RPSBLAST alignment of GI: 254780479 and protein with PDBid: 1mut

>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129
 Score = 41.2 bits (96), Expect = 4e-04
 Identities = 21/127 (16%), Positives = 36/127 (28%), Gaps = 26/127 (20%)

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTA--------- 291
           AV I    +N I + +R     +    E PG        G I+    P  A         
Sbjct: 7   AVGIIRNENNEIFITRRAADAHMANKLEFPG--------GKIEMGETPEQAVVRELQEEV 58

Query: 292 -----NWILCNTITHTFTHFTLTLFVWKTIVPQIVIIP----DSTWHDAQNLANAALPTV 342
                ++ L   + + F    +TL+ W     +            W     L     P  
Sbjct: 59  GITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPA 118

Query: 343 MKKALSA 349
            +  ++ 
Sbjct: 119 NEPVIAK 125