>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily. MTH1, the mammalian counterpart of MutT, hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP and 2-hydroxy-ATP, to monophosphates, thereby preventing the incorporation of such oxygen radicals during replication. This is an important step in the repair mechanism in genomic and mitochondrial DNA. Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for activity, and contain the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. MTH1 is predominantly localized in the cytoplasm and mitochondria. Structurally, this enzyme adopts a similar fold to MutT despite low sequence similarity outside the conserved nudix motif. The most distinctive structural difference between MutT and MTH1 is the presence of a beta-hairpin, which is absent in MutT. This results in a m

Probab=98.66 E-value=1.5e-07 Score=73.74 Aligned_cols=108 Identities=15% Similarity=0.055 Sum_probs=73.0 Q ss_pred EEEEEECCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCC------CEECCCEEEEE--EEEEEEEEEE Q ss_conf 000341376057764572013204744211113467215888630101000------02137358998--3159999999 Q gi|254780479|r 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTAN------WILCNTITHTF--THFTLTLFVW 313 (356) Q Consensus 242 ~~vii~~~~kiLL~KRp~~gll~GLwEFP~~e~~~~~~~~~~~~~~~~~~~------~~~l~~ikH~f--TH~~L~i~v~ 313 (356) T Consensus 4 tl~ii~~~~kiLl~~R~~~-~~~G~W~~PGGkvE~gEt~~~a~~REl~EEtGl~v~~~~~~g~~~~~~~~~~~~~~~~~f 82 (137) T cd03427 4 TLCFIKDPDKVLLLNRKKG-PGWGGWNGPGGKVEPGETPEECAIRELKEETGLTIDNLKLVGIIKFPFPGEEERYGVFVF 82 (137) T ss_pred EEEEEEECCEEEEEEECCC-CCCCEEECCEEECCCCCCHHHHHHHHHHHHHCEEEEEEEEEEEEEEEECCCCEEEEEEEE T ss_conf 9999998999999996999-999959795565679979999999999898692887138999999992799989999999 Q ss_pred EEECCCC-----CCCCCCEEECHHHHHHCCCCHHHHHHHHHC Q ss_conf 9980776-----766781332278887479987899999844 Q gi|254780479|r 314 KTIVPQI-----VIIPDSTWHDAQNLANAALPTVMKKALSAG 350 (356) Q Consensus 314 ~~~~~~~-----~~~~~~~Wv~~~el~~~~LPs~~kKIL~al 350 (356) T Consensus 83 ~~~~~~G~~~~~~~e~~l~Wv~~~el~~l~~~p~d~~~l~~l 124 (137) T cd03427 83 LATEFEGEPLKESEEGILDWFDIDDLPLLPMWPGDREWLPLM 124 (137) T ss_pred EEEEEEEEECCCCCCCEEEEEEHHHCCCCCCCCCHHHHHHHH T ss_conf 998352476798833368998498977589982368999999

HHsearch alignment for GI: 254780479 and conserved domain: cd03427