [Brucella ovis ATCC 25840]
 gi|161335678|gb|ABX61983.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
 gi|225640786|gb|ACO00700.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
 gi|255999497|gb|ACU47896.1| outer membrane protein, putative [Brucella microti CCM 4915]
 gi|260153949|gb|EEW89041.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|260156054|gb|EEW91134.1| DSBA oxidoreductase [Brucella suis bv. 4 str. 40]
 gi|260674765|gb|EEX61586.1| DSBA oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260873211|gb|EEX80280.1| DSBA oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|260915514|gb|EEX82375.1| DSBA oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|260920676|gb|EEX87329.1| DSBA oxidoreductase [Brucella ceti B1/94]
 gi|261296781|gb|EEY00278.1| DSBA oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261303373|gb|EEY06870.1| DSBA oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|261744637|gb|EEY32563.1| DSBA oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|262552525|gb|EEZ08515.1| DSBA oxidoreductase [Brucella ceti M490/95/1]
 gi|262765956|gb|EEZ11745.1| DSBA oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|263001790|gb|EEZ14365.1| DSBA oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094285|gb|EEZ18146.1| DSBA oxidoreductase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660789|gb|EEZ31050.1| DSBA oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|294820853|gb|EFG37852.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|297175426|gb|EFH34773.1| outer membrane protein [Brucella abortus bv. 5 str. B3196]
 gi|326408931|gb|ADZ65996.1| DSBA oxidoreductase [Brucella melitensis M28]
 gi|326538646|gb|ADZ86861.1| DSBA oxidoreductase [Brucella melitensis M5-90]
          Length = 265

 Score = 85.0 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 50/179 (27%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E+    C +C          L+        L+      P   
Sbjct: 96  DPKHDAVFGNPNGDVTVYEFFDYNCGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSM 155

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   ++ +  A   G  +     
Sbjct: 156 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEESAIADAVKLGADEAKLRE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    + +
Sbjct: 208 KMKDPAITGAFQRTYQLA-QQLNITGTPSYVIGDELVPGAIGIDGLRQRIAAARDAAKK 265


>gi|254714012|ref|ZP_05175823.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|254716930|ref|ZP_05178741.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261218736|ref|ZP_05933017.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261321766|ref|ZP_05960963.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
 gi|260923825|gb|EEX90393.1| DSBA oxidoreductase [Brucella ceti M13/05/1]
 gi|261294456|gb|EEX97952.1| DSBA oxidoreductase [Brucella ceti M644/93/1]
          Length = 265

 Score = 85.0 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 50/179 (27%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E+    C +C          L+        L+      P   
Sbjct: 96  DPKHDAVFGNPNGDVTVYEFFDYNCGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSM 155

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   ++ +  A   G  +     
Sbjct: 156 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEESAIADAVKLGADEAKLRE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    + +
Sbjct: 208 KMKDPAITGAFQRTYQLA-QQLNITGTPSYVIGDELVPGAIGIDGLRQRIAAARDAAKK 265


>gi|299140116|ref|ZP_07033285.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX8]
 gi|298597962|gb|EFI54131.1| DSBA oxidoreductase [Acidobacterium sp. MP5ACTX8]
          Length = 178

 Score = 85.0 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 51/174 (29%), Gaps = 8/174 (4%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
            +  D   G+ +A  ++VEY    C  C E              +   +        +  
Sbjct: 8   VSKHDHLQGKLNAACSLVEYGDYECPSCGEVQPTIRSLQAHLGNRMSFVFRNFPLREIHP 67

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
                            G +W    LLF  Q+              + +  G + +    
Sbjct: 68  W--AEPAAEVAEFAGSQGKFWEMHDLLFANQESLD-----ESTFHALLEKLGLTDSGLQL 120

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
             +     + I A          ++ TP FF+ G+ Y G  +      +++ ++
Sbjct: 121 ARSSGTAKERIDADFTGGI-RSGVNGTPTFFLNGDRYDGPTNYESLVTLMEQVL 173


>gi|17987343|ref|NP_539977.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|17983027|gb|AAL52241.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
          Length = 250

 Score = 85.0 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 50/179 (27%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E+    C +C          L+        L+      P   
Sbjct: 81  DPKHDAVFGNPNGDVTVYEFFDYNCGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSM 140

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   ++ +  A   G  +     
Sbjct: 141 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEESAIADAVKLGADEAKLRE 192

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    + +
Sbjct: 193 KMKDPAITGAFQRTYQLA-QQLNITGTPSYVIGDELVPGAIGIDGLRQRIAAARDAAKK 250


>gi|256061014|ref|ZP_05451171.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|261325014|ref|ZP_05964211.1| DSBA oxidoreductase [Brucella neotomae 5K33]
 gi|261300994|gb|EEY04491.1| DSBA oxidoreductase [Brucella neotomae 5K33]
          Length = 265

 Score = 85.0 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 50/179 (27%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E+    C +C          L+        L+      P   
Sbjct: 96  DPKHDAVFGNPNGDVTVYEFFDYNCGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSM 155

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   ++ +  A   G  +     
Sbjct: 156 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEESAIADAVKLGADEAKLRE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    + +
Sbjct: 208 KMKDPAITGAFQRTYQLA-QQLNITGTPSYVIGDELVPGAIGIDGLRQRIAAAWDAAKK 265


>gi|303247776|ref|ZP_07334045.1| DSBA oxidoreductase [Desulfovibrio fructosovorans JJ]
 gi|302490860|gb|EFL50759.1| DSBA oxidoreductase [Desulfovibrio fructosovorans JJ]
          Length = 213

 Score = 85.0 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 26/221 (11%), Positives = 63/221 (28%), Gaps = 15/221 (6%)

Query: 10  VLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTM 69
           VL  +V+  +        + +   E P+           AA  +       G     VT+
Sbjct: 5   VLFALVVCLVLVAAIAPLRRAVATEQPVAVDSAAVFNDPAAPVT-------GNPKGDVTI 57

Query: 70  VEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMD 129
           VE++   C  C +      K ++       K+R + +++P+ + ++              
Sbjct: 58  VEFSDYNCPFCKQAAAALDKLVKSDG----KIRVVHKDWPVLTDASAYGARLAL----AA 109

Query: 130 GGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKR 189
           G    + ++            +    L  +                    +  +      
Sbjct: 110 GYQGKYAAVHAALMQIPGMRISKDRMLEAVKASGVDMDRLESDLKVHAKEIAALLERNSE 169

Query: 190 ASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
            +E   +  TP F +G  +    +    F +++        
Sbjct: 170 QAETLGLQGTPAFLVGPYIVPSALGYDDFKQVVADARTKMK 210


>gi|254719012|ref|ZP_05180823.1| DSBA oxidoreductase [Brucella sp. 83/13]
 gi|265984002|ref|ZP_06096737.1| DSBA oxidoreductase [Brucella sp. 83/13]
 gi|306840101|ref|ZP_07472887.1| DSBA oxidoreductase [Brucella sp. NF 2653]
 gi|264662594|gb|EEZ32855.1| DSBA oxidoreductase [Brucella sp. 83/13]
 gi|306404829|gb|EFM61122.1| DSBA oxidoreductase [Brucella sp. NF 2653]
          Length = 265

 Score = 85.0 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 50/179 (27%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E+    C +C          L+        L+      P   
Sbjct: 96  DPKHDAVFGNPNGDVTVYEFFDYNCGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSM 155

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   ++ +  A   G  +     
Sbjct: 156 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEESAIADAVKLGADEAKLRE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    + +
Sbjct: 208 KMKDPAITGAFQRTYQLA-QQLNISGTPSYVIGDELVPGAIGIDGLRERIAAARDAAKK 265


>gi|302038806|ref|YP_003799128.1| putative oxidoreductase [Candidatus Nitrospira defluvii]
 gi|300606870|emb|CBK43203.1| putative Oxidoreductase, DsbA-like [Candidatus Nitrospira defluvii]
          Length = 253

 Score = 85.0 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/204 (12%), Positives = 57/204 (27%), Gaps = 11/204 (5%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
                +                      +       G     VT+VE+    C +C    
Sbjct: 61  LQSLENKRAAEEQERQKAALATHQQELLNDPASPVSGNPAGDVTVVEFFDYRCGYCKRAA 120

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
           +   +  +       ++R + ++FP+   ++                        F++  
Sbjct: 121 SALTQLQQSDA----RVRVVYKDFPILGETSELAAK------AALASNLQGKHRAFHEAL 170

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                   ++ L  +A  AG   N  D  +        +   +  A +   I  TP F +
Sbjct: 171 LATKDDLTKEQLFRIAAEAGVDVNRLDQDMTRPEWQPILDRNRALA-KTLGISGTPAFIV 229

Query: 205 GGNLYLGDMSEGVFSKIIDSMIQD 228
           G +L  G +      +++    + 
Sbjct: 230 GNDLVPGALDLKTLQELVAHKRKQ 253


>gi|226331006|ref|ZP_03806524.1| hypothetical protein PROPEN_04936 [Proteus penneri ATCC 35198]
 gi|225201801|gb|EEG84155.1| hypothetical protein PROPEN_04936 [Proteus penneri ATCC 35198]
          Length = 243

 Score = 85.0 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/208 (12%), Positives = 60/208 (28%), Gaps = 14/208 (6%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
             T   +   +          +A   A  +      IG KDA + +V +    C +C  F
Sbjct: 50  AITALQAQKADEQQAQFRTALKAEHDALYNDAASPRIGAKDAKLVLVSFTDYNCPYCKRF 109

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                +  +D       +  +++  P    S+     A  +  + D   +  +     ++
Sbjct: 110 DPLLEQITKDYPE----VAVVIKPLPFKGESSAKASQAVLSVWKEDPKAFLALHQRLMQK 165

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
              +++ +  DA+           +D                     S    I  TP   
Sbjct: 166 KTMLDNASIDDAMKTTNTSKVKLTDDSLKT----------LQNNLDLSRKLGIQGTPATV 215

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +G  +  G +       I+   +    +
Sbjct: 216 VGDMVIPGAVDYAQLEVIVKEQLAKVKK 243


>gi|213966037|ref|ZP_03394226.1| dsba oxidoreductase [Corynebacterium amycolatum SK46]
 gi|213951332|gb|EEB62725.1| dsba oxidoreductase [Corynebacterium amycolatum SK46]
          Length = 331

 Score = 85.0 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 63/178 (35%), Gaps = 3/178 (1%)

Query: 56  KDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVST 115
              ++G  DAPV +  Y+   C  CA+F N+T   L +KY+  G +R    +  ++    
Sbjct: 149 DPFALGAVDAPVVISIYSDFECPFCAKFANETEPDLVEKYVNEGLVRLEWNDMAINGEKA 208

Query: 116 VAVMLARCAEKRMDGGYWGFVSLLFN--KQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                A  A       +    +L     ++         ++ +    +        F+  
Sbjct: 209 TKDAEAGRAAAAQGKFWEFSRALFKKAGEKGQGHPEFTEKELIAVAREAGVPDMKRFEKE 268

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           L D    + ++   +  S    I  TP F +G     G     VF   I+  +  + R
Sbjct: 269 LKDGKWTEAVENATQFGSM-LGISGTPGFLVGTQFVSGAQPLDVFEDNIELALIHAKR 325


>gi|62289852|ref|YP_221645.1| hypothetical protein BruAb1_0920 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699778|ref|YP_414352.1| DSBA oxidoreductase [Brucella melitensis biovar Abortus 2308]
 gi|189024094|ref|YP_001934862.1| DSBA oxidoreductase [Brucella abortus S19]
 gi|237815341|ref|ZP_04594339.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254697293|ref|ZP_05159121.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730191|ref|ZP_05188769.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260545401|ref|ZP_05821142.1| DSBA oxidoreductase [Brucella abortus NCTC 8038]
 gi|260757880|ref|ZP_05870228.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260761703|ref|ZP_05874046.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|62195984|gb|AAX74284.1| outer membrane protein, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82615879|emb|CAJ10883.1| DSBA oxidoreductase [Brucella melitensis biovar Abortus 2308]
 gi|189019666|gb|ACD72388.1| DSBA oxidoreductase [Brucella abortus S19]
 gi|237790178|gb|EEP64388.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260096808|gb|EEW80683.1| DSBA oxidoreductase [Brucella abortus NCTC 8038]
 gi|260668198|gb|EEX55138.1| DSBA oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260672135|gb|EEX58956.1| DSBA oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 265

 Score = 85.0 bits (208), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 50/179 (27%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E+    C +C          L+        L+      P   
Sbjct: 96  DPKHDAVFGNPNGDVTVYEFFDYNCGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSM 155

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   ++ +  A   G  +     
Sbjct: 156 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEESAIADAVKLGADEAKLRE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    + +
Sbjct: 208 KMKDPAITGAFQRTYQLA-QQLNITGTPSYVIGDELVPGAIGIDGLRQRIAAARDAAKK 265


>gi|330878722|gb|EGH12871.1| hypothetical protein PSYMP_22613 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 228

 Score = 85.0 bits (208), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 60/230 (26%), Gaps = 12/230 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TR  +L GI  + +A   F       + +        +  +              G
Sbjct: 1   MKRPTRRQILYGIGAVALAILAF--ECLPDVRQAMQMLNTAESVSKTTKQTKHNGAWVYG 58

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
              A  T+VEYA + C +C ++  +   +      +   +       PL      A   A
Sbjct: 59  SSSARFTIVEYADLECPYCKDYFPQLKAW----VDQHPDVNLQWHHLPLPMHEPTASYEA 114

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
           R AE     G      L          S                 +   D C +    + 
Sbjct: 115 RWAECAGIEGGNDVFWLAVELIYQRTRSNGAGATGNPQIPGFEDRQQYIDNCASSNPSVQ 174

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIIDSM 225
                +   +    I +TP   I            G     V    ID +
Sbjct: 175 RAVISQAHKASQDGITATPTLVIKDKHSGRTIKLQGAPDGDVLLSAIDWL 224


>gi|163795156|ref|ZP_02189124.1| putative outer membrane protein [alpha proteobacterium BAL199]
 gi|159179554|gb|EDP64083.1| putative outer membrane protein [alpha proteobacterium BAL199]
          Length = 250

 Score = 85.0 bits (208), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 57/203 (28%), Gaps = 11/203 (5%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
                +                 L+    +  D  +G  +  VT+VE+    C +C    
Sbjct: 56  VASIEARQKAQKEQAVQAAIAENLSVLERSSGDPVLGNPNGDVTVVEFFDYQCGYCKTMM 115

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
               + +         L+      P   V+                         F+   
Sbjct: 116 APLMELVHGDGNIRLVLKEFPILGPASLVAAR----------ASLAANMQGKYEPFHVTL 165

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
             +  +    A+   A  AG   +     + D  +   I A  + A +   I+ TP F I
Sbjct: 166 MGLRGRLSEGAIWQAASEAGLDLDRLKKDMEDPAVTATIDANYQLA-QALQIEGTPAFTI 224

Query: 205 GGNLYLGDMSEGVFSKIIDSMIQ 227
           G  +  G   +   + ++  + +
Sbjct: 225 GQTVVPGAAPKEHLAGLVKKVRE 247


>gi|254419156|ref|ZP_05032880.1| hypothetical protein BBAL3_1466 [Brevundimonas sp. BAL3]
 gi|196185333|gb|EDX80309.1| hypothetical protein BBAL3_1466 [Brevundimonas sp. BAL3]
          Length = 215

 Score = 85.0 bits (208), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 83/182 (45%), Gaps = 10/182 (5%)

Query: 53  STMKDVSIGQKD-APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           +   D+ +G  + A VT+VEYAS+TC HCA +  KT+   + KY+ T K+RYI RE P  
Sbjct: 38  AAEGDMGLGAAEGAKVTVVEYASVTCPHCAVWQAKTWPAFKAKYVDTNKVRYIFRELPTP 97

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            V          A       Y+  +  L   Q + + S   RD LL  A+ AG S+  F+
Sbjct: 98  PVDAA-TAGFLVARCAGPDKYFDVIHQLMATQQEMLTSSP-RDWLLRTAQAAGLSEQQFN 155

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY-----LGDMSEGVFSKIIDSMI 226
            C+ D+  +  ++   + A +   +  TP F++           G  S    S  ID+ +
Sbjct: 156 DCVTDKEAVAAMEKRVQFA-QAQGVTGTPAFYVNDTQVITPGGEGA-SLADLSTAIDAEL 213

Query: 227 QD 228
             
Sbjct: 214 AK 215


>gi|225734104|pdb|3F4R|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1
          Length = 226

 Score = 85.0 bits (208), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 83/187 (44%), Gaps = 14/187 (7%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD   
Sbjct: 29  PNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRG 88

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTC 173
                            Y+ F   +FN  D W          L  +A  +   ++ F+ C
Sbjct: 89  L--KAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQC 146

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFI-----------GGNLYLGDMSEGVFSKII 222
           +ND+ I+D I   K  A     I +TP+FFI               + G      F+ +I
Sbjct: 147 INDKKIMDKIVNDKSLAINKLGITATPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVI 206

Query: 223 DSMIQDS 229
           D +   +
Sbjct: 207 DKLYGKA 213


>gi|156976090|ref|YP_001446996.1| hypothetical protein VIBHAR_04861 [Vibrio harveyi ATCC BAA-1116]
 gi|156527684|gb|ABU72769.1| hypothetical protein VIBHAR_04861 [Vibrio harveyi ATCC BAA-1116]
          Length = 238

 Score = 85.0 bits (208), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 31/250 (12%), Positives = 64/250 (25%), Gaps = 36/250 (14%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS--- 59
           M  TR  +   I L+ +  +     K S      I   + +   +L +    ++D     
Sbjct: 1   MKFTRTLLTVAIALVPL--FSHAAEKTSEEKLQEITQLLKENPQILDSLHQNLQDYVAYQ 58

Query: 60  ---------------------IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
                                 G ++  +T++     +C  C     +  K  ++     
Sbjct: 59  KTFNATLDEARAYLNDGKHSYFGAENPELTIINVTDYSCPFCKRLEGELVKVEKEYPQVK 118

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
                +  +   +     +   A    +     Y     LL  K      S   +     
Sbjct: 119 VLNMTVSFKEQYEKNGYNSASYALNVWQNQHDKYKQVHDLLVKKPGPHDASSLQK----- 173

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
                   K   +  L D      +            +  TP   I   +  G +     
Sbjct: 174 -----IAKKTGTEAQLVDDKETKALLDKNYEYFTRLGLRGTPAIIINDQVIPGYVPFEEL 228

Query: 219 SKIIDSMIQD 228
            K+ID  ++ 
Sbjct: 229 EKVIDQELKK 238


>gi|206890896|ref|YP_002249116.1| disulfide bond formation protein D, selenocysteine-containing
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742834|gb|ACI21891.1| disulfide bond formation protein D, selenocysteine-containing
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 200

 Score = 84.7 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 67/190 (35%), Gaps = 9/190 (4%)

Query: 43  DFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLR 102
              A    + S      IG KDAPVT++E+      HC E      + +++   K   + 
Sbjct: 20  AIAADQRYNLSIENSPVIGNKDAPVTIIEFIDYQUPHCVEVGPTIDRLVKELEGKVKLVI 79

Query: 103 YILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF 162
                   D     A       ++         +           + +  R++L+N AK 
Sbjct: 80  KFFPYRYRDYSRIAAEAAVEAWKQGKFTEMHDLL--------IKNSPRLDRESLINYAKK 131

Query: 163 AGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
                  F   +++Q     I    K A ++  +  TP F+I G   LG      F +II
Sbjct: 132 LNMDVEKFIKAIDNQEGASIIDKDLKLA-KELDLYVTPAFYINGIKVLGVRDSEYFKEII 190

Query: 223 DSMIQDSTRR 232
              +++  ++
Sbjct: 191 FRELKNVKKK 200


>gi|322437243|ref|YP_004219455.1| putative lipoprotein [Acidobacterium sp. MP5ACTX9]
 gi|321164970|gb|ADW70675.1| putative lipoprotein [Acidobacterium sp. MP5ACTX9]
          Length = 325

 Score = 84.7 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 67/215 (31%), Gaps = 8/215 (3%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +    +            L     T +    G + APV +V +  + C +CA+ 
Sbjct: 84  VTFLLSNDGKTVAQFSKYDISANPLTVVSGTDRPARGGPQGAPVEIVGFDDLECPYCAKM 143

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
           H++ F  L  +Y    +  Y          +  A +   C   +   GYW  V  +    
Sbjct: 144 HSQIFPALTQRYGDKVRFVYKDFPISQHPWAMRAAVDVNCVATQSSQGYWNLVDTIHAHA 203

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASED-------FAI 196
            +   + +     L+        +   +       +   IK       +          +
Sbjct: 204 GELGGTDHNLQKALDSLDKMTLDEAAKEKL-KQPEVEACIKKQDDTKIKASLKVGEDLNV 262

