RPSBLAST alignment of GI: 254780477 and protein with PDBid: 3feu

>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio fischeri ES114} Length = 185
 Score = 77.8 bits (190), Expect = 2e-15
 Identities = 23/174 (13%), Positives = 48/174 (27%), Gaps = 10/174 (5%)

Query: 59  SIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAV 118
           +  + D    + E  +++C HC    N      ++     GK+     +    +      
Sbjct: 16  TSLENDGMAPVTEVFALSCGHCRNMENFLPVISQEAGTDIGKMHITFNQSAHIASMFYYA 75

Query: 119 MLARCAEKRMDGGYWGFVSLLFNKQDDWINSK--NYRDALLNMAKFAGFSKNDFDTCLND 176
              +            F+  LF        +     ++A        G            
Sbjct: 76  AEMQVDGAP----DHAFMEDLFAATQMGEGTTLTEQQEAYSKAFTSRGLVSPYDFNEEQR 131

Query: 177 QNILDDIKAGKKRASEDFAIDSTPVFFIGGNLYL---GDMSEGVFSKIIDSMIQ 227
             ++  +    K  SE   I S P F + G   +   G       +  I  +++
Sbjct: 132 DTLIKKVDNA-KMLSEKSGISSVPTFVVNGKYNVLIGGHDDPKQIADTIRYLLE 184