>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway. Isoprenoids comprise a large family of natural products including sterols, carotenoids, dolichols and prenylated proteins. These compounds are synthesized from two precursors: isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). IPP isomerase catalyzes the interconversion of IPP and DMAPP by a stereoselective antarafacial transposition of hydrogen. The enzyme requires one Mn2+ or Mg2+ ion in its active site to fold into an active conformation and also contains the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. The metal binding site is present within the active site and plays structural and catalytical roles. IPP isomerase is well represented in several bacteria, archaebacteria and eukaryotes, including fungi, mamm

Probab=96.17 E-value=0.062 Score=34.10 Aligned_cols=101 Identities=11% Similarity=0.024 Sum_probs=50.8 Q ss_pred CCEEEEEEEEEECCCEEEEEECCCC-HHHHCCCCCCCCC-CCCCCCHHH------HHHCCCCCCCC-EECCCEEE--EEE Q ss_conf 2112320003413760577645720-1320474421111-346721588------86301010000-21373589--983 Q gi|254780479|r 236 PMRTGAVFIAITNDNRILLRKRTNT-RLLEGMDELPGSA-WSSTKDGNI------DTHSAPFTANW-ILCNTITH--TFT 304 (356) Q Consensus 236 ~~r~~~~~vii~~~~kiLL~KRp~~-gll~GLwEFP~~e-~~~~~~~~~------~~~~~~~~~~~-~~l~~ikH--~fT 304 (356) T Consensus 29 ~Hrav~v~-v~n~~g~lllqkRs~~K~~~Pg~wd~s~~Gh~~~GE~~~~aa~Rel~EElGi~~~~~~~~~~~~~y~~~~~ 107 (165) T cd02885 29 LHRAFSVF-LFNSKGRLLLQRRALSKYTFPGLWTNTCCSHPLPGEGVKDAAQRRLREELGITGDLLELVLPRFRYRAPDD 107 (165) T ss_pred EEEEEEEE-EECCCCCEEEEEECCCCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCCC T ss_conf 48999999-99089979999857988689970735543467699758999999888861998543204666899932248 Q ss_pred EE---EEEEEEEEEECC-----CCCCCCCCEEECHHHHHHC Q ss_conf 15---999999999807-----7676678133227888747 Q gi|254780479|r 305 HF---TLTLFVWKTIVP-----QIVIIPDSTWHDAQNLANA 337 (356) Q Consensus 305 H~---~L~i~v~~~~~~-----~~~~~~~~~Wv~~~el~~~ 337 (356) T Consensus 108 ~~~~e~E~~~vy~~~~d~~~~~~~~EV~~~~w~~~~el~~~ 148 (165) T cd02885 108 GGLVEHEIDHVFFARADVTLIPNPDEVSEYRWVSLEDLKEL 148 (165) T ss_pred CCCCCEEEEEEEEEEECCCCCCCHHHHEEEEEECHHHHHHH T ss_conf 98742379999999658987699579238899789999999

HHsearch alignment for GI: 254780479 and conserved domain: cd02885