Query: 197 DSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           ++TPV FI G  + G        + +DS +  + +
Sbjct: 263 EATPVLFINGEKFEGAYPLEDLYRFVDSALIAAGQ 297


>gi|330010960|ref|ZP_08306925.1| DsbA-like protein [Klebsiella sp. MS 92-3]
 gi|328534337|gb|EGF60947.1| DsbA-like protein [Klebsiella sp. MS 92-3]
          Length = 203

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 74/220 (33%), Gaps = 22/220 (10%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  ++LL ++++ F     +A  E P  +G      LL   P++      G K+  +T+V
Sbjct: 4   ITALLLLCVSAFSF-----AAPAEEPQSNGNDQLAQLLFNDPNS---PRTGAKEPKLTIV 55

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
            +    C +C +F     K + D       ++ I++  P    S+V       +  R   
Sbjct: 56  SFTDYNCPYCKQFDPLLEKIVHDNP----DIQLIVKLLPFKGQSSVNAAKIALSTWRQQP 111

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
             +  +      +  + +  +   A    A  +    +     L    IL  +       
Sbjct: 112 DKFWALHQRLMAKKGYHDDASIAAAQKKTATDSVNIDDKTMDSLKMNLILSQV------- 164

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                I  TP   IG  +  G +       ++   +  + 
Sbjct: 165 ---LNIQGTPATIIGDQMVAGAIPAEELEGLVKEQLAKAR 201


>gi|39934097|ref|NP_946373.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39647945|emb|CAE26465.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 217

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 72/229 (31%), Gaps = 16/229 (6%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M  TR      +      +      K  A    P  + V+   A+L  +         G 
Sbjct: 1   MMITRRS---AVTAALALAPTLVAAKAWAAPTAPDAEDVLSTDAVLYDAEI----PVAGN 53

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
               +T+VE++   C +C +      + +++       +R +L+++P+    +V      
Sbjct: 54  PKGDITIVEWSDYRCPYCKKVAPDLTQVVKEDGN----IRLVLKDWPIFGGVSVDAAKMV 109

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
            A K          +L+ +       +         +                ++  ++ 
Sbjct: 110 LASKYQGKFLQAHEALIGSTSKLTETTLT-----ETLKAGGIDVDRATKDLDANRATIEA 164

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           I       ++ F    TP F +G     G +   +F + I    + + +
Sbjct: 165 ILKRNDTQAKAFGFQGTPSFIVGRFRVPGVLDVALFKQAIKDAREAAKK 213


>gi|262042546|ref|ZP_06015703.1| suppressor for copper-sensitivity C [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259040106|gb|EEW41220.1| suppressor for copper-sensitivity C [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 203

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 73/220 (33%), Gaps = 22/220 (10%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  ++LL ++++ F     +A  E P   G      LL   P++      G K+  +T+V
Sbjct: 4   ITALLLLCVSAFSF-----AAPAEGPQSKGNDQLAQLLFNDPNS---PRTGAKEPKLTIV 55

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
            +    C +C +F     K + D       ++ I++  P    S+V       +  R   
Sbjct: 56  SFTDYNCPYCKQFDPLLEKIVHDNP----DIQLIVKLLPFKGQSSVNAAKIALSTWRQQP 111

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
             +  +      +  + +  +   A    A  +    +     L    IL  +       
Sbjct: 112 DKFWALHQRLMAKKGYHDDASIAAAQKKTATDSVNIDDKTMDSLKMNLILSQV------- 164

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                I  TP   IG  +  G +       ++   +  + 
Sbjct: 165 ---LNIQGTPATIIGDQMVAGAIPADELEGLVKEQLAKAR 201


>gi|325965403|ref|YP_004243308.1| protein-disulfide isomerase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323471490|gb|ADX75174.1| protein-disulfide isomerase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 231

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 34/223 (15%), Positives = 64/223 (28%), Gaps = 11/223 (4%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
              R+ +   +  +  A   +Y         L  P+      A                 
Sbjct: 17  RKARLVIWILLGAIVAAGAIWYAVF-----TLNKPEPAAVQPAAEVELVLENSHRVTSPS 71

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
                +VE+    C  C        +    K     ++ +I R FPL             
Sbjct: 72  TEKAQLVEFLDFECEACRAAEPVVAEL---KAEFGDEVTFIHRYFPLPGHKNSGQAALAV 128

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G Y    + +F  Q  W   + +++AL    A+  G     +D  +  +   + 
Sbjct: 129 EAAAQQGKYEQMYAKMFETQPQWGEKQEFQNALFRTFAEELGLDMEQYDVTVAAEETKER 188

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
           I+       +   +  TP FF+ G     + S   F + +   
Sbjct: 189 IRKDIADG-KALGVTGTPTFFLNGEKLTLN-SVEEFRQKLADA 229


>gi|158316713|ref|YP_001509221.1| DSBA oxidoreductase [Frankia sp. EAN1pec]
 gi|158112118|gb|ABW14315.1| DSBA oxidoreductase [Frankia sp. EAN1pec]
          Length = 262

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 53/172 (30%), Gaps = 9/172 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           +     S G+  APV +VEY    C +CA       + ++    +  ++         D 
Sbjct: 77  TDPGRHSRGEPGAPVVIVEYGDFECPYCARAAAILHELVDSSDGQVRQVFRHFPV--FDI 134

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
                            G +W    LLF  QD         D  L     +   + D   
Sbjct: 135 HPYALTAALAAEVAGAHGRFWEMHDLLFANQDKLA------DKYLMAFARSLGIETDLVV 188

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
               Q   D ++A     +E   +  TP  FI G  Y G +  G     +  
Sbjct: 189 GDPAQPYGDAVEADYAGGAE-LRVQGTPTIFIDGVRYRGRLELGPLRTAVAR 239


>gi|260433395|ref|ZP_05787366.1| dsba oxidoreductase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417223|gb|EEX10482.1| dsba oxidoreductase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 252

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 26/199 (13%), Positives = 54/199 (27%), Gaps = 8/199 (4%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
                           A   A          G  D  +T+VE+    C +C     +   
Sbjct: 60  QRNAASEAAADKDLVAANAEALFDDGYSWVGGNPDGDITLVEFMDYRCGYCRRAAPEVDA 119

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            L         ++          +S+   +  +                  +        
Sbjct: 120 LLAQDGNIRFVIKEFPILGDASVLSSRFAIATKHVAGDD-------AYKQVHDALMEFGG 172

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
                AL  +A   G   +     ++   + D+I   ++ A +   I  TP F +G  + 
Sbjct: 173 DVTEVALRRIADGLGLDSDAIVAAMDSDAVTDEIAQTRELA-QRLKISGTPSFVLGTEML 231

Query: 210 LGDMSEGVFSKIIDSMIQD 228
            G +      +I D++  +
Sbjct: 232 RGYLKVDQMQQIADAVRAE 250


>gi|152971852|ref|YP_001336961.1| suppression of copper sensitivity protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|150956701|gb|ABR78731.1| Suppression of copper sensitivity protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 203

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 74/220 (33%), Gaps = 22/220 (10%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  ++LL ++++ F     +A  E P  +G      LL   P++      G K+  +T+V
Sbjct: 4   ITALLLLCVSAFSF-----AAPAEEPQSNGNDQLAQLLFNDPNS---PRTGAKEPKLTIV 55

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
            +    C +C +F     K + D       ++ +  +      +      A    ++   
Sbjct: 56  SFTDYNCPYCKQFDPLLEKIVHDNPDIQLIVKLLPFKGQSSVNAA---KTALSTWRQQPD 112

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
            +W     L  K+    ++                 K   D+   D   +D +K      
Sbjct: 113 KFWALHQRLMAKKGYHDDASIAAA----------QKKTATDSVNIDDKTMDSLKMNLIL- 161

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           S+   I  TP   IG  +  G +       ++   +  + 
Sbjct: 162 SQVLNIQGTPATIIGDQMVAGAIPADELEGLVKEQLAKAR 201


>gi|325282737|ref|YP_004255278.1| hypothetical protein Deipr_0493 [Deinococcus proteolyticus MRP]
 gi|324314546|gb|ADY25661.1| hypothetical protein Deipr_0493 [Deinococcus proteolyticus MRP]
          Length = 237

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 57/179 (31%), Gaps = 9/179 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL------- 110
             +G   APV M+      C  C +F    F  +E++Y+ TGK++     +P        
Sbjct: 58  PVVGDASAPVEMIVVEDFKCPACKQFEATVFPKVENEYVSTGKVKVYSVAWPFLAEVAKL 117

Query: 111 --DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
             D     A       E      +  + ++LF  Q+D       +  L  +A        
Sbjct: 118 DEDDSKYAAQAGECAYEHGGAEAFSAYKTILFRAQEDESKVWATKARLKELAANVSGIDQ 177

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
                  D +         +   E   +  TP  FIGG         G     ID+ + 
Sbjct: 178 TAFASCLDNDETLARVEANEEEVEASGVTGTPTVFIGGKKVENPGDYGQLKSAIDAALA 236


>gi|319898972|ref|YP_004159065.1| Outer membrane protein [Bartonella clarridgeiae 73]
 gi|319402936|emb|CBI76487.1| Outer membrane protein [Bartonella clarridgeiae 73]
          Length = 264

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 27/201 (13%), Positives = 65/201 (32%), Gaps = 9/201 (4%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
           F    K     +          ++L      +  D  +G  +  + +VE+    C HC  
Sbjct: 70  FILQEKFEQRRQKEAEKQTAIIKSLEKEIFQSPHDAILGNPNGKIVLVEFFDYNCKHCKR 129

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
            +      +++       +         D        +A     ++    +    L F+K
Sbjct: 130 SYLDLISLMQEYTDLRIVI--------KDLPILGPDSVATHIISQIFRKKFPEKYLQFHK 181

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           +      ++  D  + +A   G ++ +    + D  +   +     R +    I  TP +
Sbjct: 182 KLLMSQGRSNEDKAIKIAVLLGANEKELRNAIQDSKL-QKLFQENIRIASALNITGTPAY 240

Query: 203 FIGGNLYLGDMSEGVFSKIID 223
            IG  + +G + + +    I+
Sbjct: 241 IIGDKVLIGAVEKNILQAAIE 261


>gi|183222168|ref|YP_001840164.1| hypothetical protein LEPBI_I2813 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|167780590|gb|ABZ98888.1| Hypothetical protein LEPBI_I2813 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 313

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 67/201 (33%), Gaps = 8/201 (3%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
             ++R     N       +   ++ L            G K A   +VE++   C  C +
Sbjct: 117 IVWSRIFHKTNINIKQKPIYQSKSNLLTQLDVQYSPQFGNKKAKWVIVEWSDYLCGFCKK 176

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
               T   L     +   +            S + ++++RC  ++    +   + LL+  
Sbjct: 177 TFPHTKNLLLKYKTQIHYIHKDFPLDGESDQSLIPLVVSRCLWEKDPTQFSLHMQLLYAH 236

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
            +     +         +        +  +  ++    + ++A  + A +   + S P F
Sbjct: 237 ANHLAKGEAI-------SSNNWNYFTECISQTSNARYRNLVEADWEEA-KKLGVSSVPTF 288

Query: 203 FIGGNLYLGDMSEGVFSKIID 223
           ++ G   LG +    + ++++
Sbjct: 289 WVNGRWILGALDAETWERVLE 309


>gi|146340177|ref|YP_001205225.1| putative disulfide bond formation protein D [Bradyrhizobium sp.
           ORS278]
 gi|146192983|emb|CAL76990.1| putative disulfide bond formation protein D precursor (Disulfide
           oxidoreductase D) [Bradyrhizobium sp. ORS278]
          Length = 211

 Score = 84.7 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 50/174 (28%), Gaps = 9/174 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
             +G  D  +T+VEY    C +C +   +  K + D       +R I +++P+    ++ 
Sbjct: 47  PVLGNADGDITIVEYFDYQCPYCRKISPELAKVVRDDGH----VRLIFKDWPIFGGPSIY 102

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                            F                        A     ++   D      
Sbjct: 103 AARMTL----AAKYQDKFAEAHEALISLKDKLSEANADAALSAAGIDLARAKADLAAKGS 158

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            I D + A     +       TP F IG     G  +   F + I    + + +
Sbjct: 159 EI-DAVLARNHEQAMGLGFQGTPAFIIGRFRVPGAPNAQAFKQAIADARKAARK 211


>gi|290511319|ref|ZP_06550688.1| secreted protein, suppressor for copper-sensitivity ScsC
           [Klebsiella sp. 1_1_55]
 gi|289776312|gb|EFD84311.1| secreted protein, suppressor for copper-sensitivity ScsC
           [Klebsiella sp. 1_1_55]
          Length = 203

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 74/220 (33%), Gaps = 22/220 (10%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  ++LL ++++ F     +A  E P  +G      LL   P++      G K+  +T+V
Sbjct: 4   ITALLLLCVSAFSF-----AAPAEKPQSNGNDQLAQLLFNDPNS---PRTGAKEPKLTIV 55

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
            +    C +C +F     K + D       ++ +  +      +      A    ++   
Sbjct: 56  SFTDYNCPYCKQFDPLLEKIVHDNPDIQLIVKLLPFKGQSSVNAA---KAALSTWRQQPD 112

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
            +W     L  K+    ++                 K   D+   D   +D +K      
Sbjct: 113 KFWALHQRLMAKKGYHDDASIAAA----------QKKTATDSVNIDDKTMDSLKMNLIL- 161

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           S+   I  TP   IG  +  G +       ++   +  + 
Sbjct: 162 SQVLNIQGTPATIIGDQMVAGAIPAEDLEGLVKEQLAKAR 201


>gi|116662139|ref|YP_829194.1| DSBA oxidoreductase [Arthrobacter sp. FB24]
 gi|116612891|gb|ABK05613.1| DSBA oxidoreductase [Arthrobacter sp. FB24]
          Length = 229

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 68/220 (30%), Gaps = 11/220 (5%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
              R+ +   + ++  A   +Y    +A    P P          A              
Sbjct: 15  KKVRLVLWILLGVIVTAGVIWYAVFTAAKQAPPAP-----QPVAEAQLVREDSHRVTTPT 69

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
                +VE+    C  C             K     ++ ++ R FPL             
Sbjct: 70  TEKAQLVEFLDFECESCRAAQPLVEDL---KKEFGDRITFVNRYFPLPGHRNSGTAALAV 126

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQNILDD 182
                 G Y    + +F+ Q  W   ++ +  L    A+  G     +D  + D+  +D 
Sbjct: 127 EAAAQQGKYEQMYTKMFDTQPQWGEKQDSQAPLFRTYAQEMGLDLATYDAAVADEKTIDR 186

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
           I+       +   +  TP FF+ G   + + +E  F + +
Sbjct: 187 IRKDVADG-KALGVTGTPTFFLNGEKLVLN-TEEQFRQKL 224


>gi|283833736|ref|ZP_06353477.1| secreted protein, suppressor [Citrobacter youngae ATCC 29220]
 gi|291070395|gb|EFE08504.1| secreted protein, suppressor [Citrobacter youngae ATCC 29220]
          Length = 207

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/214 (9%), Positives = 57/214 (26%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + S F                       +  A  +      IG K A +T++ +   
Sbjct: 5   IVLLLSLFSAVSVAKEPAPFTPEQEKQIEALIQEALFNDPNSPRIGAKQAKLTLINFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  +++  P    S+           R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVVIKPLPFKGESSELSARTALMTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                         + +    + A     
Sbjct: 121 LHEKLMQKKGYHTDVSIKQAQEKAGATPVTLDAQS---------AETLSTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   +G  L  G +      +++   +  +
Sbjct: 171 VQGTPATIVGDELIPGAVPWETLEEVVKEKLAAA 204


>gi|222525231|ref|YP_002569702.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
 gi|222449110|gb|ACM53376.1| DSBA oxidoreductase [Chloroflexus sp. Y-400-fl]
          Length = 232

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 83/232 (35%), Gaps = 16/232 (6%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP------------ 52
             R  +L  IVLL   S        +  + +P            +               
Sbjct: 1   MVRRLILSFIVLLTACSAPAAMSPTATPSPVPTRAPTSTPTTADSTPVVAGYFPDLPRGR 60

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
           +      +G+ DAPVTMV Y+   C  CA         L + ++ TG++R + R      
Sbjct: 61  TPEGYHYLGRPDAPVTMVIYSDFLCTSCAIHTLDVEPRLIEAFVATGQMRLVYRHLLQLG 120

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
             +  +  A          +     +            N R+ ++++A   G  ++ F T
Sbjct: 121 ERSQILAEASECASDFGYFWELRREIYARY---NQLYFNTRETVIDLAAGLGIPRDAFTT 177

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
           CL+       ++A    A E+  + + PVF IG  + +G      F+++I+ 
Sbjct: 178 CLDSHTYQAQVQADYAAAIEE-GVYARPVFRIGTEVIVGSQRFETFAQVIER 228


>gi|114328527|ref|YP_745684.1| thiol:disulfide interchange protein dsbA [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316701|gb|ABI62761.1| thiol:disulfide interchange protein dsbA [Granulibacter
           bethesdensis CGDNIH1]
          Length = 225

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 61/220 (27%), Positives = 93/220 (42%), Gaps = 17/220 (7%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
            MS TR            A+ F      +A  E P   G            S + + SIG
Sbjct: 17  TMSITRRSF-------CTAALFSLPLIQAARAEAPATSGG--------DLSSFLSERSIG 61

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
           + DA VT++E+ S+TC HCA F   T   L  K I TG LR + R+FPLD V+     + 
Sbjct: 62  KADAKVTVMEFFSLTCTHCAAFSQNTLPELIKKQIDTGHLRIVFRDFPLDQVALS-AAMV 120

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
             A  +     +         +  +    N  ++L  MA  AG S+  FD  +N++ +  
Sbjct: 121 ARALPQERYEPFISALFASQDRWAFNRDGNVTESLAQMALLAGLSRAKFDAVINNEALKR 180

Query: 182 DIKAGKKRASEDFAIDSTPVFFI-GGNLYLGDMSEGVFSK 220
            +   +++ S  + I+STP F +  G    G +S   F  
Sbjct: 181 AMLERQQQESIKYNINSTPTFALTNGKTQSGALSYSDFVS 220


>gi|189912226|ref|YP_001963781.1| oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167776902|gb|ABZ95203.1| Oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
          Length = 305

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 67/201 (33%), Gaps = 8/201 (3%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
             ++R     N       +   ++ L            G K A   +VE++   C  C +
Sbjct: 109 IVWSRIFHKTNINIKQKPIYQSKSNLLTQLDVQYSPQFGNKKAKWVIVEWSDYLCGFCKK 168

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
               T   L     +   +            S + ++++RC  ++    +   + LL+  
Sbjct: 169 TFPHTKNLLLKYKTQIHYIHKDFPLDGESDQSLIPLVVSRCLWEKDPTQFSLHMQLLYAH 228

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
            +     +         +        +  +  ++    + ++A  + A +   + S P F
Sbjct: 229 ANHLAKGEAI-------SSNNWNYFTECISQTSNARYRNLVEADWEEA-KKLGVSSVPTF 280

Query: 203 FIGGNLYLGDMSEGVFSKIID 223
           ++ G   LG +    + ++++
Sbjct: 281 WVNGRWILGALDAETWERVLE 301


>gi|325961946|ref|YP_004239852.1| protein-disulfide isomerase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468033|gb|ADX71718.1| protein-disulfide isomerase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 227

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 62/224 (27%), Gaps = 10/224 (4%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
              R  +   + L+ +    +Y        +   P      + + A S            
Sbjct: 13  RFVRKIIWIVLALIVVGGAAWYAAMTLGKPQESAPPAGGAEQLVRADSHRLTSPAVE--- 69

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
                +VE+    C  CA  H    +    K     ++ ++ R FPL +           
Sbjct: 70  --RAQLVEFLDFECPSCASIHPVVAE---FKAEFGDRITFVHRHFPLSAHPNSGQAALAA 124

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQNILDD 182
                 G Y      LF  Q  W  S+  +  L              +D  + D    D 
Sbjct: 125 EAAGQQGKYQEMADRLFETQSQWAGSQQSQAPLFRTYAGELGLDLARYDAAIADPATEDR 184

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           I A      E   +  TP FF+ G             K+ D+  
Sbjct: 185 ILADIADG-EALGVSGTPTFFLNGEKLTLSTKADFRQKLADAAR 227


>gi|300024388|ref|YP_003756999.1| disulfide bond formation protein D [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526209|gb|ADJ24678.1| putative disulfide bond formation protein D [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 264

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 104/218 (47%), Gaps = 16/218 (7%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRA------------LLAASPSTMKDVSIGQKDAPV 67
           A   + +        +P P G  D  A                +PS + ++S G  +APV
Sbjct: 38  AGAAYPSIASEQPEGVPKPFGAADEPARTGREVIANPTIADVMAPSPLPEMSWGNANAPV 97

