RPSBLAST alignment for GI: 254780477 and conserved domain: cd02972

>gnl|CDD|73335 cd02972, DsbA_family, DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins. Members of this family contain a redox active CXXC motif (except GSTK and HCCA isomerase) imbedded in a TRX fold, and an alpha helical insert of about 75 residues (shorter in DsbC and DsbG) relative to TRX. DsbA is involved in the oxidative protein folding pathway in prokaryotes, catalyzing disulfide bond formation of proteins secreted into the bacterial periplasm. DsbC and DsbG function as protein disulfide isomerases and chaperones to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins.. Length = 98
 Score = 39.7 bits (92), Expect = 6e-04
 Identities = 20/80 (25%), Positives = 29/80 (36%), Gaps = 9/80 (11%)

Query: 69  MVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSV----STVAVMLARCA 124
           +VE+    C +C  F  +  K L   Y   G +R + R FPL       S  A   A  A
Sbjct: 1   IVEFFDPLCPYCYLFEPELEKLL---YADDGGVRVVYRPFPLLGGMPPNSLAAARAALAA 57

Query: 125 EKRMDGGYWGFVSLLFNKQD 144
             +  G +      L +   
Sbjct: 58  AAQ--GKFEALHEALADTAL 75