BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780477|ref|YP_003064890.1| DSBA oxidoreductase
[Candidatus Liberibacter asiaticus str. psy62]
         (232 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780477|ref|YP_003064890.1| DSBA oxidoreductase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 232

 Score =  479 bits (1234), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/232 (100%), Positives = 232/232 (100%)

Query: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60
           MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI
Sbjct: 1   MVMSTTRIGVLGGIVLLFIASYFFYTRKGSALNELPIPDGVVDFRALLAASPSTMKDVSI 60

Query: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120
           GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML
Sbjct: 61  GQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVML 120

Query: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180
           ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL
Sbjct: 121 ARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNIL 180

Query: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232
           DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR
Sbjct: 181 DDIKAGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVFSKIIDSMIQDSTRR 232


>gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 702

 Score = 25.8 bits (55), Expect = 0.71,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 31  ALNELPIPDGVVDFRALLAASPSTMKDVSIGQKDAPVT-MVEYASMTCFHCAEFHNKTFK 89
           A+NE P   G  D  AL  A+   ++ +   + D P++  +E  ++  F    FH++   
Sbjct: 491 AINEKP--SGSKDPYALRRATLGIIRIILENKIDIPLSQFIEDQNLILF----FHDRLKL 544

Query: 90  YLEDKYIKTGKLRYILR 106
           YL D+ I+   +  ILR
Sbjct: 545 YLHDRDIRHDLIEAILR 561


>gi|254781111|ref|YP_003065524.1| geranyltranstransferase protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 237

 Score = 24.3 bits (51), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 8/28 (28%), Positives = 15/28 (53%)

Query: 73  ASMTCFHCAEFHNKTFKYLEDKYIKTGK 100
           A++ C HC    +     +++ YI+ GK
Sbjct: 77  AAIECIHCYSLIHDDLPSMDNGYIRRGK 104


>gi|254780368|ref|YP_003064781.1| electron transfer flavoprotein beta subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 249

 Score = 23.1 bits (48), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 4/22 (18%)

Query: 183 IKAGKKRASE----DFAIDSTP 200
           IKA KKR  +    DFAID TP
Sbjct: 192 IKARKKRIEKKKATDFAIDLTP 213


>gi|254780168|ref|YP_003064581.1| monooxygenase FAD-binding protein [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 380

 Score = 22.7 bits (47), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 7  RIGVLGGIVLLFIASYFFYTRKGSALNEL 35
          RIG+L  +  ++I    F  R GS L EL
Sbjct: 51 RIGILDQLEDIWIEPEDFVFRSGSTLKEL 79


>gi|254780928|ref|YP_003065341.1| histidyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 496

 Score = 22.7 bits (47), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 8/21 (38%), Positives = 13/21 (61%)

Query: 163 AGFSKNDFDTCLNDQNILDDI 183
            G  +ND+   +N++ ILD I
Sbjct: 158 VGIKRNDYHIGINNRKILDGI 178


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.323    0.138    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 146,271
Number of Sequences: 1233
Number of extensions: 5864
Number of successful extensions: 20
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 10
length of query: 232
length of database: 328,796
effective HSP length: 71
effective length of query: 161
effective length of database: 241,253
effective search space: 38841733
effective search space used: 38841733
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 37 (18.9 bits)