Query: 68  TMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKR 127
           TMVEYAS+TC HC  FH   +   + ++I TGK+RYILREFP+   S  A +  RCA   
Sbjct: 98  TMVEYASLTCPHCRNFHLTVYPDFKRRFIDTGKVRYILREFPIGKTSGNATIALRCAPPD 157

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGK 187
                +G       +Q  W++ +   DA+  +A+  G ++  FD CL +Q +++++K  K
Sbjct: 158 KYLDLFG---KFMEQQSSWVSQEVRLDAIYAVARQVGMTRPQFDACLQNQGMIENLKWVK 214

Query: 188 KRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            R  +   I  TP FFIG  L   +++    +  +   
Sbjct: 215 DRGRK-LGIVGTPNFFIGTKLIKKELTIAEIADYVQQA 251


>gi|204930853|ref|ZP_03221726.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204320312|gb|EDZ05516.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 207

 Score = 84.7 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/215 (11%), Positives = 62/215 (28%), Gaps = 14/215 (6%)

Query: 15  VLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYAS 74
           +++ + + F                       + AA  +      IG K   +T+V +  
Sbjct: 4   IIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTD 63

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
             C +C +      K ++        +  I++  P    S++          R     + 
Sbjct: 64  YNCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSILAARIALTTWREHPQQFL 119

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
            +     ++  +    + + A                    D+  ++ I+   + A    
Sbjct: 120 ALHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLV 169

Query: 195 AIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            +  TP   IG  L  G +       ++   +  +
Sbjct: 170 GVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAA 204


>gi|159045945|ref|YP_001534739.1| thiol:disulfide interchange protein DsbA [Dinoroseobacter shibae
           DFL 12]
 gi|157913705|gb|ABV95138.1| thiol:disulfide interchange protein DsbA [Dinoroseobacter shibae
           DFL 12]
          Length = 253

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/205 (11%), Positives = 49/205 (23%), Gaps = 11/205 (5%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                     E  +                      +G  D  VT++E+    C +C   
Sbjct: 59  AVAILREREAEAQVASAAETLANQRDLLERDENAPVLGNPDGDVTVIEFFDYNCPYCRRA 118

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                  +          R          ++  A + AR      +  +           
Sbjct: 119 KPTIEGLIAADPNVRVVFREFPILGDDSVLAARAALAARAQGMYEEFHWALMALSGRIN- 177

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
                       ++  A   G      +  +    +   I+     A +   I  TP F 
Sbjct: 178 ---------EAQIMQTADDLGLDVAQLEADMQSDAVTMHIETSLSLA-QSLGISGTPSFV 227

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQD 228
           +G  +  G + +    +++     D
Sbjct: 228 VGETILPGLVDQARLEELVAQERSD 252


>gi|225627398|ref|ZP_03785435.1| outer membrane protein [Brucella ceti str. Cudo]
 gi|260168638|ref|ZP_05755449.1| outer membrane protein, putative [Brucella sp. F5/99]
 gi|261758111|ref|ZP_06001820.1| DSBA oxidoreductase [Brucella sp. F5/99]
 gi|225617403|gb|EEH14448.1| outer membrane protein [Brucella ceti str. Cudo]
 gi|261738095|gb|EEY26091.1| DSBA oxidoreductase [Brucella sp. F5/99]
          Length = 265

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 51/179 (28%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E++   C +C          L+        L+      P   
Sbjct: 96  DPKHDAVFGNPNGDVTVYEFSDYNCGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSM 155

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   ++ +  A   G  +     
Sbjct: 156 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEESAIADAVKLGADEAKLRE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    + +
Sbjct: 208 KMKDPAITGAFQRTYQLA-QQLNITGTPSYVIGDELVPGAIGIDGLRQRIAAARDAAKK 265


>gi|330466080|ref|YP_004403823.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
 gi|328809051|gb|AEB43223.1| DSBA oxidoreductase [Verrucosispora maris AB-18-032]
          Length = 238

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 70/222 (31%), Gaps = 19/222 (8%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
            IG +  +V+  +  +  ++ + S     P              +      + +G    P
Sbjct: 31  SIGAVAVLVVAGLIGWSVWSSQSSGTFVAP------------PGATEDGTGIVVGS--GP 76

Query: 67  VTMVEYASMTCFHCAEFHNK---TFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
           VT+  Y    C  C +F      T + L            +       S        A  
Sbjct: 77  VTIDVYEDYLCPACKQFEQTSGATIEQLVSDGKARVVYHPVAYLNRFSSTQYSTRASAAS 136

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDI 183
                 G +  F   LF+KQ     ++   + L+++    G +++ F +C+ D       
Sbjct: 137 GCAAEGGKFTEFSKALFDKQPPENGAQLSDNELIDIGAEVGLNRDSFGSCVRDGKYKPWT 196

Query: 184 KAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
               + A+    +  TP   + G     + +    +  +++ 
Sbjct: 197 SHVSEEATRA-NVTGTPTVLVNGEQVR-EWTPENITAAVEAA 236


>gi|153006605|ref|YP_001380930.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
 gi|152030178|gb|ABS27946.1| DSBA oxidoreductase [Anaeromyxobacter sp. Fw109-5]
          Length = 307

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/213 (19%), Positives = 74/213 (34%), Gaps = 12/213 (5%)

Query: 20  ASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFH 79
           A++     +  A +               A   ++  + ++G + APV +VEY+  TC +
Sbjct: 100 AAHAVRLARAGAGDLRRQLSAYYAAFDRRAKLATSGFEPALGDEAAPVAIVEYSDFTCPY 159

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           C  F  +            G+++   + FP++S              R  G +W     L
Sbjct: 160 CRAFRPQLEA---FVEEHAGRVKLYFKPFPIESHEHALEAAQAVEWAREKGFFWQMHDRL 216

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F  +          D L + A   G    D    L D      I+A +  A +   +  T
Sbjct: 217 FESEGALAV-----DDLADHASSLGGDAEDLRAALADGRYRARIQASQVEARDA-GLRGT 270

Query: 200 PVFFIGGNLYLGDMSEGVFSKII--DSMIQDST 230
           P  F+ G L   D+SE    + +  +   Q   
Sbjct: 271 PTLFMNGRLLT-DLSEEGLEQALRDEEEWQQHR 302


>gi|159898007|ref|YP_001544254.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159891046|gb|ABX04126.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 250

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 66/219 (30%), Gaps = 6/219 (2%)

Query: 13  GIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKD--VSIGQKDAPVTMV 70
            + ++ I    F   +  +        G +  +A L A      D     GQ DAPV + 
Sbjct: 27  ALGVIGILGIGFVLVQSLSKPASVSNTGPMPNQAGLNAPVGKTADNYWYKGQSDAPVKVE 86

Query: 71  EYASMTCFHCAEFHNKTFKYLED--KYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM 128
            YA   C  C     +  +   D                       +  +          
Sbjct: 87  IYADYECPACRTLELELAQADFDGLYVETGKAQVIFREFPLKTIHKSAQLTAEIARCAGD 146

Query: 129 DGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKK 188
              +W   + LF+ Q  W  S   +  ++   + AG  +   ++C++     D I     
Sbjct: 147 QNLFWPIHNALFDSQTQWAQSLGPKTQIMAAVEQAGADRQKIESCVDAGTYTDVINTAYD 206

Query: 189 RASEDFAIDSTPVFFIGGNLYLGDMSEG-VFSKIIDSMI 226
            A E   +  TP  F+ G     +          +D+ +
Sbjct: 207 AALER-QLQQTPTVFVDGQQVNFETDFAKTLMAAVDAKL 244


>gi|220911391|ref|YP_002486700.1| DSBA oxidoreductase [Arthrobacter chlorophenolicus A6]
 gi|219858269|gb|ACL38611.1| DSBA oxidoreductase [Arthrobacter chlorophenolicus A6]
          Length = 227

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 63/225 (28%), Gaps = 11/225 (4%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQK 63
              R  +   +    I    +Y    +   +   P      + +   S            
Sbjct: 13  RLVRTVIWIVLAAAVIGGVAWYALLTANNEQKAAPPAPGSEQLVRENSYRLTAPSVE--- 69

Query: 64  DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARC 123
                +VE+    C  C   H    +    K     ++ ++ R FPL + +         
Sbjct: 70  --KAQLVEFLDFECPSCGSIHPVVEEL---KAEFGDRITFVNRHFPLAAHANSGQAALAA 124

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKND-FDTCLNDQNILDD 182
                 G Y    + LF  Q  W   +  +  L              FD  + D    + 
Sbjct: 125 EAANQQGKYQEMANRLFETQSQWAGQQTSQAPLFRTYAEDLGLDLALFDAAVADHQTEER 184

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           + A      E   +  TP FF+ G       ++  F + +   ++
Sbjct: 185 VLADIADG-EALGVHGTPTFFLNGEKLT-LTTKADFRQKLADAVR 227


>gi|206577589|ref|YP_002236637.1| suppressor for copper-sensitivity C [Klebsiella pneumoniae 342]
 gi|206566647|gb|ACI08423.1| suppressor for copper-sensitivity C [Klebsiella pneumoniae 342]
          Length = 203

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 74/220 (33%), Gaps = 22/220 (10%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  ++LL ++++ F     +A  E P  +G      LL   P++      G K+  +T+V
Sbjct: 4   ITALLLLCVSAFSF-----AAPAEKPQSNGNDQLAQLLFNDPNS---PRTGAKEPKLTIV 55

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
            +    C +C +F     K + D       ++ I++  P    S+V    A  +  R   
Sbjct: 56  SFTDYNCPYCKQFGPLLEKIVHDNP----DIQLIVKLLPFKGQSSVNAAKAALSTWRQQP 111

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
             +  +      +  + +  +   A    A       +     L    IL  +       
Sbjct: 112 DKFWALHQRLMAKKGYHDDASIAAAQKKTATDGVSIDDKTMDSLKMNLILSQV------- 164

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
                I  TP   IG  +  G +       ++   +  + 
Sbjct: 165 ---LNIQGTPATIIGDQMVAGAIPAEDLEGLVKEQLAKAR 201


>gi|260221388|emb|CBA29900.1| hypothetical protein Csp_A14470 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 218

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 57/194 (29%), Gaps = 8/194 (4%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
           +   D  +   A    M    +G  +APVT+VE+    C  C EF+    + L+      
Sbjct: 32  NSQQDKVSQAEARLVRMHSPVLGPVNAPVTIVEFFDPACETCREFYPIVKELLKKYPNDV 91

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
             +                +++      ++ G YW  +  +   Q  W +       +  
Sbjct: 92  RLVVRYA-----PFHRNSDLVVKMLEASKVQGKYWEVLDAVLADQPLWASHGEPNLYVAY 146

Query: 159 MAKFAGFSK-NDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGV 217
            +        N          +   +K   +  +    +  TP FF+ G           
Sbjct: 147 QSAVRVGVDLNKALFDAQSPAVTAALKQDVEDLT-ALEVTKTPTFFVNGRSLP-SFGAAQ 204

Query: 218 FSKIIDSMIQDSTR 231
              ++   +    +
Sbjct: 205 LESLVAEEVAKIKK 218


>gi|294637218|ref|ZP_06715523.1| outer membrane protein [Edwardsiella tarda ATCC 23685]
 gi|291089596|gb|EFE22157.1| outer membrane protein [Edwardsiella tarda ATCC 23685]
          Length = 199

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/192 (10%), Positives = 55/192 (28%), Gaps = 13/192 (6%)

Query: 37  IPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYI 96
              G +                 +G  DA +T+V +    C +C        + +E    
Sbjct: 19  AAPGAMAADEAETLLFHNPATPRLGASDAALTVVVFTDYNCPYCKRLDPLLEQLVERNPQ 78

Query: 97  KTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDAL 156
               +    +  P    S+           R     +  +      +  + ++++ + AL
Sbjct: 79  ----VAVAFKLLPFKGESSHQAAQLALTLWRQQPERFLALHRALMAKRGYHSTRSIQAAL 134

Query: 157 LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
                    +          Q  + ++       ++   +  TP   IG  L  G +   
Sbjct: 135 QRSGNADLQAD--------SQGTIQEL-RDSLLLAQVLGVQGTPTLVIGNQLIPGAIDYD 185

Query: 217 VFSKIIDSMIQD 228
             ++ +++ +  
Sbjct: 186 QLTQAVETALAQ 197


>gi|299134139|ref|ZP_07027332.1| DSBA oxidoreductase [Afipia sp. 1NLS2]
 gi|298590886|gb|EFI51088.1| DSBA oxidoreductase [Afipia sp. 1NLS2]
          Length = 241

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 64/220 (29%), Gaps = 13/220 (5%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           + G+     A        G A +    PD V     +L          S+G  +  VT+V
Sbjct: 4   ISGLRASAFAMAVLTLVAGMASDVRAEPDNVTSRERILRDPEI----PSLGNPNGDVTIV 59

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           E+    C +C     +  K +++       L+      P    ++  V+           
Sbjct: 60  EWFDYQCPYCKALSPELEKIIKEDGHVRFVLKDWPILGPPSPEASRLVLAT------KYQ 113

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
           G +         +   + +    + L                    +  ++ + A     
Sbjct: 114 GKFEAAHKALMARVGRLTTGTIDETLA---GAGVDVAKAKADLETHKAEIEALLARNNEQ 170

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           +E    +STP F +G     G M   +F   I      + 
Sbjct: 171 AEGLGFNSTPSFIVGTFRIPGVMKPELFKLAIADARAKAK 210


>gi|329888147|ref|ZP_08266745.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846703|gb|EGF96265.1| DSBA-like thioredoxin domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 211

 Score = 84.3 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 50/214 (23%), Positives = 89/214 (41%), Gaps = 4/214 (1%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD-APVTMVEYAS 74
           +  I  Y   +R+ +          V+   +   A      D++ G  + A VT+VEYAS
Sbjct: 1   MAPIFKYAAMSRRAALSAAALASMAVLAGCSAGGAGGEVEGDMAKGAPEGAKVTVVEYAS 60

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
           +TC HCA ++ + +   + KY+   K+R++ REFP        V     A       Y+ 
Sbjct: 61  VTCGHCAVWNEEVWPEFKTKYVDNNKVRFVFREFPTPPQDIA-VAGFLIARCAGPDKYFD 119

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
            VS +   Q +W      R  L    + AG S+   + C+ D+  ++ ++   +      
Sbjct: 120 VVSDIMASQKEWQAGVAPRTTLFRAGQAAGLSEQQINDCIRDKAAIEAMEKRIQAGISA- 178

Query: 195 AIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            +  TP F + G       S    S++ID+ +  
Sbjct: 179 GVTGTPYFTVNGVKVADS-SLSGLSEVIDAELAK 211


>gi|331671717|ref|ZP_08372514.1| secreted protein, suppressor for copper-sensitivity C [Escherichia
           coli TA280]
 gi|331071109|gb|EGI42467.1| secreted protein, suppressor for copper-sensitivity C [Escherichia
           coli TA280]
          Length = 207

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 67/215 (31%), Gaps = 15/215 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP-STMKDVSIGQKDAPVTMVEYAS 74
           L+ +   FF     +       P+  +    ++  +  +      IG K A +T+V +  
Sbjct: 4   LIILMMIFFTGMSMAKGPAPVSPEQEMQIEVVIQEALFNDPSSPRIGAKQAKLTLVNFTD 63

Query: 75  MTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWG 134
             C +C        K ++        +  I++  P    S+           R     + 
Sbjct: 64  YNCPYCKRLDPMLEKIVQKYP----DVAVIIKPLPFKGESSELSARTALTTWRKFPEQFI 119

Query: 135 FVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
            +     K+  +  + + +             K        D   ++ +K   + A    
Sbjct: 120 ALHENLMKKKGYHTATSIKQ---------AQEKAVVTPLTPDDKSMETVKTNLQLA-RLL 169

Query: 195 AIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            +  TP   IG  L  G +   +  +I+   ++ +
Sbjct: 170 GVRGTPTTIIGNELIPGAVPWEMLEQIVKEKLEAA 204


>gi|306840403|ref|ZP_07473168.1| DSBA oxidoreductase [Brucella sp. BO2]
 gi|306289641|gb|EFM60845.1| DSBA oxidoreductase [Brucella sp. BO2]
          Length = 265

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/179 (13%), Positives = 50/179 (27%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E+    C +C          L+        L+      P   
Sbjct: 96  DPKHDAVFGNPNGDVTVYEFFDYNCGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSM 155

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   +  +  A   G  +     
Sbjct: 156 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEETAIADAVKLGADEAKLRE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    +T+
Sbjct: 208 KMKDPAITGAFQQTYQLA-QQLNITGTPSYVIGDELVPGAIGIDGLRERIAAARDAATK 265


>gi|238896445|ref|YP_002921183.1| copper-sensitivity suppressor protein C [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238548765|dbj|BAH65116.1| copper-sensitivity suppressor protein C [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 203

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 74/220 (33%), Gaps = 22/220 (10%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  ++LL ++++ F     +A  E P  +G      LL   P++      G K+  +T+V
Sbjct: 4   ITALLLLCVSAFSF-----AAPAEEPQSNGNDQLAQLLFNDPNS---PRTGAKEPKLTIV 55

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
            +    C +C +F     K + D       ++ +  +      +      A    ++   
Sbjct: 56  SFTDYNCPYCKQFDPLLEKIVHDNPDIQLIVKLLPFKGQSSVNAA---KAALSTWRQQPD 112

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
            +W     L  K+    ++                 K   D+   D   +D +K      
Sbjct: 113 KFWALHQRLMAKKGYHDDASIAAA----------QKKTATDSVNIDDKTMDSLKMNLIL- 161

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           S+   I  TP   IG  +  G +       ++   +  + 
Sbjct: 162 SQVLNIQGTPATIIGDQMVAGAIPADELEGLVKEQLAKAR 201


>gi|168243912|ref|ZP_02668844.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194444870|ref|YP_002040370.1| copper sensitivity supression protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194447839|ref|YP_002045115.1| copper sensitivity supression protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194403533|gb|ACF63755.1| suppression of copper sensitivity: lipoprotein modification in lgt
           mutants of E coli [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406143|gb|ACF66362.1| suppression of copper sensitivity: lipoprotein modification in lgt
           mutants of E coli [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205337135|gb|EDZ23899.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
          Length = 207

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/214 (12%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S+V          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSVLAARIALTTWRDHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAA 204


>gi|260753256|ref|YP_003226149.1| DSBA oxidoreductase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552619|gb|ACV75565.1| DSBA oxidoreductase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 259

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/171 (16%), Positives = 65/171 (38%), Gaps = 11/171 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +   VT+VE++   C  C + +    + L +       +R ++R+ P+    +     
Sbjct: 100 GAEKGRVTIVEFSDYACGFCRKANGDLNRLLSEDK----DIRLVIRQLPILGPDSEIAAR 155

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
              A  +    +  F   ++N +          + ++++ K  G +  D     +D  I 
Sbjct: 156 TALAIAKNSSKFSEFHHQIYNSKH------LSPEVIVDIVKSLGLNPQDIAKQGSDPAIT 209

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            +I      A E   +  TP F IG  ++ G        + +  + + S++
Sbjct: 210 QEITKNILLARE-LGLTGTPAFIIGDKVFSGVAGYDALKEAVAKIREKSSK 259


>gi|241761342|ref|ZP_04759430.1| DSBA oxidoreductase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241374249|gb|EER63746.1| DSBA oxidoreductase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 259

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/171 (16%), Positives = 65/171 (38%), Gaps = 11/171 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +   VT+VE++   C  C + +    + L +       +R ++R+ P+    +     
Sbjct: 100 GAEKGRVTIVEFSDYACGFCRKANGDLNRLLSEDK----DIRLVIRQLPILGPDSEIAAR 155

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
              A  +    +  F   ++N +          + ++++ K  G +  D     +D  I 
Sbjct: 156 TALAIAKNSSKFSEFHHQIYNSKH------LSPEVIVDIVKSLGLNPQDIAKQGSDPAIT 209

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            +I      A E   +  TP F IG  ++ G        + +  + + S++
Sbjct: 210 QEITKNILLARE-LGLTGTPAFIIGDKVFSGVAGYDALKEAVAKIREKSSK 259


>gi|56551087|ref|YP_161926.1| DSBA oxidoreductase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56542661|gb|AAV88815.1| DSBA oxidoreductase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 259

 Score = 83.9 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/171 (16%), Positives = 65/171 (38%), Gaps = 11/171 (6%)

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G +   VT+VE++   C  C + +    + L +       +R ++R+ P+    +     
Sbjct: 100 GAEKGRVTIVEFSDYACGFCRKANGDLNRLLSEDK----DIRLVIRQLPILGPDSEIAAR 155

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
              A  +    +  F   ++N +          + ++++ K  G +  D     +D  I 
Sbjct: 156 TALAIAKNSSKFSEFHHQIYNSKH------LSPEVIVDIVKSLGLNPQDIAKQGSDPAIT 209

