RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780478|ref|YP_003064891.1| hypothetical protein CLIBASIA_01815 [Candidatus Liberibacter asiaticus str. psy62] (161 letters) >1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} (A:84-221) Length = 138 Score = 24.5 bits (52), Expect = 8.1 Identities = 11/86 (12%), Positives = 25/86 (29%), Gaps = 1/86 (1%) Query: 2 IHFSQVIDDLLDPFLRRRAGI-SMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDI 60 + FS++ + D + V ++ + Sbjct: 47 LTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKD 106 Query: 61 SSDVSGTLIIACEGSHALFLMHDQSK 86 ++ + L+ A E H+L L H + Sbjct: 107 TTGTNLFLVAAHEIGHSLGLFHSANT 132 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.326 0.139 0.418 Gapped Lambda K H 0.267 0.0775 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,228,237 Number of extensions: 50337 Number of successful extensions: 149 Number of sequences better than 10.0: 1 Number of HSP's gapped: 149 Number of HSP's successfully gapped: 3 Length of query: 161 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 79 Effective length of database: 2,184,039 Effective search space: 172539081 Effective search space used: 172539081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.3 bits)