>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function. In general, members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability

Probab=97.94 E-value=0.00013 Score=52.99 Aligned_cols=104 Identities=14% Similarity=0.169 Sum_probs=63.4 Q ss_pred EEEEECCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCC------EECCCEEEEEE------EEEEEE Q ss_conf 003413760577645720132047442111134672158886301010000------21373589983------159999 Q gi|254780479|r 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW------ILCNTITHTFT------HFTLTL 310 (356) Q Consensus 243 ~vii~~~~kiLL~KRp~~gll~GLwEFP~~e~~~~~~~~~~~~~~~~~~~~------~~l~~ikH~fT------H~~L~i 310 (356) T Consensus 4 ~avi~~~~~vLL~rr~~~-~~~g~W~lPGG~ve~gEt~~~aa~REv~EETGl~v~~~~~l~~~~~~~~~~~~~~~~~~v~ 82 (128) T cd04684 4 YAVIPRDGKLLLIQKNGG-PYEGRWDLPGGGIEPGESPEEALHREVLEETGLTVEIGRRLGSASRYFYSPDGDYDAHHLC 82 (128) T ss_pred EEEEEECCEEEEEEECCC-CCCCEEECCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEEEEEEEEEEEECCCCCEEEEEEE T ss_conf 999993999999997789-9898298985607799899999999999872937886338899999997899977679999 Q ss_pred EEEEEECCCCC--------CCCCCEEECHHHHHHCCCCHHHHHHH Q ss_conf 99999807767--------66781332278887479987899999 Q gi|254780479|r 311 FVWKTIVPQIV--------IIPDSTWHDAQNLANAALPTVMKKAL 347 (356) Q Consensus 311 ~v~~~~~~~~~--------~~~~~~Wv~~~el~~~~LPs~~kKIL 347 (356) T Consensus 83 ~~f~~~~~~g~~~~~~~~ee~~e~~W~~~del~e~~~~P~~~~~v 127 (128) T cd04684 83 VFYDARVVGGALPVQEPGEDSHGAAWLPLDEAIERLLSPLVLWAV 127 (128) T ss_pred EEEEEEECCCCCCCCCCCCCEEEEEEECHHHHHCCCCCHHHHHHH T ss_conf 999999868940568999830599995889942312794787863

HHsearch alignment for GI: 254780479 and conserved domain: cd04684