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            +I      A E   +  TP F IG  ++ G        + +  + + S++
Sbjct: 210 QEITKNILLARE-LGLTGTPAFIIGDKVFSGVAGYDALKEAVAKIREKSSK 259


>gi|330831286|ref|YP_004394238.1| DsbA family, Com1-like subfamily protein [Aeromonas veronii B565]
 gi|328806422|gb|AEB51621.1| DsbA family, Com1-like subfamily protein [Aeromonas veronii B565]
          Length = 249

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 63/203 (31%), Gaps = 9/203 (4%)

Query: 26  TRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHN 85
           +    A  E    +         +      +D  +G   A +T+VE+    C +C   H 
Sbjct: 50  SNALRAKQESQQAESDKALIKAHSKQLYANQDPEMGNPKASLTIVEFFDYNCGYCKRAHP 109

Query: 86  KTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDD 145
              + + +       +RYI ++FP+ S S+     A  A +      +            
Sbjct: 110 LVKQLMAEDK----DIRYIYKQFPILSESSYFAARAALAVQLGQPDKYQAFHEKLYSHQG 165

Query: 146 WINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIG 205
            +  +     L   A          +  + D +I  ++   +  A E   I  TP F IG
Sbjct: 166 PLADEAQVKQLAVAAGVDWS---KVEAKIKDGSIDQNLGTNRVLA-EALGISGTPAFIIG 221

Query: 206 GNLYLGD-MSEGVFSKIIDSMIQ 227
             +  G           I  +  
Sbjct: 222 DQILRGAPRDLASLKGFIKDVRA 244


>gi|288959211|ref|YP_003449552.1| dsbA oxidoreductase [Azospirillum sp. B510]
 gi|288911519|dbj|BAI73008.1| dsbA oxidoreductase [Azospirillum sp. B510]
          Length = 255

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 54/200 (27%), Gaps = 11/200 (5%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
                                A      DV  G     VT+VE+    C +C      T 
Sbjct: 66  QERQKTAEAEQARKALSENKQALTRNPADVVAGNPQGDVTVVEFFDYQCGYCKAVQADTQ 125

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN 148
             ++        L     +          V        R  G Y  F + L  ++     
Sbjct: 126 TLIKGDPKLRFVL-----KEFPILGPASVVASKAAIASRGQGKYMEFHNALMAQRGQLD- 179

Query: 149 SKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNL 208
                  ++ +AK  G   +     +   ++L  I   +  A E   I  TP F  G  L
Sbjct: 180 ----EAVIMRLAKSVGLDTDRLKKDMEAPDVLKVIATNQALA-EKLNIRGTPAFIFGDEL 234

Query: 209 YLGDMSEGVFSKIIDSMIQD 228
             G +      ++ D+    
Sbjct: 235 VPGAIKLDDMKRLTDAARAK 254


>gi|282891808|ref|ZP_06300289.1| hypothetical protein pah_c197o132 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498392|gb|EFB40730.1| hypothetical protein pah_c197o132 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 173

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/176 (15%), Positives = 51/176 (28%), Gaps = 10/176 (5%)

Query: 51  SPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
            P + +D   GQ++A +T+VEY    C  C   +    +  E   +K   +        +
Sbjct: 6   DPVSNEDHVQGQQNAEITLVEYGDYQCPFCGHAYLIIKQIQEHFGLKLRFVFRNFPLTEI 65

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDF 170
                             +G +W    L++  Q +    +    A               
Sbjct: 66  --HPLAKPAAELTEYAGSEGKFWKMHDLIYENQANLSLERLVELADSLDLSSTKLKDGPN 123

Query: 171 DTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
                       I+       +   ++ TP  FI  + Y G +        I+  I
Sbjct: 124 -------TFDQKIQKDFIGGVKS-GVNGTPTLFINDDRYAGPVEFRYLILAINKTI 171


>gi|161614683|ref|YP_001588648.1| hypothetical protein SPAB_02434 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168233496|ref|ZP_02658554.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168264116|ref|ZP_02686089.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194468581|ref|ZP_03074565.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|198244971|ref|YP_002215046.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205352268|ref|YP_002226069.1| secreted protein, suppressor for copper-sensitivity C [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207856458|ref|YP_002243109.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|161364047|gb|ABX67815.1| hypothetical protein SPAB_02434 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194454945|gb|EDX43784.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197939487|gb|ACH76820.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205272049|emb|CAR36893.1| secreted protein, suppressor for copper-sensitivity C precursor
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205332398|gb|EDZ19162.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205347374|gb|EDZ34005.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708261|emb|CAR32561.1| secreted protein, suppressor for copper-sensitivity C precursor
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|326622800|gb|EGE29145.1| Thioredoxin fold containing protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627313|gb|EGE33656.1| DSBA-like thioredoxin domain-containing protein [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 207

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/214 (12%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S+V          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAA 204


>gi|183598122|ref|ZP_02959615.1| hypothetical protein PROSTU_01487 [Providencia stuartii ATCC 25827]
 gi|188020281|gb|EDU58321.1| hypothetical protein PROSTU_01487 [Providencia stuartii ATCC 25827]
          Length = 242

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/207 (12%), Positives = 61/207 (29%), Gaps = 14/207 (6%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +   E          +A      +      +G KDA + +V +    C  C  F
Sbjct: 50  AIVALQAKQGEKQQAQMKATIKAEHDKLFNDPASPRLGAKDAKLVLVNFTDYNCPFCKRF 109

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
             +  + ++        +  +++  P    +++            D   +  +   F ++
Sbjct: 110 DPQLEEIVKKYP----DVAVVIKPLPFKGKTSLESSQLVLTLWEKDPKAFQALHQKFMQK 165

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
              +  +N + AL              +  + +    + I+     A E   ++ TP   
Sbjct: 166 QGMLTEENIKQALKATGN---------EKLVANDKSEETIRTNMMLA-EKLGVNGTPATL 215

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDST 230
           IG  +  G +       I+   +    
Sbjct: 216 IGEEMIPGAVDAQQLEMIVKEQLAKVK 242


>gi|238911064|ref|ZP_04654901.1| suppression of copper sensitivity: lipoprotein modification in lgt
           mutants of E coli [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 207

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/214 (11%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S++          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSILAARIALTTWRDHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAA 204


>gi|239831787|ref|ZP_04680116.1| DSBA oxidoreductase [Ochrobactrum intermedium LMG 3301]
 gi|239824054|gb|EEQ95622.1| DSBA oxidoreductase [Ochrobactrum intermedium LMG 3301]
          Length = 300

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 67/207 (32%), Gaps = 13/207 (6%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDV----SIGQKDAPVTMVEYASMTCFHCAEFH 84
            SAL            + +LAA+ S++ D       G  D  VT+ E+    C +C    
Sbjct: 103 QSALETKQARAAQEQIKQVLAANRSSLYDPKHDAVFGNPDGDVTVYEFFDYNCGYCKRAL 162

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
                 L+        +R++++EFP+    +           +            F++  
Sbjct: 163 PDMEAILKTDKN----VRFVMKEFPILGPDSA----KAHVVAQAFRALMPEKYAEFHEVL 214

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
                +   D+ +  A   G  +      + D  I    +   + A +   I  TP + I
Sbjct: 215 LGAQERATEDSAIADAVKLGADETQLREKMKDPAITGAFQQTYQLA-QQLNITGTPSYII 273

Query: 205 GGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           G  L  G +      + I +    +  
Sbjct: 274 GDELVPGAIGVDGLVERIAAARAGAKN 300


>gi|197264347|ref|ZP_03164421.1| suppression of copper sensitivity [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197242602|gb|EDY25222.1| suppression of copper sensitivity [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
          Length = 207

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/214 (12%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S+V          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLASA 204


>gi|296532555|ref|ZP_06895265.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
 gi|296267120|gb|EFH13035.1| DSBA oxidoreductase [Roseomonas cervicalis ATCC 49957]
          Length = 232

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/208 (14%), Positives = 57/208 (27%), Gaps = 11/208 (5%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                  A  +          RA  AA      D + G     +T+VE+    C +C   
Sbjct: 34  ALAAMQQAEQQDRAAAQSAAIRANQAALLRDAADPAKGNPRGSLTIVEFFDPRCGYCKAL 93

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
           H      L            ++ +                   +  G Y  +        
Sbjct: 94  HPTMAALLAADRDL-----RVVLKDLPILGPASVTASRALLAAQRQGKYAEYQDA----- 143

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
              +  +    AL   A+  G         + D  I + ++     A    +I+ TP   
Sbjct: 144 LMRLRGEPTEAALQAEAQKLGLDWARLRRDMEDPAITERLQRNLALA-RALSIEGTPALV 202

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           IG  L  G +      +++    + + +
Sbjct: 203 IGDTLVPGAVDLPTLQQLVAEARRQARQ 230


>gi|161503798|ref|YP_001570910.1| hypothetical protein SARI_01885 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865145|gb|ABX21768.1| hypothetical protein SARI_01885 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 207

 Score = 83.9 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/214 (11%), Positives = 60/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       +  A  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPEQEKQIENLIHTALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S++          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSILAARIALTTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAA 204


>gi|301166290|emb|CBW25865.1| putative sodium/proton antiporter [Bacteriovorax marinus SJ]
          Length = 161

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 49/168 (29%), Gaps = 8/168 (4%)

Query: 60  IGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVM 119
           +G  DAPV +VE+    C  C  F       ++    K       +              
Sbjct: 1   MGPDDAPVKLVEFMDPECESCRMFFPFVKNLMKKYEGKIQLTIRYV-----PFHGNSKFA 55

Query: 120 LARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQN 178
           +A     R  G YW  + +LF  Q  W N    R  L+           +       D  
Sbjct: 56  IAILESARKQGKYWETLEILFKNQPAWGNHHQPRPELIWNYLPMVGLDVDQIKKDYKDPA 115

Query: 179 ILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
               I+     A E   + +TP FFI G               I   +
Sbjct: 116 WTKIIEQDFADARE-LGVRATPTFFINGMPLR-SFGYQQLEDQIKENL 161


>gi|163731557|ref|ZP_02139004.1| outer membrane protein, putative [Roseobacter litoralis Och 149]
 gi|161395011|gb|EDQ19333.1| outer membrane protein, putative [Roseobacter litoralis Och 149]
          Length = 249

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/203 (13%), Positives = 52/203 (25%), Gaps = 8/203 (3%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                     E+     V        A  +       G  D  +T+VE+    C  C   
Sbjct: 54  AVNALEERQAEVQAQADVDLVSRNAEAIFNDGFSYVGGNPDGDITLVEFMDYRCGFCKRA 113

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
             +  K L         ++              +        +     Y      L +  
Sbjct: 114 FGEVEKLLAADDNIRFVVKEFPILGEQSL--LASRFAIATKLEEGPDAYKAMHDALMSYN 171

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
            D          L  +A   G + +  +  +    +  ++ A +  A +   I  TP F 
Sbjct: 172 GDITIPA-----LRRLADTFGLNTDQIEARMEADEVTQELMATRALA-QRLQISGTPTFV 225

Query: 204 IGGNLYLGDMSEGVFSKIIDSMI 226
           +   +  G +       I+D   
Sbjct: 226 LDDEMLRGFLPMDQLQMIVDEKR 248


>gi|163747044|ref|ZP_02154400.1| outer membrane protein, putative [Oceanibulbus indolifex HEL-45]
 gi|161379605|gb|EDQ04018.1| outer membrane protein, putative [Oceanibulbus indolifex HEL-45]
          Length = 249

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 48/183 (26%), Gaps = 8/183 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
             A   A          G  D  +T+VE+    C +C   H +  K LE       KL  
Sbjct: 74  VSANADAIFDDGYSWVGGNPDGDITLVEFLDYRCGYCKRAHGEVAKLLETD--GNIKLIV 131

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
                  +     +       +      Y      L     +          L  + +  
Sbjct: 132 KEFPILGEQSMLASRFAVATKQVAGGDAYKQLNDALMAFNGEVSMPA-----LRRLGESF 186

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
                  +  +    +  +I   +  A E   I  TP F +   +  G +       +++
Sbjct: 187 DLDVAAIEAEMGSDAVAQEIATTRALA-EKLQITGTPTFVMQDEMLRGYLPYDQMMALVE 245

Query: 224 SMI 226
              
Sbjct: 246 EKR 248


>gi|158424696|ref|YP_001525988.1| putative outer membrane protein precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158331585|dbj|BAF89070.1| putative outer membrane protein precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 258

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 51/192 (26%), Gaps = 9/192 (4%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
              E           ++      + + V IG     VT+VE+    C +C    +     
Sbjct: 67  RQGEAEAQARAKTLASIKPKVFDSPRGVVIGNPKGNVTLVEFFDYNCGYCKHTLSDINAL 126

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           +++       LR      P    +                         F+        +
Sbjct: 127 VKNNPNLRVVLREFPVLGPGSVEAA--------QVAVAVRMVAPDKYKAFHDALLSGRGQ 178

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
             R   L  AK  G              +   +    + A +   ++ TP F IG  + +
Sbjct: 179 ADRARALAAAKEVGIDVAQLQKQATSPELNATLDESMEIA-QALGLNGTPSFVIGDEVIV 237

Query: 211 GDMSEGVFSKII 222
           G +      + +
Sbjct: 238 GAVGLEKLQEAV 249


>gi|261343542|ref|ZP_05971187.1| suppressor [Providencia rustigianii DSM 4541]
 gi|282568691|gb|EFB74226.1| suppressor [Providencia rustigianii DSM 4541]
          Length = 242

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/207 (11%), Positives = 58/207 (28%), Gaps = 14/207 (6%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +   E          +    A  +      IG KDA + +V +    C +C  F
Sbjct: 50  AIVALQAKQGEKQQAQMKQVLKDQHNALFNDPTSPRIGSKDAKLVLVNFTDFNCPYCKRF 109

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                  ++        +  +++  P    +++          + +   +  +      +
Sbjct: 110 DPLLEDIVKKNP----DVAVVIKYLPFKGETSMESSQLAMTLWKENPKAFLALHQKLMAK 165

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
              ++  N ++AL                          I+   + A     ++ TP   
Sbjct: 166 QGMLSDSNIKEALQATGNG---------KLKASDESRAAIRKNLELA-NMLQVNGTPATL 215

Query: 204 IGGNLYLGDMSEGVFSKIIDSMIQDST 230
           +G  +  G +    F +I+   +    
Sbjct: 216 VGDEMIPGAVDAQEFERIVKEQLSKVK 242


>gi|200389412|ref|ZP_03216023.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199601857|gb|EDZ00403.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 207

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/214 (11%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S++          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSILAARIALTTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + +             K        D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIK---------HAQQKAGATPVTLDEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAA 204


>gi|56413893|ref|YP_150968.1| secreted protein, suppressor for copper-sensitivity C [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62179635|ref|YP_216052.1| hypothetical protein SC1065 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167552618|ref|ZP_02346370.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168467564|ref|ZP_02701401.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168821765|ref|ZP_02833765.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|197251026|ref|YP_002145984.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197362816|ref|YP_002142453.1| copper sensitivity supressor protein C [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|224584378|ref|YP_002638176.1| secreted protein, suppressor for copper-sensitivity C [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|56128150|gb|AAV77656.1| secreted protein, suppressor for copper-sensitivity C precursor
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|62127268|gb|AAX64971.1| Suppression of copper sensitivity: lipoprotein modification in lgt
           mutants of E coli [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|195630078|gb|EDX48730.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197094293|emb|CAR59801.1| secreted protein, suppressor for copper-sensitivity C precursor
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197214729|gb|ACH52126.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|205322742|gb|EDZ10581.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205341772|gb|EDZ28536.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|224468905|gb|ACN46735.1| secreted protein, suppressor for copper-sensitivity C precursor
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|320085332|emb|CBY95115.1| Na(+)/H(+) antiporter nhaA 3 Sodium/proton antiporter nhaA 3
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|322714103|gb|EFZ05674.1| secreted protein, suppressor for copper-sensitivity C precursor
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 207

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/214 (11%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S++          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSILAARIALTTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAA 204


>gi|16764473|ref|NP_460088.1| suppression of copper sensitivity protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167993687|ref|ZP_02574781.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|2327005|gb|AAC45602.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16419631|gb|AAL20047.1| suppression of copper sensitivity protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|205328340|gb|EDZ15104.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261246329|emb|CBG24138.1| secreted protein, suppressor for copper-sensitivity C precursor
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267992875|gb|ACY87760.1| suppression of copper sensitivity protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157658|emb|CBW17150.1| secreted protein, suppressor for copper-sensitivity C precursor
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312912104|dbj|BAJ36078.1| suppression of copper sensitivity protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|321223730|gb|EFX48793.1| Secreted protein, suppressor for copper-sensitivity ScsC
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323129383|gb|ADX16813.1| suppression of copper sensitivity protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|332988008|gb|AEF06991.1| suppression of copper sensitivity protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 207

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/214 (12%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S+V          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRVYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLASA 204


>gi|213971778|ref|ZP_03399882.1| DSBA oxidoreductase [Pseudomonas syringae pv. tomato T1]
 gi|213923463|gb|EEB57054.1| DSBA oxidoreductase [Pseudomonas syringae pv. tomato T1]
          Length = 232

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 62/234 (26%), Gaps = 14/234 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +M  TR  +L GI    +A   F   +            +         S         G
Sbjct: 1   MMRPTRRQMLYGIGAAALALTPFLLAELRQNTLGVSGGPLEQAVDQQKQS----GGWVYG 56

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
            + A  T+VEYA + C +C ++  +   +      +   +       PL      A   A
Sbjct: 57  SRSARFTIVEYADLECPYCKDYFPQLKAW----VDQHPDVNLQWHHLPLPMHEPAASYEA 112

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
           R AE            L          S     A           ++  D C +    + 
Sbjct: 113 RWAECAGIERGNDAFWLAVELIYQRTRSNGAGTAGNPQIPGLEDRQHYIDNCASSNPAVR 172

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIIDSMIQDS 229
                +   +    I +TP   I            G     V    ID +   S
Sbjct: 173 KAVVSQAHKASIGGITATPTLVIKDKHSGRTIKLQGAPDGDVLLSAIDWLAAGS 226


>gi|83643873|ref|YP_432308.1| protein-disulfide isomerase [Hahella chejuensis KCTC 2396]
 gi|83631916|gb|ABC27883.1| Protein-disulfide isomerase [Hahella chejuensis KCTC 2396]
          Length = 353

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 55/186 (29%), Gaps = 10/186 (5%)

Query: 45  RALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYI 104
                A          G   A V++VE+A   C HC    +   K +  +          
Sbjct: 176 PHAPVADLQLEGYPVRGNAQAAVSIVEFADFRCSHCKHASHTLRKIVAAQSDNVRWTMVD 235

Query: 105 LREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAG 164
                  SV           + +    +                      ++  +A+  G
Sbjct: 236 FPVTGKTSVYLAQAAYCAGKQNKYWEFHDALFDYDGK---------LSEASIAGVAESLG 286

Query: 165 FSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDS 224
                 + C +    +  ++  + +A E   +  TP  FI G  + GD  E V  + +++
Sbjct: 287 LDAAKIEECASSPEAVQFVEKEQSQAIE-LGLRGTPAIFINGLPFHGDNLEAVLEEAVNA 345

Query: 225 MIQDST 230
            +  S 
Sbjct: 346 AVARSR 351


>gi|297622777|ref|YP_003704211.1| DSBA oxidoreductase [Truepera radiovictrix DSM 17093]
 gi|297163957|gb|ADI13668.1| DSBA oxidoreductase [Truepera radiovictrix DSM 17093]
          Length = 223

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 72/220 (32%), Gaps = 17/220 (7%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVT 68
            V  G++ L +     Y R           +   D R              +G   APV 
Sbjct: 15  LVTLGVLALVVLGIVLYARLAPRAAGAAAGELSFDGR------------PMLGDPAAPVE 62

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA-EKR 127
           +  +    C  CA F       +E + I+TG+ R     +P     +    +A     ++
Sbjct: 63  IAVFEDFKCPACAYFDESILPRVERELIETGQARMYFIHYPFLGPDSTTAAIASECAYRQ 122

Query: 128 MDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF--SKNDFDTCLNDQNILDDIKA 185
            +  +W F + +F  Q +          L ++A+        ++   C  ++   + I+A
Sbjct: 123 NEAAFWDFKTYVFRSQGNETQEWATPARLADIARNNVPALDADELRACTEEERYAEVIRA 182

Query: 186 GKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            ++  +    +  TP   + G       S       + + 
Sbjct: 183 DRELGNRA-GVRGTPTVLVDGVALD-SFSFEAIQAAVQNA 220


>gi|262276827|ref|ZP_06054620.1| dsba oxidoreductase [alpha proteobacterium HIMB114]
 gi|262223930|gb|EEY74389.1| dsba oxidoreductase [alpha proteobacterium HIMB114]
          Length = 194

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 66/165 (40%), Gaps = 2/165 (1%)

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             +  + +  ++S+TC HCA+FH      L +KY+ + K+   L +FPLD     A  + 
Sbjct: 32  DPEPKIVIKVFSSLTCPHCADFHLNVMPKLLEKYVLSEKVLIKLMDFPLDLSGLKAAQIQ 91

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
           +C        Y   +     +       K     +  +    G    DF  CL ++   D
Sbjct: 92  KCLPLETQKSYLDEIYKTQPQWTTAKTLKELEANIEKITSKLGLQGKDFRNCLKNKKNED 151

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
            +   + +A   + ID+TP   I    + G  S     K ID ++
Sbjct: 152 AVLQSRIKAQSKYEIDATPTLIINEKKFKG--STKELEKYIDKLL 194


>gi|56709144|ref|YP_165189.1| 27kDa outer membrane protein [Ruegeria pomeroyi DSS-3]
 gi|56680829|gb|AAV97494.1| 27kDa outer membrane protein [Ruegeria pomeroyi DSS-3]
          Length = 244

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/178 (12%), Positives = 51/178 (28%), Gaps = 11/178 (6%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
                 +G  +  VT+VE+    C +C     +    ++        +          S 
Sbjct: 78  DPNAPVLGNPEGDVTVVEFFDYNCPYCRRAMAEVQGLVDADPNVR-LVYREWPILGEGSD 136

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                 LA   + + +  +W  + +                 +L +A+  G         
Sbjct: 137 FAARAALAARQQGKYEAFHWALMGMSGKA---------NETGVLRIAREVGLDTEQLQRD 187

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
           +    +   I      A +    + TP F +   L  G + +      +D   + + +
Sbjct: 188 MEAPEVTAHIAQSMALA-QKLGFNGTPSFVVEDALVPGFVEQSQLQDAVDRARKAAAK 244


>gi|168237178|ref|ZP_02662236.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194738162|ref|YP_002114113.1| copper sensitivity supression protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194713664|gb|ACF92885.1| suppression of copper sensitivity: lipoprotein modification in lgt
           mutants of E coli [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197289840|gb|EDY29201.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 207

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/214 (12%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGTKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S+V          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAA 204


>gi|270262855|ref|ZP_06191126.1| DSBA oxidoreductase [Serratia odorifera 4Rx13]
 gi|270043539|gb|EFA16632.1| DSBA oxidoreductase [Serratia odorifera 4Rx13]
          Length = 238

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/209 (10%), Positives = 55/209 (26%), Gaps = 14/209 (6%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                  +   +          +    A         +G  +A +T+V +    C +C  
Sbjct: 43  ILAQAVDAWQQQTAGQQIDQAIKQNAKALYEDPASPRLGAGNARLTLVVFTDYNCPYCKR 102

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
           F     K ++        +  +++  P    S+V+         +     +  +      
Sbjct: 103 FDPMLEKIVKQNPE----VALVVKLLPFKGESSVSSARVALTAWQQHPDQFWALHQRLMA 158

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           +  + +S +               +      +    +           +E   +  TP  
Sbjct: 159 KKGFHDSASIAA----------AQQKTGVKAVAPSELSMTTLRTNMELAEKLGVQGTPAT 208

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            IG  +  G +S      I+   +  +  
Sbjct: 209 LIGDQMLPGAVSYEELEAIVKQQLAKAKN 237


>gi|259419086|ref|ZP_05743003.1| dsba oxidoreductase [Silicibacter sp. TrichCH4B]
 gi|259345308|gb|EEW57162.1| dsba oxidoreductase [Silicibacter sp. TrichCH4B]
          Length = 254

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 59/184 (32%), Gaps = 8/184 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
            +A L            G  +  +T+VE+    C +C +   +    L         ++ 
Sbjct: 76  VKANLQELQDDGYSWVGGNPEGDITLVEFMDYRCGYCRKAAPEVEALLAADKNIRFVVKE 135

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
                    VS+   +         D  Y      L   Q +         AL  MA+  
Sbjct: 136 FPILGEASMVSSRFAVA--TKMVAGDEAYKNIHDTLIAFQGEPN-----EVALRRMAEGL 188

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
               +     ++D  + D I+  +  A +  +I  TP F +   +  G +       +ID
Sbjct: 189 SLDADAILAKMDDPEVTDQIQRTRTLA-QTLSISGTPTFVLEDEMLRGYLPADQLQIMID 247

Query: 224 SMIQ 227
           ++ +
Sbjct: 248 TIRE 251


>gi|322616487|gb|EFY13396.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619738|gb|EFY16613.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622567|gb|EFY19412.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629718|gb|EFY26493.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632563|gb|EFY29309.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636943|gb|EFY33646.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641520|gb|EFY38158.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644821|gb|EFY41355.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649685|gb|EFY46116.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654016|gb|EFY50339.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658549|gb|EFY54811.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663406|gb|EFY59608.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670140|gb|EFY66280.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674796|gb|EFY70887.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676734|gb|EFY72801.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682657|gb|EFY78676.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686337|gb|EFY82319.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195706|gb|EFZ80882.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199854|gb|EFZ84943.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202847|gb|EFZ87883.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209117|gb|EFZ94054.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323212398|gb|EFZ97216.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217924|gb|EGA02639.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222211|gb|EGA06595.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323227470|gb|EGA11633.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229726|gb|EGA13849.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323232951|gb|EGA17047.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240686|gb|EGA24728.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243000|gb|EGA27021.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247691|gb|EGA31636.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252692|gb|EGA36530.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323261682|gb|EGA45256.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323268071|gb|EGA51550.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269921|gb|EGA53370.1| suppressor for copper-sensitivity C [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 207

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/214 (11%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       + AA  +      IG K   +T+V +   
Sbjct: 5   IVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  I++  P    S++          R     +  
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVIIKPLPFKGESSILAARIALTTWREHPQQFLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                    D+  ++ I+   + A     
Sbjct: 121 LHEKLMQKRGYHTDDSIKQAQQKAGATPVTL---------DEKSMETIRTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           +  TP   IG  L  G +       ++   +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWDALEAVVKEKLAAA 204


>gi|49475572|ref|YP_033613.1| Outer membrane protein [Bartonella henselae str. Houston-1]
 gi|49238379|emb|CAF27606.1| Outer membrane protein [Bartonella henselae str. Houston-1]
          Length = 285

 Score = 83.5 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 66/203 (32%), Gaps = 9/203 (4%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                K    +            +L      +  D  +G  +    +V++    C +C  
Sbjct: 91  LILQDKLEKQSAQNTQKQASIINSLKKQIFQSPYDAVLGNPNGKRVLVDFFDYNCGYCKI 150

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
            +      +++          I     L S S  A ++A    K+    Y  F   L   
Sbjct: 151 SYPYIENLIKEYPDLRV---IIKDLPILGSDSMAAHIVAYAFRKQFPEKYPQFYKELLTH 207

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           Q             + +A   G  +      + D ++ +  K   + AS    I  TP +
Sbjct: 208 QSRAN-----EIKAIKIAVSLGADEKKLRNAIKDSSLQNAFKKNIQIAS-RLNITGTPSY 261

Query: 203 FIGGNLYLGDMSEGVFSKIIDSM 225
            IG  L +G +SE +  + I++M
Sbjct: 262 IIGDKLLIGAVSEEILKEAIENM 284


>gi|313126726|ref|YP_004036996.1| protein-disulfide isomerase [Halogeometricum borinquense DSM 11551]
 gi|312293091|gb|ADQ67551.1| protein-disulfide isomerase [Halogeometricum borinquense DSM 11551]
          Length = 222

 Score = 83.1 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 66/196 (33%), Gaps = 4/196 (2%)

Query: 38  PDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
                           ++   ++G +DA VT+  Y    C HCA ++   F  ++  YI 
Sbjct: 28  SQSKPSCEVGDLEQVKSLPTPTLGPEDADVTVDVYEDFACPHCATYNVDVFPKVKQNYID 87

Query: 98  TGKL--RYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
           TGK+  R+     P+    +    +A  A +        F       +     + N    
Sbjct: 88  TGKIRYRFFDFPIPVSKQWSWGGAIAARAVQDRTDDETYFKYAKRLFEKQNELTSNGYTV 147

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
           + ++A        +    +        +K+ ++R  E   I  TP   + G    G    
Sbjct: 148 IHDVANEFDVDGCEVMASVEQDIYRSVVKSDRQRGIE-VDIGGTPAIIVNGEHLSGA-GW 205

Query: 216 GVFSKIIDSMIQDSTR 231
                 I+  ++ +++
Sbjct: 206 ETVKNGIEGHLKSASK 221


>gi|56697436|ref|YP_167804.1| 27 kDa outer membrane protein, putative [Ruegeria pomeroyi DSS-3]
 gi|56679173|gb|AAV95839.1| 27 kDa outer membrane protein, putative [Ruegeria pomeroyi DSS-3]
          Length = 252

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/199 (10%), Positives = 54/199 (27%), Gaps = 8/199 (4%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
               +      +   +       +       G  D  +T+VE+    C +C     +  +
Sbjct: 60  QRKAQEEAQQDLELVQVNAEELFNDGYSWVGGNPDGDITLVEFMDYRCGYCRRAVPEVDE 119

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            L+        ++           S+   +                     +        
Sbjct: 120 LLKTDGNIRLIIKEFPILGEASLASSRFAVATLIVAG-------PDAYKQVHDALLDFTG 172

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
           +    AL  + +  G   +     +  + +   +   +  A +   I  TP F +   + 
Sbjct: 173 EADEVALGRIGEGLGLDTDAILAEMESEEVTRRLAETRALA-QRLNISGTPSFVMETEML 231

Query: 210 LGDMSEGVFSKIIDSMIQD 228
            G +      +I+D++  +
Sbjct: 232 RGFLPADQMRQIVDALRAE 250


>gi|157371586|ref|YP_001479575.1| DSBA oxidoreductase [Serratia proteamaculans 568]
 gi|157323350|gb|ABV42447.1| DSBA oxidoreductase [Serratia proteamaculans 568]
          Length = 238

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/209 (10%), Positives = 57/209 (27%), Gaps = 14/209 (6%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
                  +   +          +    A         +G  +A +T+V +    C +C  
Sbjct: 43  ILAQAVDAWQQQTAGQQISQAIKQNAKALYEDPASPRLGAANAKLTLVTFTDYNCPYCKR 102

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
           F     K ++        +  +++  P    S+V+         +     +  +      
Sbjct: 103 FDPMLEKIVKQYP----DVALVVKLLPFKGESSVSSARVALTAWQQHPDQFWALHQRLMA 158

Query: 143 QDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVF 202
           +  + ++ +               K         +  +  ++   + A E   +  TP  
Sbjct: 159 KKGFHDTASIAA---------AQQKTGVKEVAPSELSMTTLRTNMELA-EKLGVQGTPAT 208

Query: 203 FIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            IG  +  G +S      ++   +     
Sbjct: 209 LIGDQMLPGAVSYEELEAMVKQQLAKVKN 237


>gi|295687465|ref|YP_003591158.1| putative disulfide isomerase [Caulobacter segnis ATCC 21756]
 gi|295429368|gb|ADG08540.1| putative disulfide isomerase [Caulobacter segnis ATCC 21756]
          Length = 202

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 83/171 (48%), Gaps = 5/171 (2%)

Query: 48  LAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILRE 107
            +A  +   D+S+G KDA +T+VEYAS+ C  CA +  + +   + KYI TGK+RY+ RE
Sbjct: 22  ASAPTAMADDMSLGNKDAKITVVEYASVGCPVCAAWQKEVYPAFKAKYIDTGKVRYVFRE 81

Query: 108 F--PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGF 165
                 S  TVA      A       Y+  V  +F  Q         R+ LL +AK +G 
Sbjct: 82  MLVGGGSEVTVASAGFLLARCAGKEKYFPVVDAVFASQ--PGVFDTPRETLLEIAKSSGM 139

Query: 166 SKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY-LGDMSE 215
           S++ F  C+ D+  +  + A  +R + +  + +TP F I G     G  S 
Sbjct: 140 SEDQFTQCVTDEAQIKALNARVERNASENDVTATPTFEINGRKMEPGYHSL 190


>gi|54309329|ref|YP_130349.1| outer membrane protein [Photobacterium profundum SS9]
 gi|46913765|emb|CAG20547.1| Hypothetical outer membrane protein [Photobacterium profundum SS9]
          Length = 247

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/256 (8%), Positives = 64/256 (25%), Gaps = 43/256 (16%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDV------ 58
             ++ ++   V   +          +A       D +V  + +L   P  +  +      
Sbjct: 1   MKKLSLIAAAVSAVLFVAAI--PAKAAPLTSEQQDNLVKIQTILEQKPELIDGLLTSLNM 58

Query: 59  --------------------------SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLE 92
                                     + G ++  +T++ +    C +C        +  E
Sbjct: 59  YIDQENKTAVTLKKYHDWLYNNPDLAAFGSENPKLTIINFTDFNCPYCKRLDPVLQRLTE 118

Query: 93  DKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNY 152
           +         ++  +    +              + D   +  V     +++   +  + 
Sbjct: 119 ENQEVRVVNVFVPLQQREVAGIDTNSAQYALNVWKNDPDGYMKVHDYLIRKNGRHDKSSL 178

Query: 153 RDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD 212
                                     +   +    +  SE   ++ TP   IG  +  G 
Sbjct: 179 ERVAQVTNTKML--------LDASNTLKPTVDKSYQVFSE-LGLNGTPAMLIGDQILPGY 229

Query: 213 MSEGVFSKIIDSMIQD 228
           +       I++  ++ 
Sbjct: 230 LPYDQLKPIVEEALKK 245


>gi|268316621|ref|YP_003290340.1| DSBA oxidoreductase [Rhodothermus marinus DSM 4252]
 gi|262334155|gb|ACY47952.1| DSBA oxidoreductase [Rhodothermus marinus DSM 4252]
          Length = 409

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/174 (13%), Positives = 53/174 (30%), Gaps = 10/174 (5%)

Query: 57  DVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTV 116
           D + G  DA V ++EY    C HC   H    + +E   ++   +   +  +        
Sbjct: 245 DPTAGNPDAKVVVIEYLDPNCPHCKHLHPIMKQVVESYGLQAYFVFKPIPLWQFSIPQVA 304

Query: 117 AVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLND 176
           A+               G    +   Q +   S       +     A     +      +
Sbjct: 305 ALYA---------AAREGKFEAMLEAQFERQRSGGLTLEEILDIAEAIGMDRNELARQIN 355

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLG-DMSEGVFSKIIDSMIQDS 229
           + + ++    + R +    +   P   I G+   G   +     ++I+   + S
Sbjct: 356 EGVFNEYMQRQSRQASMIGVRGVPTVLINGHFVPGYARTVECLGQLIEQQAKGS 409


>gi|237730947|ref|ZP_04561428.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906486|gb|EEH92404.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 207

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/217 (9%), Positives = 56/217 (25%), Gaps = 14/217 (6%)

Query: 16  LLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           ++ + + F                       +  A  +      IG K A +T++ +   
Sbjct: 5   IVLLLTLFSAVSIAKEPAPFTPEQEKQIEALIQEALFNDPNSPRIGAKQAKLTLINFTDY 64

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C +C +      K ++        +  +++  P    S+                    
Sbjct: 65  NCPYCKQLDPMLEKIVQKYP----DVAVVIKPLPFKGESSELAARTVLTTWHEHPQQSLA 120

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
           +     ++  +    + + A                         + +    + A     
Sbjct: 121 LHEKLMQKKGYHTDVSIKQAQEKAGASPVTLDAQS---------AETLSTNLQLA-RLVG 170

Query: 196 IDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           +  TP   IG  L  G +      +++   +  +  +
Sbjct: 171 VQGTPATIIGDELIPGAVPWETLEEVVKEKLAAANAQ 207


>gi|288933615|ref|YP_003437674.1| DSBA oxidoreductase [Klebsiella variicola At-22]
 gi|288888344|gb|ADC56662.1| DSBA oxidoreductase [Klebsiella variicola At-22]
          Length = 203

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 73/220 (33%), Gaps = 22/220 (10%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           +  ++LL ++++ F     +A  E P  +G      LL   P++      G K   +T+V
Sbjct: 4   ITALLLLCVSAFSF-----AAPAEEPQSNGNDQLAQLLFNDPNS---PRTGAKAPKLTIV 55

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
            +    C +C +F     K + D       ++ +  +      +      A    ++   
Sbjct: 56  SFTDYNCPYCKQFDPLLEKIVHDNPDIQLIVKLLPFKGQSSVNAA---KAALSTWRQQPD 112

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
            +W     L  K+    ++                 K   D+   D   +D +K      
Sbjct: 113 KFWTLHQRLMAKKGYHDDASIAAA----------QKKTATDSVNIDDKTMDSLKMNLIL- 161

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDST 230
           S+   I  TP   IG  +  G +       ++   +  + 
Sbjct: 162 SQVLNIQGTPATIIGDQMVAGAIPAEDLEGLVKEQLAKAR 201


>gi|284043941|ref|YP_003394281.1| DSBA oxidoreductase [Conexibacter woesei DSM 14684]
 gi|283948162|gb|ADB50906.1| DSBA oxidoreductase [Conexibacter woesei DSM 14684]
          Length = 235

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/240 (14%), Positives = 70/240 (29%), Gaps = 17/240 (7%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSA----------LNELPIPDGVVDFRALLAAS 51
           +    +I +    +++       +                             +A  A  
Sbjct: 1   MTRNVKISIALVAIVVLAGVTLAFATDSGDRGAPTTAAATTASAAATGTGTAAQAAPAPQ 60

Query: 52  PSTMKDVSI-GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPL 110
                   +   +D  VT+VE+    C  C   +    +    +    G++ + +R FP+
Sbjct: 61  AIRPDSHRLSTARDGRVTLVEFLDFECESCRALYPYLEQL---RAEYDGRVTFAIRYFPI 117

Query: 111 DSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWIN-SKNYRDALLNMAKFAGFSKND 169
            S +   +         + G        +F  Q +W    ++ R   L  A   G   + 
Sbjct: 118 ASHTNAQLAAQAVEAASLQGRLEPMYRTMFETQAEWGESQESRRATFLGFASRLGLDMDR 177

Query: 170 FDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
           F   L+D      I   ++       +  TP  F+ G       S       ID+ +  S
Sbjct: 178 FRRDLDDPRTAARIARDQEEGL-ALGVQGTPTLFLNGEQLQ-LESVDQLKAEIDAALAGS 235


>gi|239931861|ref|ZP_04688814.1| hypothetical protein SghaA1_26812 [Streptomyces ghanaensis ATCC
           14672]
 gi|291440229|ref|ZP_06579619.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291343124|gb|EFE70080.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 258

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 60/227 (26%), Gaps = 9/227 (3%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS-IGQKDA 65
           R G++ G  ++ +          +A                 A +      V  +G+KDA
Sbjct: 30  RRGLIVGASVVCVLGLAAVIGVVAANAGKDDESDSAGPVVTPAGALGEDGTVIPVGKKDA 89

Query: 66  PVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK---LRYILREFPLDSVSTVAVMLAR 122
             T+  +    C  C  F       + +             +         +        
Sbjct: 90  KATLTVWEDFRCPACKAFEQAYGPTVNELTAAGQLKVEYHLVTLIDGGMGGTGSRNAANA 149

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSKNDFDTCLNDQNIL 180
            A  + DG +  +  +LF  Q    +     +   +    K  G     F +C+ D    
Sbjct: 150 AACAQDDGKFAAYHEVLFANQPLESDDAYADNDRLIELAGKVDGLDTPAFRSCVEDGRHN 209

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGN--LYLGDMSEGVFSKIIDSM 225
             +      A +      TP     G        M+     +++   
Sbjct: 210 SWVAKSH-EAFQKGGFTGTPTVLFDGENIYQDRSMTPEKLKQMVQEA 255


>gi|303246398|ref|ZP_07332677.1| DSBA oxidoreductase [Desulfovibrio fructosovorans JJ]
 gi|302492108|gb|EFL51983.1| DSBA oxidoreductase [Desulfovibrio fructosovorans JJ]
          Length = 260

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/203 (20%), Positives = 69/203 (33%), Gaps = 7/203 (3%)

Query: 21  SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDV-SIGQKDAPVTMVEYASMTCFH 79
           +        +   +  +              P+      S+G  +APVT+VEY+   C  
Sbjct: 50  AVLEVIENTARARQRDLERARFAAELAKPLKPALEPGRASLGPANAPVTIVEYSDFLCHF 109

Query: 80  CAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLL 139
           CA+ +                +R + + F        A +       +     W F+   
Sbjct: 110 CAQANGTVKAL---LKKHPDDVRLVFKHFATGKNDARAALYFEAINLQDPKKAWAFMDKA 166

Query: 140 FNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           F  Q+   N     +AL  MAK  G   N     L  +++ + IKA  K A   F    T
Sbjct: 167 FADQEAVANKG--DEALSAMAKELGVDMNRLAKDLTRKDLAERIKADVKEA-RGFGFAGT 223

Query: 200 PVFFIGGNLYLGDMSEGVFSKII 222
           P+F I G    G +   +  + +
Sbjct: 224 PIFLINGAAVRGAVPLDILEEYV 246


>gi|301382764|ref|ZP_07231182.1| hypothetical protein PsyrptM_09032 [Pseudomonas syringae pv. tomato
           Max13]
          Length = 234

 Score = 83.1 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 61/234 (26%), Gaps = 12/234 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TR  +L GI  + +A   F       + +        +  +              G
Sbjct: 1   MKRPTRRQILYGIGAVALAILAF--ECLPDVRQAMQMLNTAESVSKTTKQTKHNGAWVYG 58

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
              A  T+VEYA + C +C ++  +   +      +   +       PL      A   A
Sbjct: 59  SSSARFTIVEYADLECPYCKDYFPQLKAW----VDQHPDVNLQWHHLPLPMHEPAASYEA 114

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
           R AE            L          S                 ++  D C +    + 
Sbjct: 115 RWAECAGIERGNDAFWLAVELIYQRTRSNGAGATGNPQIPGLEDRQHYIDNCASSNPAVR 174

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIIDSMIQDS 229
                +   +    I +TP   I            G     V    ID +   S
Sbjct: 175 KAVVSQAHKASIGGITATPTLVIKDKHSGRTIKLQGAPDGDVLLSAIDWLAAGS 228


>gi|311744606|ref|ZP_07718405.1| DSBA oxidoreductase [Aeromicrobium marinum DSM 15272]
 gi|311312089|gb|EFQ82007.1| DSBA oxidoreductase [Aeromicrobium marinum DSM 15272]
          Length = 223

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 78/226 (34%), Gaps = 11/226 (4%)

Query: 4   STTRIGVL-GGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           STTR  V+   +V L +A+   +           +    +    L  A    ++D   G 
Sbjct: 5   STTRRTVITAALVTLSLAALGVFVALEMRDKPPVVESSGIADPRLFRADSHVIQDAPEGS 64

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
                 +VE+    C  C   +    +    +    G++ +++R FPL            
Sbjct: 65  P----VLVEFLDFECEACGALYPAIEQL---RQDFDGQIEFVVRYFPLPGHVNSRNAAHA 117

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTCLNDQNILD 181
                  G +     +LF  Q  W  S++ +       A+  G     +D  +  +++  
Sbjct: 118 AEAAARQGAFEPMYRMLFETQTSWGESQDDQSAVFRGFAEDLGLDLAQYDRDVTSEDVAA 177

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            +++  + A     +  TP  F+ G +     +   F+  ++S   
Sbjct: 178 RVESDFQDALS-LGLTGTPSLFLDGEILQ-PRTLDDFTDALESAAA 221


>gi|320105544|ref|YP_004181134.1| putative lipoprotein [Terriglobus saanensis SP1PR4]
 gi|319924065|gb|ADV81140.1| putative lipoprotein [Terriglobus saanensis SP1PR4]
          Length = 309

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 77/215 (35%), Gaps = 13/215 (6%)

Query: 23  FFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAE 82
              +  G+ + +    D  VD +  L+      +    G  DAPV +V Y  + C +CA 
Sbjct: 88  LLVSNDGTRVAQFMTYDIAVDPKLKLSTEDRPARG---GPLDAPVVIVSYDDLECPYCAR 144

Query: 83  FHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNK 142
            H   F  L D+Y    ++ Y          +  A +   C       GYW  V  +   
Sbjct: 145 LHAALFPALMDRYKNQVRIAYRSFPLEGHLWAMHAAVDVDCLGAENAQGYWAAVDQIHAH 204

Query: 143 QDDWINSKN--------YRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDF 194
             ++  +++            ++N        ++    C+  Q+    ++     + +  
Sbjct: 205 AGEYGGAEHLLAKAEEELDTVVINEGHLFHVDESALRACIKKQDTT--LENANIDSGKKL 262

Query: 195 AIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            +  TP FFI G    G +      +++D+ +  +
Sbjct: 263 GVYRTPTFFINGMKIDGAVPISFVFEMVDNALNAA 297


>gi|302383805|ref|YP_003819628.1| DSBA oxidoreductase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194433|gb|ADL02005.1| DSBA oxidoreductase [Brevundimonas subvibrioides ATCC 15264]
          Length = 213

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 55/176 (31%), Positives = 86/176 (48%), Gaps = 5/176 (2%)

Query: 53  STMKDVSIGQKD-APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLD 111
           +   D++ G  + A VT++EYAS+TC HCA + N+ +   + KY+ T K+RY+ REFP  
Sbjct: 40  AAEGDMAQGAAEGAKVTVIEYASVTCSHCATWQNEVYPEFKAKYVDTNKVRYVFREFPTP 99

Query: 112 SVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFD 171
            V   A      A       Y+  +  +   Q +   S   R  LL +A  AG S+  F 
Sbjct: 100 PVPIAA-AGFLVARCAGADKYFPVIHEIMASQAEL-FSGPPRPVLLRIANGAGLSEEQFQ 157

Query: 172 TCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
           TC+ DQ  ++ + A + +A     ++ TP FF+ G     D S    S  ID+ + 
Sbjct: 158 TCVTDQAGIEAMDA-RIKAGIAAGVEGTPTFFVNGEKVA-DTSLAGLSSKIDAALA 211


>gi|21233861|ref|NP_640159.1| hypothetical protein Rts1_198 [Proteus vulgaris]
 gi|21203045|dbj|BAB93761.1| hypothetical membrane protein [Proteus vulgaris]
          Length = 302

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 62/208 (29%), Gaps = 12/208 (5%)

Query: 33  NELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLE 92
           N+         ++   A+  S       G   A  T++ Y+ + C  C  FH      ++
Sbjct: 89  NDKVAEAQANLYKNWDASGESKDGHHMYGNPSARFTLINYSDLECPFCKRFHETPKYLVD 148

Query: 93  DKYIKTGKLRYILREFPLDSVSTVAVMLARCA--EKRMDGGYWGFVSLLFNKQDDWINSK 150
                     +                +      +++   G+W F    F          
Sbjct: 149 SAKNGMVNWVWRHFPLSFHEPMASKAAMMGECVAQQKGSKGFWAFTEYWFTNSAGNGQGF 208

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTP-VFFIGG--- 206
              D +    +  G +K  +++CL D  I+  IK   + A     +  TP    I     
Sbjct: 209 AGSDKI---PELFGLNKEQYESCLTDPVIIKKIKDDMQ-AGNVAGVTGTPATIVIDNETG 264

Query: 207 --NLYLGDMSEGVFSKIIDSMIQDSTRR 232
                +G      F ++I+ M      +
Sbjct: 265 KTETIVGAQPFAKFVQVIEGMAHPERAQ 292


>gi|148252673|ref|YP_001237258.1| hypothetical protein BBta_1102 [Bradyrhizobium sp. BTAi1]
 gi|146404846|gb|ABQ33352.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 211

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 73/221 (33%), Gaps = 20/221 (9%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +  T R GVLG +      S +    +    +E      + D  A             +G
Sbjct: 1   MFDTNRRGVLGALGAGVALSLWPRASRAQEADEPDEASVLRDPDA-----------PVLG 49

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
                + +VE+    C +C +   +  + + D      K+R++L+E+P+    +V     
Sbjct: 50  NAAGDIAIVEWFDYNCPYCRKLDPELHQVVHDDG----KVRWVLKEWPILGPVSVVAARM 105

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
             A K  D       +L+           +       +++              +   +D
Sbjct: 106 ALACKYQDKYARAHEALIGTSSKLTEPRID-----ELLSEAGIDVDRAKRDLAANAKAID 160

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKII 222
            + A   + +       TP F +G     G ++   F ++I
Sbjct: 161 AMLARNDKQARGLRFRGTPSFIVGKFRVPGVLTMAQFEQVI 201


>gi|254460382|ref|ZP_05073798.1| dsba oxidoreductase [Rhodobacterales bacterium HTCC2083]
 gi|206676971|gb|EDZ41458.1| dsba oxidoreductase [Rhodobacteraceae bacterium HTCC2083]
          Length = 248

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/183 (15%), Positives = 58/183 (31%), Gaps = 8/183 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
                 A          G  +  +T+VE+    C +C + H +  + LE        ++ 
Sbjct: 73  VATNAEALFEDGFSWIGGNPEGDLTVVEFLDYRCGYCRKAHEEVAQLLEADGNIRLIIKE 132

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
                   ++S+   + A+                  +        +    AL  +A+  
Sbjct: 133 FPILGEASAISSRFAIAAKQIGGNE-------AYKAVHDAMMSFGGEPSAAALGRLAEGL 185

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
           G +       ++ Q +  +I   +  A +   I  TP F +GG L  G +      +I+ 
Sbjct: 186 GLNAKAIVARMDSQEVEKEISETRALA-QRLQIRGTPTFVMGGQLVRGYVPLDAMQQIVK 244

Query: 224 SMI 226
              
Sbjct: 245 EER 247


>gi|302561176|ref|ZP_07313518.1| membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302478794|gb|EFL41887.1| membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 258

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/226 (13%), Positives = 62/226 (27%), Gaps = 8/226 (3%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           R  ++G  V+  +          +        D      A   A       + +G+ DA 
Sbjct: 30  RALIVGASVVCVLGLAAVIGVVAANSGGDGESDSAGPVVAPSGALGKDGTAIPVGKPDAK 89

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK---LRYILREFPLDSVSTVAVMLARC 123
            T+  +    C  C  F       + +             +         +         
Sbjct: 90  ATLTVWEDFRCPACKSFEQTYRPTIHELTDAGQLKVEYHLVTLIDNGLGGTGSRNAANAA 149

Query: 124 AEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA--LLNMAKFAGFSKNDFDTCLNDQNILD 181
           A  +  G +  +  +LF  Q    +     +A  +    K  G     F TC+ D     
Sbjct: 150 ACAQDAGKFAAYHDVLFRSQPMESDDAYADNAKLIDLAGKVDGLDTPAFRTCVEDGTHNS 209

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN--LYLGDMSEGVFSKIIDSM 225
            +    + A +    + TP     G        M+   F ++++  
Sbjct: 210 WVAKSHQ-AFQKGGFNGTPTVLFEGKNIYQDRSMTPAKFKQMVEEA 254


>gi|319408521|emb|CBI82174.1| Outer membrane protein [Bartonella schoenbuchensis R1]
          Length = 285

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 61/173 (35%), Gaps = 9/173 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
            +  D   G  +  VT+VE+    C  C  F+      +++       +         D 
Sbjct: 121 QSPHDAVFGNPNGKVTLVEFFDYNCNFCKRFYPSMVNLIKEYPDLRIII--------KDL 172

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
                  +            +      F K+     ++  +   + +A   G ++ D   
Sbjct: 173 PILGPDSIEAHTIAYAFRQQFPEKYFQFYKELLTSQNRANKAKAIKIAVSLGANEKDLYN 232

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
            + + N+    K   + AS    I+ TP   IG  +++G +SE +  + I+S+
Sbjct: 233 AIENPNLRKSFKRNIQIAS-TLNINGTPSHIIGDKVFIGAVSEDILKEAIESI 284


>gi|73538274|ref|YP_298641.1| DSBA oxidoreductase [Ralstonia eutropha JMP134]
 gi|72121611|gb|AAZ63797.1| DSBA oxidoreductase [Ralstonia eutropha JMP134]
          Length = 173

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 57/179 (31%), Gaps = 8/179 (4%)

Query: 49  AASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREF 108
                T  D +IG   A VT+VEY    C +C   +      +E    +   +       
Sbjct: 2   PDVAVTAADHAIGPDTARVTVVEYGDFECEYCRMAYGAMKILMEHYGPQVRFVYRHY--P 59

Query: 109 PLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKN 168
                 +                +W    LL  K      +    +AL + A   G   N
Sbjct: 60  MSHWHPSAEAAAECAEAAGAQQKFWQMYRLLHEK-----PNGLKSEALRHYAGMLGMDLN 114

Query: 169 DFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQ 227
            FD+ +   + L  I+    R +  + +  TP FF+ G +           + ID  + 
Sbjct: 115 RFDSDMAAHSHLPHIRDDM-RGATQWQVRGTPSFFVNGVVQDVTFGMERLQRAIDVALA 172


>gi|288921277|ref|ZP_06415560.1| DSBA oxidoreductase [Frankia sp. EUN1f]
 gi|288347308|gb|EFC81602.1| DSBA oxidoreductase [Frankia sp. EUN1f]
          Length = 223

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 50/168 (29%), Gaps = 9/168 (5%)

Query: 58  VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVA 117
            S G  DA V +VEY    C +CA       + +     +  ++         D      
Sbjct: 25  HSRGFPDAGVVIVEYGDFECPYCARAAGILRELVNTSDGQVRQVFRHFPV--FDVHPYAL 82

Query: 118 VMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQ 177
                       G +W    L+F  QD         D  L     A     D       Q
Sbjct: 83  TAALAAEVAGAHGRFWEMHDLMFANQDKLA------DKYLMGFARAVGLDADLVVGDPAQ 136

Query: 178 NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSM 225
              D ++     A++   ++ TP  FI G  Y G +  G     +   
Sbjct: 137 PYGDAVEDDYAGAAQ-LRVEGTPTIFIDGVRYRGRLELGPLRSAVARA 183


>gi|161831442|ref|YP_001596817.1| putative disulfide bond formation protein D [Coxiella burnetii RSA
           331]
 gi|161763309|gb|ABX78951.1| putative disulfide bond formation protein D [Coxiella burnetii RSA
           331]
          Length = 218

 Score = 82.7 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 81/227 (35%), Gaps = 17/227 (7%)

Query: 7   RIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAP 66
           +  VL  +V+    S         A              AL A +  T    ++G   AP
Sbjct: 7   KHLVLITVVIALTMSAIALALSKPA--------------ALKATTIDTKGQPTLGNPAAP 52

Query: 67  VTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEK 126
           V +V +  + C +CA F+ +    ++ KYI TG  +YIL        S  A   A C  K
Sbjct: 53  VHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYILITLAFLPGSPPAGNAALCLYK 112

Query: 127 RMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKF--AGFSKNDFDTCLNDQNILDDIK 184
           +    ++ FVS L+  Q D   +      LL  A+      +      C+        ++
Sbjct: 113 QNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVPQANMKQLSNCIFSSRYSGALQ 172

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
              K A +     +TP  ++ G      +++     +I      +  
Sbjct: 173 KNLKIAEKTMNPVATPAVYVNGVNVE-PLTQKRLEALIKGARSRAKN 218


>gi|294811606|ref|ZP_06770249.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|294324205|gb|EFG05848.1| DSBA oxidoreductase [Streptomyces clavuligerus ATCC 27064]
          Length = 239

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 55/202 (27%), Gaps = 6/202 (2%)

Query: 27  RKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNK 86
              +A    P   G              M D + G   APV +  +  ++C  C    + 
Sbjct: 37  GPAAAPTARPGGTGAAWAAPGPGWETGLMSDSTTGSPTAPVVLDVWCDLSCPDCRTALDD 96

Query: 87  TFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDW 146
                E    +                   A       E+     Y   +    ++  + 
Sbjct: 97  IRALRERYGDRLDIRLRHFPLEKNKHSYVSAQAAEEAVEQGRGREYAEELLARVDELRER 156

Query: 147 INSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGG 206
                    LL  A+  G    + DT L D      + A +    +   +  TP + +GG
Sbjct: 157 GAPV-----LLETARDLGLDAEEIDTALIDGRHTLIVDADQAEG-KALGVSGTPTYVVGG 210

Query: 207 NLYLGDMSEGVFSKIIDSMIQD 228
               G  S+      I+ +   
Sbjct: 211 QRLDGGQSQDGLRARIEEIADR 232


>gi|225734105|pdb|3F4S|A Chain A, Crystal Structure Of Wolbachia Pipientis Alpha-Dsba1 T172v
          Length = 226

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 55/187 (29%), Positives = 82/187 (43%), Gaps = 14/187 (7%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             D  +G   AP+ M+EYAS+TC+HC+ FH   F  +++KYI TGK+ YI R FPLD   
Sbjct: 29  PNDKLLGDPKAPILMIEYASLTCYHCSLFHRNVFPKIKEKYIDTGKMLYIFRHFPLDYRG 88

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYR-DALLNMAKFAGFSKNDFDTC 173
                            Y+ F   +FN  D W          L  +A  +   ++ F+ C
Sbjct: 89  L--KAAMLSHCYEKQEDYFNFNKAVFNSIDSWNYYNLSDLTLLQRIAALSNLKQDAFNQC 146

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFI-----------GGNLYLGDMSEGVFSKII 222
           +ND+ I+D I   K  A     I + P+FFI               + G      F+ +I
Sbjct: 147 INDKKIMDKIVNDKSLAINKLGITAVPIFFIKLNDDKSYIEHNKVKHGGYKELKYFTNVI 206

Query: 223 DSMIQDS 229
           D +   +
Sbjct: 207 DKLYGKA 213


>gi|217979787|ref|YP_002363934.1| DSBA oxidoreductase [Methylocella silvestris BL2]
 gi|217505163|gb|ACK52572.1| DSBA oxidoreductase [Methylocella silvestris BL2]
          Length = 211

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/227 (12%), Positives = 65/227 (28%), Gaps = 19/227 (8%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +++ +R G+L G V+             +   +L     + D                 G
Sbjct: 1   MLNVSRRGLLAGAVMAVCIGAASAAPLSADDPDLSREALLSDPAT-----------PVGG 49

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
             +  VT+V +    C  C +      + +         +R + +++P+    +V     
Sbjct: 50  DPNGDVTIVAFFDYNCPFCMKSEPALERLIASDKN----IRLVYKDWPIFGGVSVYAAKL 105

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
             A            +L+   +     ++  +         A    +           +D
Sbjct: 106 ALAANFQGKYAAAHHALMATSRRKSSEAEARQLVAAAGVDMARLDADFSGKAAQ----ID 161

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            I    ++ +       TPV+ IG  L    +    F K +      
Sbjct: 162 AILKRTEKQATGMGFAGTPVYLIGPFLVAAALDFDGFKKAVADARAK 208


>gi|27376460|ref|NP_767989.1| hypothetical protein blr1349 [Bradyrhizobium japonicum USDA 110]
 gi|27349600|dbj|BAC46614.1| blr1349 [Bradyrhizobium japonicum USDA 110]
          Length = 241

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/191 (16%), Positives = 65/191 (34%), Gaps = 12/191 (6%)

Query: 39  DGVVDFRALLAASPSTMKD-VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIK 97
               D   L         D    G  +  +T+VE++   C +C +   +  + ++D    
Sbjct: 57  AAAADDEVLTETKVLRDPDTPVAGNPEGNITIVEWSDYNCPYCRKLEPELRQVVQDDG-- 114

Query: 98  TGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALL 157
             K+R +++++P+    +V                +       +     ++S+     + 
Sbjct: 115 --KVRLVMKDWPILGPVSVTAARI------ALAAKFQDKYHQAHDAMMGVSSRLTEPRIN 166

Query: 158 NMAKFAGFSKNDFDTCLNDQ-NILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
            +   AG   +     L D    +D I       +E F    TP F +G     G +S  
Sbjct: 167 ELLAAAGVDMDRLKRDLTDHAKDIDTILKRNNEQAEAFGFRGTPAFIVGKYRVPGVLSMT 226

Query: 217 VFSKIIDSMIQ 227
            F ++I    +
Sbjct: 227 EFEQVIADARK 237


>gi|306843808|ref|ZP_07476406.1| DSBA oxidoreductase [Brucella sp. BO1]
 gi|306275886|gb|EFM57602.1| DSBA oxidoreductase [Brucella sp. BO1]
          Length = 265

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/179 (13%), Positives = 50/179 (27%), Gaps = 9/179 (5%)

Query: 53  STMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDS 112
               D   G  +  VT+ E+    C +C          L+        L+      P   
Sbjct: 96  DPKHDAVFGNPNGDVTVYEFFDYNCGYCKRALPDMEAILKKDPSVRYVLKEFPILGPDSM 155

Query: 113 VSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDT 172
            + V     +         +   +           + +   ++ +  A   G  +     
Sbjct: 156 RAHVVSQAFKALMPEKYPEFHEMLL--------GGHGRATEESAIADAVKLGADEAKLRE 207

Query: 173 CLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
            + D  I    +   + A +   I  TP + IG  L  G +      + I +    + +
Sbjct: 208 KMKDPAITGAFQRTYQLA-QQLNITGTPSYVIGEELVPGAIGIDGLRERITAARDAAKK 265


>gi|260907522|ref|ZP_05915844.1| DSBA oxidoreductase [Brevibacterium linens BL2]
          Length = 206

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 63/218 (28%), Gaps = 12/218 (5%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           + G+  L +A    +    +       P        L+      +       K      V
Sbjct: 1   MIGVAALVLAGLLVFNDDSNEPEPETAPTSADTADLLVRDDSPRL------SKGGEAVFV 54

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           E+    C  C   +       ++   +   +   +        + +A   A    +    
Sbjct: 55  EFLDFECEGCLSLYPVIEDLRKEYGDRVTFVVRHMPLHNNSVNAALAAEAAAEQGEFEAM 114

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
               F ++      +       R+     AK  G   + F    +D   L+ ++  +K  
Sbjct: 115 YQRLFETVDEWGHQETSQ----REKFSGYAKELGLDMDQFTASYDDPATLERVEQSQKDG 170

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            +   +  TP FF+ G       S     +  D+ +QD
Sbjct: 171 -QALGVTGTPTFFLDGEKLQ-PESVTDLEEAFDAALQD 206


>gi|254451639|ref|ZP_05065076.1| dsba oxidoreductase [Octadecabacter antarcticus 238]
 gi|198266045|gb|EDY90315.1| dsba oxidoreductase [Octadecabacter antarcticus 238]
          Length = 251

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/199 (12%), Positives = 53/199 (26%), Gaps = 8/199 (4%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
           +   +          +  + A          G  D  +T+VE+    C  C   H +  +
Sbjct: 60  NRQEQAEATRDETLAQVNMNALIDDGFSFVGGNPDGDITIVEFIDYRCGFCRRAHPEVAE 119

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            +        ++         +     +           D  Y      L   Q D   +
Sbjct: 120 LVTSD--GNIRIITKEFPILGEQSVLASQFAVATKTVAGDEAYKLVSDALIALQSDVTPT 177

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
                 L ++A       +     +N       +   +    +   I  TP F  G  + 
Sbjct: 178 S-----LSSLASAFDLDGDAIFAEMNSDATKAVLANNRALG-DRMQITGTPTFVFGDQMV 231

Query: 210 LGDMSEGVFSKIIDSMIQD 228
            G ++     +I++    D
Sbjct: 232 RGYINLAQMRQIVEQERDD 250


>gi|254499963|ref|ZP_05112116.1| DSBA-like thioredoxin domain protein [Labrenzia alexandrii DFL-11]
 gi|222441430|gb|EEE48107.1| DSBA-like thioredoxin domain protein [Labrenzia alexandrii DFL-11]
          Length = 219

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 70/227 (30%), Gaps = 8/227 (3%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             R  ++  ++    AS+       +    L     +V     +   P +     +G ++
Sbjct: 1   MNRRTLILSVLAPASASFVGAAWYVNRQAPLESAQPLVSEGNEVLVRPYS---PILGPEN 57

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           APVT+VE+    C  C  FH      L         +  ++  +     +     +    
Sbjct: 58  APVTIVEFFDPACEACRAFHPIVKDLLAQHEP----VVRVVMRYTAFHGAASEEAIRILE 113

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
             RM G +   +  +  +Q  W +  + +  L+     A     +          +  I 
Sbjct: 114 AARMQGVFEPVLEAVLREQPRWASHGSPQPGLILGIAAAAGLDAEAARTQMLAPDVVGIL 173

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTR 231
              +   E   +  TP FF+ G             +++ + +     
Sbjct: 174 NQDRADVEAVGVRQTPTFFVNGKPLDPFGDVE-LRRLVSAEVAAVQN 219


>gi|332706392|ref|ZP_08426454.1| protein-disulfide isomerase [Lyngbya majuscula 3L]
 gi|332354829|gb|EGJ34307.1| protein-disulfide isomerase [Lyngbya majuscula 3L]
          Length = 252

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/206 (13%), Positives = 58/206 (28%), Gaps = 10/206 (4%)

Query: 19  IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
           +        +     E       +                + G  +  + +VE++   C 
Sbjct: 55  VILESVQRYQQQLERESQQQQQAILQGFKTNPQAFIGSSPATGSTEDKIVLVEFSDFQCP 114

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
            CA  H+   +++ +   +   +        + S +  A   A  A ++    +W +   
Sbjct: 115 FCARAHDTVNQFIANHGDEVTLVYKHFPLTSIHSQALPAAQAAWAATQQG--KFWQYHDA 172

Query: 139 LFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDS 198
           LF  Q           A         F+++              I    + A E   +  
Sbjct: 173 LFANQKQLGEELYLAIAQDLNLDLEEFNRDRNAADR-------AIAEDMQLA-EILGLSG 224

Query: 199 TPVFFIGGNLYLGDMSEGVFSKIIDS 224
           TP F + G  + G +       I+  
Sbjct: 225 TPFFVMNGEAFSGAVPLQQMEAILAR 250


>gi|325003170|ref|ZP_08124282.1| DSBA oxidoreductase [Pseudonocardia sp. P1]
          Length = 213

 Score = 82.7 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 54/168 (32%), Gaps = 6/168 (3%)

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
             A V  VE+    C  C   +    +  ++      ++ +++R FP+ S +        
Sbjct: 51  PGATVDFVEFLDFECEACGAAYPAIEQLRQEYGD---RVNFVIRYFPVQSHANAERAARA 107

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSK-NYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
                  G        +F  Q  W   +    D     A+  G     FD   ND   +D
Sbjct: 108 VEAAAQQGALEPMYKRMFETQAQWGEQQVPMDDRFRGYARDLGLDLVRFDVAYNDPATMD 167

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
            I A +        +  TP FF+ G       +     + +D  +  S
Sbjct: 168 RIDADRNDGLS-LGVQGTPTFFVNGERVT-VQTFDDLRRALDDALAAS 213


>gi|225872336|ref|YP_002753791.1| DSBA-like thioredoxin domain protein [Acidobacterium capsulatum
           ATCC 51196]
 gi|225793402|gb|ACO33492.1| DSBA-like thioredoxin domain protein [Acidobacterium capsulatum
           ATCC 51196]
          Length = 334

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 62/211 (29%), Gaps = 6/211 (2%)

Query: 19  IASYFFYTRKGSA---LNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASM 75
           +A   F+          N+  IP G   F A  A           G       +VE+A  
Sbjct: 115 VAGLTFFVTPDGHYLIANDSIIPFGPHPFAAARATLQQDATGAWQGSASKQHELVEFADF 174

Query: 76  TCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGF 135
            C HC        K + D        +              A           +  ++ F
Sbjct: 175 QCPHCKAAQPTAKKLVADFPNARYVYQPFPLVNVHPEAFKAADYGNCVTRIGGNTAFFKF 234

Query: 136 VSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFA 195
              +F  Q+D +N    +  L      AG        C         ++A  K A+E   
Sbjct: 235 ADSVFANQNDLVNDGGTKT-LDAAVTAAGLDPAKVAACAASPAGKAAVQADLKLANE-LN 292

Query: 196 IDSTPVFFIGGNLYL-GDMSEGVFSKIIDSM 225
           ++ TP  F+ G      ++      KII+  
Sbjct: 293 VNETPTLFVDGRPVPMTELPYPELKKIIEYQ 323


>gi|268680062|ref|YP_003304493.1| DsbA oxidoreductase [Sulfurospirillum deleyianum DSM 6946]
 gi|268618093|gb|ACZ12458.1| DsbA oxidoreductase [Sulfurospirillum deleyianum DSM 6946]
          Length = 208

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 67/222 (30%), Gaps = 14/222 (6%)

Query: 5   TTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKD 64
             +  +L   + LFI  Y   +   ++ N     +                    +G++D
Sbjct: 1   MKKQWILLSTLALFIGLYIAGSYLYTSANHTIPNEQQSSL--------YRSHAFVVGKED 52

Query: 65  APVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCA 124
           AP+T+VE+    C  C  F+    ++L+    +   +          S+    +  +R  
Sbjct: 53  APITIVEFFDPACVTCKNFYPFVKEFLKKHPKELKLMLRYAPFHQDSSIVVAMIEASRLQ 112

Query: 125 EKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK 184
            + ++     +                    + +    AG         +    I   I 
Sbjct: 113 NRYLETLEVIYRYQDQW----VSQHTPNIARIWSFLPEAGVDIERLKEDMKKPEIEAIIA 168

Query: 185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
                  +   I +TP FF+ G   +          +I+S +
Sbjct: 169 QDMAD-VKTLGIKATPEFFVNGKPLV-KFGYKELQTLIESEL 208


>gi|260906583|ref|ZP_05914905.1| DSBA oxidoreductase [Brevibacterium linens BL2]
          Length = 206

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 64/218 (29%), Gaps = 12/218 (5%)

Query: 11  LGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMV 70
           + G+  L +     +    +       P        L+      +       K +    V
Sbjct: 1   MIGVAALVLVGLLVFNNDSNEPKPETAPTSADTADLLVRGDSPRL------SKGSEAVFV 54

Query: 71  EYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDG 130
           E+    C  C   +       ++   +   +   +        + +A   A    +    
Sbjct: 55  EFLDFECEGCLSLYPVIEDLRKEYGDRVTFVVRHMPLHTNSVNAALAAEAAAEQGEFEAM 114

Query: 131 GYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRA 190
               F ++      +       R+     AK  G +   F    +D   L+ ++ G+K  
Sbjct: 115 YQRLFETVDEWGHQETSQ----REKFSGYAKELGLNMEQFTAAYDDPATLERVEQGQKDG 170

Query: 191 SEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            +   +  TP FF+ G       S     +  D+ +QD
Sbjct: 171 -QALGVTGTPTFFLDGEKLQ-PESVTDLKEAFDAALQD 206


>gi|117618988|ref|YP_858191.1| secreted protein, suppressor for copper-sensitivity C [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117560395|gb|ABK37343.1| secreted protein, suppressor for copper-sensitivity C [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 251

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/198 (12%), Positives = 52/198 (26%), Gaps = 13/198 (6%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                         +       ++     +G KD  +T+V +    C +C +F  +  K 
Sbjct: 65  QNAAAQEAQLGDFIKGNQDVLFNSATSPRLGAKDPKLTLVLFTDYNCPYCKQFDPQLTKL 124

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           L+      G +  +L      S       L     ++    +      L +KQ     + 
Sbjct: 125 LKAYPDDLGLVIKLLPFKGQSSAKAAQYSL--TLWQQEPARFLALHDKLMSKQGMLTEAD 182

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
             +                 +   N   I                +  TP   IG  L  
Sbjct: 183 INKALAATGNTALKPDAKATEELRNSLRI-----------GTLLGVQGTPATLIGNQLVP 231

Query: 211 GDMSEGVFSKIIDSMIQD 228
           G +      +++ + +  
Sbjct: 232 GAVPYDELEQLVKAELAK 249


>gi|295687793|ref|YP_003591486.1| thiol:disulfide interchange protein DsbA [Caulobacter segnis ATCC
           21756]
 gi|295429696|gb|ADG08868.1| thiol:disulfide interchange protein DsbA [Caulobacter segnis ATCC
           21756]
          Length = 206

 Score = 82.4 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 43/162 (26%), Positives = 72/162 (44%), Gaps = 2/162 (1%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
             ++ +G   APV +V YAS +C HCA +  +    +   ++ TGK+R++ REF      
Sbjct: 35  PGEMVLGSPTAPVQLVAYASASCPHCAHWWTEVLPQVRKSFVDTGKVRFVFREFLTPPTE 94

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                      +R+ G Y+  +S +F +Q++   S+   + L  + K  G +   F   +
Sbjct: 95  FA--AAGFILARRIPGKYFEVLSTVFQRQEEIYRSEKLWEGLQAIGKQYGLTDAQFAAAM 152

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEG 216
           ND   L  +     RA     I+ TP FF+ G    GD    
Sbjct: 153 NDPAALKGVNDRFFRALNQENIEVTPTFFVNGAPIEGDTGFD 194


>gi|163735681|ref|ZP_02143112.1| 27kDa outer membrane protein [Roseobacter litoralis Och 149]
 gi|161391109|gb|EDQ15447.1| 27kDa outer membrane protein [Roseobacter litoralis Och 149]
          Length = 242

 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 45/173 (26%), Gaps = 11/173 (6%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
                 +G  D  VT+VE+    C +C          L++                    
Sbjct: 77  DPNAPVLGNPDGDVTVVEFFDYNCPYCRRVKPHIEALLDEDPNVRLV-----YREWPILG 131

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                        R  G Y  F   L   Q           +++ +A+  G         
Sbjct: 132 DGSVFAARAALAAREQGKYEEFHWALMGMQGRAE-----EASVIQVAQEIGLDIAQLRRD 186

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMI 226
           +    I   I A  +  S     + TP F IG  L  G +      ++     
Sbjct: 187 MQAPEIDAHIAASMEM-SRALGFNGTPSFVIGDALVPGVIEADQMIRLAQEAR 238


>gi|254420341|ref|ZP_05034065.1| DSBA-like thioredoxin domain protein [Brevundimonas sp. BAL3]
 gi|196186518|gb|EDX81494.1| DSBA-like thioredoxin domain protein [Brevundimonas sp. BAL3]
          Length = 262

 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/202 (11%), Positives = 56/202 (27%), Gaps = 9/202 (4%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
                 +   +  + D      A         +D + G  DA VT++E+    C  C   
Sbjct: 68  ASLALQAKEGQARVDDTNTAAAANATLLAPDARDPAFGPADAKVTVIEFFDFRCPGCKAV 127

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
             +              +R++ +++P+                        ++ +     
Sbjct: 128 APQFRAL----MAAHPDVRFVFKDWPILDRGEDVASQYAARAALAAHQQGKYLEVYDALM 183

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
            +   +    D +L                      + DI      A+    +  TP FF
Sbjct: 184 SERALTPESTDRILAQHGVDMARAKQTLVAPETTRHIADIHT----AAAALKLQGTPTFF 239

Query: 204 IGGNLYLGDMSEGVFSKIIDSM 225
           + G      +     +++I++ 
Sbjct: 240 VNGKA-AASIDPAEIARMIEAA 260


>gi|83942248|ref|ZP_00954709.1| 27 kDa outer membrane protein, putative [Sulfitobacter sp. EE-36]
 gi|83846341|gb|EAP84217.1| 27 kDa outer membrane protein, putative [Sulfitobacter sp. EE-36]
          Length = 294

 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 22/183 (12%), Positives = 52/183 (28%), Gaps = 8/183 (4%)

Query: 44  FRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRY 103
                AA          G  +  +T+VE+    C +C +  ++  K +         ++ 
Sbjct: 119 VSDNAAAIFDDGYSYVGGNPEGDMTIVEFMDYRCGYCKKAFSEVEKLVNGDGNIRFIVKE 178

Query: 104 ILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFA 163
           +        V++   +  +                  +      N      +L  +A   
Sbjct: 179 LPILGEQSMVASRFAIATKIVAG-------DEAYKSVHDALMSFNGDITPTSLGRLASSF 231

Query: 164 GFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIID 223
                     ++   +  +I+  +  A +   I  TP F +   L  G +       I++
Sbjct: 232 DLDAEAIQEKMDSAEVTAEIEKTRALA-QTLQISGTPTFVMQDELLRGYLPYDQMKAILE 290

Query: 224 SMI 226
              
Sbjct: 291 EKR 293


>gi|145589563|ref|YP_001156160.1| DSBA oxidoreductase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047969|gb|ABP34596.1| DSBA oxidoreductase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 276

 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 74/212 (34%), Gaps = 11/212 (5%)

Query: 29  GSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTF 88
            +A  +    +      A  A +     D   G+ DA ++++EY+   C  C +F +   
Sbjct: 66  NAAQAKQQKEEAQKVAMAKNARAVDVKNDFIYGKPDAVISIIEYSDFECPFCKQFGDIPN 125

Query: 89  KYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFV----SLLFNKQD 144
           K ++    +   +         D V+T   + A CA ++     +               
Sbjct: 126 KVVDSMPDQVNLVWRNFPLSFHDPVATKEAIAAACAAQQGGNNAFWKYAQGIFKNTRSNA 185

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF- 203
             + S N  D LL +AK  G   + F TC+  + +   + A  +       I  TP    
Sbjct: 186 QGMPSVNGVDPLLALAKEQGLDTDKFSTCMQSEAVAKQVSADLEDGMNA-GISGTPGVIL 244

Query: 204 IGGN-----LYLGDMSEGVFSKIIDSMIQDST 230
           +        +  G + E V  + + +++    
Sbjct: 245 VNHKTGAFNVLAGAVPEDVLKQEVKNLLNAKK 276


>gi|254463938|ref|ZP_05077349.1| dsba oxidoreductase [Rhodobacterales bacterium Y4I]
 gi|206684846|gb|EDZ45328.1| dsba oxidoreductase [Rhodobacterales bacterium Y4I]
          Length = 254

 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 60/201 (29%), Gaps = 8/201 (3%)

Query: 30  SALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFK 89
               +       V     L    +       G  D  +T+VE+    C +C     +  K
Sbjct: 62  ERQQQAEAARDDVLVADNLEELQNDGYSWVGGNPDGDITLVEFMDYRCGYCRRAAPEVEK 121

Query: 90  YLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINS 149
            LE        ++          +S+   +  +                  +        
Sbjct: 122 LLESDGNIRLVIKEFPILGEASVLSSRFAVATKQVAGDD-------AYKQVHDALIAFGG 174

Query: 150 KNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLY 209
           +    AL  +A+      +     ++ + +  +++  ++ A +  AI  TP F +G  L 
Sbjct: 175 EPNEVALRRLAEGLSLDADPIFARMDSEEVTAELRQTRELA-QKMAISGTPTFVLGTELL 233

Query: 210 LGDMSEGVFSKIIDSMIQDST 230
            G +       ++  + +  +
Sbjct: 234 RGYLPADQMEIMVAEIREKQS 254


>gi|85716164|ref|ZP_01047139.1| DSBA oxidoreductase [Nitrobacter sp. Nb-311A]
 gi|85696997|gb|EAQ34880.1| DSBA oxidoreductase [Nitrobacter sp. Nb-311A]
          Length = 255

 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 73/200 (36%), Gaps = 7/200 (3%)

Query: 24  FYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEF 83
             T                       +  ++ + V++G K+  VT VE+    C +C   
Sbjct: 54  VSTELSKRQATAEALKHETAVTENANSIFNSPRGVTLGNKNGDVTFVEFFDYNCGYCKRA 113

Query: 84  HNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQ 143
                + L+       KL+ +L+EFP+   S+V       A +  D     ++   F+++
Sbjct: 114 MADMLELLKSD----HKLKVVLKEFPVLGQSSVEAAQVAVAARMQDPTGKKYLD--FHQK 167

Query: 144 DDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFF 203
                 +  R   L  AK AGF        +    +   ++   K A E   ++ TP + 
Sbjct: 168 LLGGRGQADRARALAAAKEAGFDIAKIQKDMTSPEVRATLEENFKLA-ESMGMNGTPSYV 226

Query: 204 IGGNLYLGDMSEGVFSKIID 223
           IG  + +G +      + I+
Sbjct: 227 IGKQVVVGAVGLETLKEKIN 246


>gi|226349525|ref|YP_002776639.1| hypothetical protein ROP_pROB01-02880 [Rhodococcus opacus B4]
 gi|226245440|dbj|BAH55787.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 227

 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 71/211 (33%), Gaps = 9/211 (4%)

Query: 19  IASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCF 78
           I    +  R GS           VD  A+L  +   +        D  V +VE+    C 
Sbjct: 25  IGMLLYVNRSGSGSAASGAAGRTVDPAAVLRENTHLLTS----SPDRKVVLVEFLDFECE 80

Query: 79  HCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSL 138
            C   +    +    +   +G++   +R FP+ S +   +           G +      
Sbjct: 81  SCLAMYPTMERI---RAEYSGRITVGVRYFPIPSHTNSNLAARVVEAASRQGKFEAMYQR 137

Query: 139 LFNKQDDWINSKNYRDAL-LNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAID 197
           ++  Q  W  S   ++ L  + A+  G     FD+ L +  + + +        E   + 
Sbjct: 138 MYETQTQWGESGRSQEPLFRSFAQDLGLDMGRFDSDLGNPALAERVDQDFNEGIE-LGVQ 196

Query: 198 STPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
            TP  F+GG       S       ID+ + +
Sbjct: 197 GTPTLFLGGTALPPMPSYEDLRARIDAALAE 227


>gi|302062395|ref|ZP_07253936.1| hypothetical protein PsyrptK_20596 [Pseudomonas syringae pv. tomato
           K40]
          Length = 232

 Score = 82.4 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 64/234 (27%), Gaps = 14/234 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TR  +L GI    +A   F   +    N L +  G ++                 G
Sbjct: 1   MKRPTRRQILYGIGAAALALTPFLLAELRQ-NTLGVSGGPLEQAVDQQKQ---SGGWVYG 56

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
            + A  T+VEYA + C +C ++  +   +      +   +       PL      A   A
Sbjct: 57  SRSARFTIVEYADLECPYCKDYFPQLKAW----VDQHPDVNLQWHHLPLPMHEPAASYEA 112

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
           R AE            L          S                 ++  D C +    + 
Sbjct: 113 RWAECAGIERGNDAFWLAVELIYQRTRSNGAGATGNPQIPGLEDRQHYIDNCASSNPAVR 172

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIIDSMIQDS 229
                +   +    I +TP   I            G     V    ID +   S
Sbjct: 173 KAVVSQAHKASIGGITATPTLVIKDKHSGRTIKLQGAPDGDVLLSAIDWLAAGS 226


>gi|114799585|ref|YP_761377.1| outer membrane protein [Hyphomonas neptunium ATCC 15444]
 gi|114739759|gb|ABI77884.1| outer membrane protein [Hyphomonas neptunium ATCC 15444]
          Length = 246

 Score = 82.0 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 58/193 (30%), Gaps = 9/193 (4%)

Query: 35  LPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDK 94
                          A  +   D  +G +DA VT+VE+    C +C      T    E  
Sbjct: 62  AQASATQAAIADSKDALYNDSNDYFVGPEDAAVTVVEFFDYRCGYCKRSAEWTANLPETY 121

Query: 95  YIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRD 154
             +   +      F   S +     LA   + +       ++ +         N +    
Sbjct: 122 DGQVRVVFKEYPIFGDISETAALAALASGRQGK-------YIDMHLALMALKSNDELTEQ 174

Query: 155 ALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMS 214
            +  +A   G         +   ++ + + A  +       +  TP +F+G     G  +
Sbjct: 175 KIDELAMQLGIDVQRMRADMKSDSVKNQL-ADMQALGRTLNVGGTPGYFVGDQAIEGA-N 232

Query: 215 EGVFSKIIDSMIQ 227
                ++I + I 
Sbjct: 233 LPKIDEVIRAEIA 245


>gi|115375621|ref|ZP_01462878.1| dsba oxidoreductase [Stigmatella aurantiaca DW4/3-1]
 gi|310823177|ref|YP_003955535.1| thioredoxin domain-containing protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|115367397|gb|EAU66375.1| dsba oxidoreductase [Stigmatella aurantiaca DW4/3-1]
 gi|309396249|gb|ADO73708.1| Thioredoxin domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 327

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 55/175 (31%), Gaps = 11/175 (6%)

Query: 55  MKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVS 114
              +  G  +APVT+ E+A   C  C        +          K+R     FPL S  
Sbjct: 151 DPRMCKGDANAPVTVAEFADFECPSCGHASPLLKE---FAKKGGDKMRLCFLPFPLPSHP 207

Query: 115 TVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCL 174
                       R  G +W     LF +Q +   +         +A   G S       L
Sbjct: 208 NALPAAQAALWARDQGKFWEMHDALFGQQQNLAPAAL-----PALADKIGLSGAKLQEVL 262

Query: 175 NDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGD--MSEGVFSKIIDSMIQ 227
                  +++  + +      I  TP  F  G  Y G   +   + +  ++  ++
Sbjct: 263 KAGTYAKEVETFRNQG-RAANISGTPSVFFNGRPYPGALTLDPELLAHSLEDELE 316


>gi|219849651|ref|YP_002464084.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
 gi|219543910|gb|ACL25648.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
          Length = 232

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 81/228 (35%), Gaps = 17/228 (7%)

Query: 14  IVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASP-------------STMKDVSI 60
           + LL + +    T    A   LP P           + P             +      +
Sbjct: 9   LSLLILTACTGQTATVPATPTLPPPGAPTSTPVTAQSDPIVTAYYPDLPRGRTPEGYHYL 68

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPVT++ Y+   C  CA +       + + ++ TGK R + R        +  +  
Sbjct: 69  GNPDAPVTIMVYSDFLCTTCAIYTLDLEPQVIEAFVVTGKARLVYRHLLQLGERSQLLAE 128

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
                    G +W     L+ + +    +   R+  +++A+  G   + F  CL+     
Sbjct: 129 -ASECAADHGKFWEMRHELYARYNQLYFNT--RETTIDLAQGLGIPADAFSACLDAHTYR 185

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQD 228
             ++A    A+    + + PVF IG    +G       +++I+   Q 
Sbjct: 186 AQVEADY-SAATAEGVFARPVFRIGNETLVGMPRFEALAQVIERAAQR 232


>gi|239782029|pdb|3GYK|A Chain A, The Crystal Structure Of A Thioredoxin-Like Oxidoreductase
           From Silicibacter Pomeroyi Dss-3
 gi|239782030|pdb|3GYK|B Chain B, The Crystal Structure Of A Thioredoxin-Like Oxidoreductase
           From Silicibacter Pomeroyi Dss-3
 gi|239782031|pdb|3GYK|C Chain C, The Crystal Structure Of A Thioredoxin-Like Oxidoreductase
           From Silicibacter Pomeroyi Dss-3
 gi|239782032|pdb|3GYK|D Chain D, The Crystal Structure Of A Thioredoxin-Like Oxidoreductase
           From Silicibacter Pomeroyi Dss-3
          Length = 175

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 49/176 (27%), Gaps = 11/176 (6%)

Query: 54  TMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV 113
                 +G  +  VT+VE+    C +C     +    ++        +          S 
Sbjct: 11  DPNAPVLGNPEGDVTVVEFFDYNCPYCRRAXAEVQGLVDADPNVR-LVYREWPILGEGSD 69

Query: 114 STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTC 173
                 LA   + + +  +W              + K     +L +A+  G         
Sbjct: 70  FAARAALAARQQGKYEAFHWAL---------XGXSGKANETGVLRIAREVGLDTEQLQRD 120

Query: 174 LNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDS 229
                +   I      A +    + TP F +   L  G + +      +D   + +
Sbjct: 121 XEAPEVTAHIAQSXALA-QKLGFNGTPSFVVEDALVPGFVEQSQLQDAVDRARKAA 175


>gi|145595906|ref|YP_001160203.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
 gi|145305243|gb|ABP55825.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
          Length = 182

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 51/173 (29%), Gaps = 8/173 (4%)

Query: 41  VVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
                     SP T  D   G  DAPVT+VEYA   C  C   +    + L  +      
Sbjct: 3   TPHQVTPRLRSPVTESDHVRGPVDAPVTLVEYADFQCQFCGVAYANLAELLRQRTDTVRL 62

Query: 101 LRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMA 160
           +         +                  G +W     L+  QD           L    
Sbjct: 63  VYRHFPIS--NVHPYAESAAHATEAAGARGRFWEMHDWLYEHQDQLDPV-----HLSLGV 115

Query: 161 KFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDM 213
              G + ++ D   + Q   D ++           +++TP  F+ G  + G  
Sbjct: 116 GQLGLAADEIDAETDQQAHGDRVRRDFVGGI-RSGVEATPTLFVNGARHNGGY 167


>gi|170783127|ref|YP_001711461.1| hypothetical protein CMS_2828 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169157697|emb|CAQ02899.1| putative membrane protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 282

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 70/210 (33%), Gaps = 6/210 (2%)

Query: 5   TTRIGVLGGIVLLFIA-SYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVS---I 60
            T+  V GG+V++  A +   Y    S       P                  + +   +
Sbjct: 49  ITQFSVAGGLVIVIAAIAGGVYLLGQSQAASAAGPVQDTTAALSTGDQVRIATEPTGVSV 108

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           G  DAPVTM  +   +C HCA++  +T   L D+   TG++R +     + +   V    
Sbjct: 109 GAADAPVTMDVFEDYSCPHCAQYEAETGPLL-DRIAATGQVRIVYHPIQIVTKYGVVAGS 167

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           A       +   W  V          I         +      G + +   TC+ +    
Sbjct: 168 AAACVLAEEPDKWPAVHSALFDNHSTITDSWTHADFVTWLTTQGVTADAARTCVAEGRYS 227

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
             I +    A+    +  TP   I G++  
Sbjct: 228 SWITSNTSDATSA-GVTGTPTLRIQGDIVT 256


>gi|315654544|ref|ZP_07907450.1| hcca isomerase [Mobiluncus curtisii ATCC 51333]
 gi|315491008|gb|EFU80627.1| hcca isomerase [Mobiluncus curtisii ATCC 51333]
          Length = 284

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/266 (12%), Positives = 72/266 (27%), Gaps = 45/266 (16%)

Query: 4   STTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAA------------- 50
           +   + ++G + +L + +  F+  + +A             +   A              
Sbjct: 14  NVWALKIIGVLAVLVLLAIAFFLGRTTAPGANAPAASPSSPQKTTAGGATAGDAQKAVAD 73

Query: 51  ------------------------------SPSTMKDVSIGQKDAPVTMVEYASMTCFHC 80
                                           +   + ++G+ DAPVT+   +  +C  C
Sbjct: 74  FVAQTGLVPGQDFASSVTNEGGLKAMKILRDGADEPERTLGKPDAPVTLTVLSDFSCPMC 133

Query: 81  AEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLF 140
             + N T   L+                         +           G  W FV   +
Sbjct: 134 TSWGNDTLPKLQKYVDDGTLKIQWHNMVIFADQYQSDIAAKASIAAMKQGKLWDFVRAAY 193

Query: 141 NKQDDWINSKNYRDALLNMAKFAGFSK-NDFDTCLNDQNILDDIKAGKKRASEDFAIDST 199
           +   +  +     + ++ +A+  G +    F T +N       +            ++ T
Sbjct: 194 HTAPEGEHPTYDENKVIQIAQSIGITDLGRFKTDMNSPETQATVSEETDSGHS-VGVNGT 252

Query: 200 PVFFIGGNLYLGDMSEGVFSKIIDSM 225
           P F +G +   G      F   I+  
Sbjct: 253 PFFVLGDSTISGAYPIEYFEHSIEYQ 278


>gi|27228673|ref|NP_758723.1| hypothetical protein pCAR1_p182 [Pseudomonas resinovorans]
 gi|219857097|ref|YP_002474129.1| outer membrane protein [Pseudomonas sp. CA10]
 gi|26106261|dbj|BAC41701.1| outer membrane protein [Pseudomonas resinovorans]
 gi|219689025|dbj|BAH10116.1| outer membrane protein [Pseudomonas putida]
          Length = 219

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/184 (13%), Positives = 47/184 (25%), Gaps = 7/184 (3%)

Query: 25  YTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFH 84
                 A                             G   APVT+VE+   +C  C  FH
Sbjct: 28  SQSPQQAQAPGSTAQETGTQPKQNGGQLVRFHSPVFGPAQAPVTIVEFFDPSCEACRAFH 87

Query: 85  NKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQD 144
               + L +       +   +         +           R    +   +  +   Q 
Sbjct: 88  PYVKQILAENPEDVRLVLRYVLFHQGSEEVSR-----MLEAARKQNLHEKVLEAVLEAQP 142

Query: 145 DWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI 204
            W +           A+  G +       ++  ++   ++   +   +   I  TP FF+
Sbjct: 143 GW-HDDPKVTQAWAAAERVGLNLEQARQDMHTPSVNAVLETDMQD-VKAVGIRGTPTFFV 200

Query: 205 GGNL 208
            G  
Sbjct: 201 NGKP 204


>gi|330828226|ref|YP_004391178.1| secreted protein, suppressor for copper-sensitivity C [Aeromonas
           veronii B565]
 gi|328803362|gb|AEB48561.1| Secreted protein, suppressor for copper-sensitivity C [Aeromonas
           veronii B565]
          Length = 247

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 22/198 (11%), Positives = 53/198 (26%), Gaps = 13/198 (6%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                         +       ++     +G K+  +T+V +    C +C +F  +  K 
Sbjct: 61  QNAAAQEAQLGNFIKGNKDVLFNSATSPRLGAKNPKLTLVLFTDYNCPYCKQFDPQLTKL 120

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
                     L  +++  P    ++           + D   +  +      +   +   
Sbjct: 121 ---LKAYPDDLGLVIKLLPFKGQTSAKAAQYSLTLWQQDPARFLTLHDKLMSKQGMLTEA 177

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
           +   AL      A          L +   +  I            +  TP   IG  L  
Sbjct: 178 DINKALAATGNTALKPAAKATEELRNSLRIGTI----------LGVQGTPATLIGNQLVP 227

Query: 211 GDMSEGVFSKIIDSMIQD 228
           G +      +++ + +  
Sbjct: 228 GAIPYEELEQLVKAELAK 245


>gi|86159539|ref|YP_466324.1| Na+/H+ antiporter NhaA [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123763870|sp|Q2IE76|NHAA_ANADE RecName: Full=Na(+)/H(+) antiporter nhaA; AltName:
           Full=Sodium/proton antiporter nhaA
 gi|85776050|gb|ABC82887.1| sodium/proton antiporter, NhaA family [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 644

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 51/184 (27%), Gaps = 10/184 (5%)

Query: 39  DGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT 98
            G       L       +D  +G+  A +T+VEY S  C HC   H    +  +    + 
Sbjct: 19  SGPGPLPVRLDPPVDPARDHVLGEPGADLTLVEYGSYACPHCHVAHEVVAELRDRLGDRL 78

Query: 99  GKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLN 158
             +          +     +  A   +               +              L  
Sbjct: 79  RYVFRQRPIRAEAARPAAELAEAAGLDGE--------RFWHAHDLLMRRGPSFAAGELDA 130

Query: 159 MAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF 218
           +A+  G    +      +      ++   + A     +  TP FFI G  Y G       
Sbjct: 131 IARELGLPPRERGAGPWEGA-AARVREDVESA-RRSGVHLTPTFFINGRRYEGPWDAAAL 188

Query: 219 SKII 222
           S+ +
Sbjct: 189 SEAL 192


>gi|28868078|ref|NP_790697.1| hypothetical protein PSPTO_0857 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28851314|gb|AAO54392.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 234

 Score = 82.0 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 61/228 (26%), Gaps = 12/228 (5%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TR  +L GI  + +A   F       + +        D  +  +           G
Sbjct: 1   MKRPTRRQILYGIGAVALAILAF--ECLPDVRQGMQMLNTADSISQTSKQTKHNGAWVYG 58

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
              A  T+VEYA + C +C ++  +   +++        +       PL      A   A
Sbjct: 59  SSSARFTIVEYADLECPYCKDYFPQLKAWVDQHP----DVNLQWHHLPLPMHEPAASYEA 114

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
           R AE            L          S     A           ++  D C +      
Sbjct: 115 RWAECAGIERGNDVFWLAVELIYQRTRSNGAGTAGNPQIPGLEDRQHFIDNCASSNPAAR 174

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIID 223
                +   +    I +TP   I            G     V    ID
Sbjct: 175 QAVVSQAHKASLGGITATPTLVIKDKHSGRTIKLQGAPDGNVLLSAID 222


>gi|320326178|gb|EFW82233.1| DSBA oxidoreductase [Pseudomonas syringae pv. glycinea str. B076]
          Length = 228

 Score = 82.0 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 71/230 (30%), Gaps = 14/230 (6%)

Query: 2   VMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIG 61
           +   TR  +L GI    +A   F   +                 +    S         G
Sbjct: 1   MKRPTRRQILYGIGAAALALTPFLLTELRQNTLGVTGGTQASAESQQRPS----GGWIYG 56

Query: 62  QKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLA 121
            + A  T+VEYA + C +C ++  +   +++       +  ++       + S  A    
Sbjct: 57  SRGARFTIVEYADLECPYCKDYFPQLKAWVDQHPDVNLQWHHLPLPMHEPTASYEARWAE 116

Query: 122 RCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILD 181
               +R +  +W  V L++ +             +  +           +   ++  +  
Sbjct: 117 CAGIERGNDAFWLAVELIYQRTRSNGAGTAGNPQIPGLEDRQHSID---NCASSNPAVRQ 173

Query: 182 DIKAGKKRASEDFAIDSTPVFFIGGN------LYLGDMSEGVFSKIIDSM 225
            + +   +AS+D  I +TP   I            G     V    ID +
Sbjct: 174 TVVSQAHKASQD-GITATPTLVIKDKVSGRSIKLQGAPDGNVLLSAIDWL 222


>gi|260575215|ref|ZP_05843215.1| DSBA oxidoreductase [Rhodobacter sp. SW2]
 gi|259022475|gb|EEW25771.1| DSBA oxidoreductase [Rhodobacter sp. SW2]
          Length = 246

 Score = 82.0 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/197 (11%), Positives = 53/197 (26%), Gaps = 8/197 (4%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKY 90
                   + +                   G  D  +T+VE+    C +C + +++  + 
Sbjct: 57  RQQTAEAANDLTLVATNADDIFKDANSWVGGNPDGNITIVEFTDYRCGYCRKAYDEVEEL 116

Query: 91  LEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSK 150
           ++        ++          +S+   +  R                  +     +   
Sbjct: 117 VKSDGNIRFVVKEFPILGEQSVLSSRFAIAVRQLNGDD-------AYKRAHDALISLRGD 169

Query: 151 NYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL 210
              + L  +A   GF        ++   +   I A      +   I  TP F I   L  
Sbjct: 170 ATPETLTRLAADLGFDAAAVMAKMDAPEVTAVIDANHGLG-DRLQISGTPTFVIDQTLVR 228

Query: 211 GDMSEGVFSKIIDSMIQ 227
           G +       I++   +
Sbjct: 229 GYVPLEGMRSIVEDQRK 245


>gi|148255086|ref|YP_001239671.1| putative disulfide bond formation protein D [Bradyrhizobium sp.
           BTAi1]
 gi|146407259|gb|ABQ35765.1| putative disulfide bond formation protein D precursor (Disulfide
           oxidoreductase D) [Bradyrhizobium sp. BTAi1]
          Length = 211

 Score = 82.0 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 34/218 (15%), Positives = 64/218 (29%), Gaps = 18/218 (8%)

Query: 3   MSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQ 62
           M+ TR      IVLL  A+      +    +   + +  +   A + A+         G 
Sbjct: 1   MTRTRSRSSFAIVLLLTAAMLPLQARAEDADTDILSEARILHDAAIPAA---------GN 51

Query: 63  KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLAR 122
            D  +T+VEY    C +C +      K + +       +R + +++P+    ++      
Sbjct: 52  ADGDITIVEYFDYQCPYCRKISPDLAKVVREDGH----VRLVFKDWPIFGGVSIYAARLT 107

Query: 123 CAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDD 182
                       F                 +      A     ++   D       I D 
Sbjct: 108 L----ASRYQDKFAEAHEALISLKEKLSEAKVDAALSAAGIDLARAKADLAAKRTEI-DA 162

Query: 183 IKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSK 220
           + A     +       TP F IG     G  +   F +
Sbjct: 163 VLARNHEQATGLGFQGTPAFIIGHFRVPGAPNAQAFKQ 200


>gi|56459322|ref|YP_154603.1| protein-disulfide isomerase [Idiomarina loihiensis L2TR]
 gi|56178332|gb|AAV81054.1| Protein-disulfide isomerase [Idiomarina loihiensis L2TR]
          Length = 243

 Score = 82.0 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 47/186 (25%), Gaps = 9/186 (4%)

Query: 36  PIPDGVVDFRALLAASPSTMKDVSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKY 95
              +    F         +     +G +DAP  ++ +    C  C +      K +E+  
Sbjct: 59  QQSEQKNAFANHQEWLYQSAAHPILGDQDAPHKIIVFTDYNCPFCKKLEPGLHKLIEEYP 118

Query: 96  IKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDA 155
                  ++               L      R D   +     L  K+     + + +  
Sbjct: 119 SIQVVNIFVPLRQQQVDGLKTNSALYGLNLWRNDPKAFFEAHNLMMKKSGMHTADSLQSV 178

Query: 156 LLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSE 215
               +  A  S              + +      A  D     TP   IG  +  G +  
Sbjct: 179 AQVTSTEAFLSP---------SGESEAVIRKNMSAFRDLGFRGTPTIIIGQQVMPGYIPY 229

Query: 216 GVFSKI 221
               +I
Sbjct: 230 DKLEEI 235


>gi|148271787|ref|YP_001221348.1| hypothetical protein CMM_0608 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147829717|emb|CAN00634.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 268

 Score = 82.0 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 66/202 (32%), Gaps = 2/202 (0%)

Query: 9   GVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVT 68
           G++  I  +    Y     + ++                     +    VS+G  DAPVT
Sbjct: 43  GLVIVIAAIAGGVYLLGQSQAASAAGPVQDTTAALSTGDQVRIATEPTGVSVGAADAPVT 102

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRM 128
           M  Y   +C HCA++  +T   L D+   TG++R +