RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780480|ref|YP_003064893.1| 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus Liberibacter asiaticus str. psy62] (367 letters) >gnl|CDD|31061 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide transport and metabolism]. Length = 183 Score = 108 bits (272), Expect = 2e-24 Identities = 44/168 (26%), Positives = 67/168 (39%), Gaps = 22/168 (13%) Query: 198 SVDLK-GNEIGKKSIIGYRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNE 256 DL+ GNE ID D+ ++ D + L +G+FIL P E Sbjct: 33 GYDLRLGNEFR------VFRNEGAGVIDPDNPDEEDPLVEEEEL-----EDGEFILPPGE 81 Query: 257 FYIFASREFIQIPPSLVAEMIPYDHSIGEFRVHYAGFFDPGFGCVLPQEVGAKAVLEVRS 316 FY+ + E+++IP + A + + G DPGF G + V S Sbjct: 82 FYLAVTLEYVEIPEDVAAFCTGRSSLARLGLIVHVGVIDPGFE-------GRITLELVNS 134 Query: 317 S-VPFVLEHGQIIGRLKYESMDGEPERLYGEARGSHYQSQALKLSKHF 363 +P L G+ I +L + +D ER Y RG YQ Q ++ Sbjct: 135 GPLPIRLYPGERIAQLVFLELDSPAERPYSG-RGGKYQGQ-RGVTPSR 180 Score = 61.8 bits (150), Expect = 3e-10 Identities = 39/161 (24%), Positives = 71/161 (44%), Gaps = 10/161 (6%) Query: 5 VLPDKAIATLAERGDIVSE-HPLEKNQIQPASIDLRLSSKAYRVRASFLPNIDGLVSDKI 63 +L D+ I + E G ++ E ++ QIQPA DLRL ++ R ID D+ Sbjct: 2 ILSDRDIRKMVEEGRLLIEPFEDKEYQIQPAGYDLRLGNEFRVFRNEGAGVIDPDNPDEE 61 Query: 64 KHFKLREIDLSGGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFARVIGDRS 123 E G +L Y+ +E + + ++A+ +SS+ R+ + Sbjct: 62 DPLVEEEELEDGEFILPPGEFYLAVTLEYVEIPEDVAAFCTGRSSLARLGLIV------- 114 Query: 124 QEFDSISPNYSGPLYLEILPRT-FPIVVRVGSRLSQIRFVK 163 I P + G + LE++ PI + G R++Q+ F++ Sbjct: 115 -HVGVIDPGFEGRITLELVNSGPLPIRLYPGERIAQLVFLE 154 >gnl|CDD|143638 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases. Trimeric dUTP diphosphatases, or dUTPases, are the most common family of dUTPase, found in bacteria, eukaryotes, and archaea. They catalyze the hydrolysis of the dUTP-Mg complex (dUTP-Mg) into dUMP and pyrophosphate. This reaction is crucial for the preservation of chromosomal integrity as it removes dUTP and therefore reduces the cellular dUTP/dTTP ratio, and prevents dUTP from being incorporated into DNA. It also provides dUMP as the precursor for dTTP synthesis via the thymidylate synthase pathway. dUTPases are homotrimeric, except some monomeric viral dUTPases, which have been shown to mimic a trimer. Active sites are located at the subunit interface. Length = 92 Score = 54.0 bits (131), Expect = 6e-08 Identities = 23/88 (26%), Positives = 35/88 (39%), Gaps = 11/88 (12%) Query: 247 EGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDHSIG--EFRVHYAGFFDPGF-GCVLP 303 +L P E + + E I++P V + P S+ VH AG DPG+ G + Sbjct: 11 FEGIVLPPGETVLVPTGEAIELPEGYVGLVFPRS-SLARKGITVHNAGVIDPGYRGEI-- 67 Query: 304 QEVGAKAVLEVRSSVPFVLEHGQIIGRL 331 L P V++ G I +L Sbjct: 68 -----TLELYNLGPEPVVIKKGDRIAQL 90 Score = 49.4 bits (119), Expect = 1e-06 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 17/99 (17%) Query: 71 IDLS-----GGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGR--IDVFARVIGDRS 123 DL G VL +VP E++ L G P+SS+ R I V + D Sbjct: 3 YDLRLGEDFEGIVLPPGETVLVPTGEAIELPEGYVGLVFPRSSLARKGITVHNAGVID-- 60 Query: 124 QEFDSISPNYSGPLYLEILPRT-FPIVVRVGSRLSQIRF 161 P Y G + LE+ P+V++ G R++Q+ F Sbjct: 61 -------PGYRGEITLELYNLGPEPVVIKKGDRIAQLVF 92 >gnl|CDD|185736 cd08995, GH32_Aec43_like, Glycosyl hydrolase family 32. This glycosyl hydrolase family 32 (GH32) includes characterized as well as uncharacterized proteins. GH32 enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). GH32 family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. Length = 280 Score = 29.2 bits (66), Expect = 1.7 Identities = 8/33 (24%), Positives = 16/33 (48%) Query: 218 RHTAAIDVDSENKYDESDFWDPLFSWDAPEGQF 250 + I + Y+++D+ DP W+ EG + Sbjct: 104 KDPEFILIADGEGYEKNDWRDPFVFWNEEEGCY 136 >gnl|CDD|32635 COG2804, PulE, Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 500 Score = 28.4 bits (63), Expect = 3.1 Identities = 10/31 (32%), Positives = 14/31 (45%) Query: 27 EKNQIQPASIDLRLSSKAYRVRASFLPNIDG 57 E+ Q I L+L+ + R S LP G Sbjct: 190 ERRLPQDGRIRLKLNGRKVDFRVSTLPTFYG 220 >gnl|CDD|35731 KOG0511, KOG0511, KOG0511, Ankyrin repeat protein [General function prediction only]. Length = 516 Score = 28.1 bits (62), Expect = 3.7 Identities = 16/79 (20%), Positives = 28/79 (35%), Gaps = 11/79 (13%) Query: 14 LAERGDIVSEHPLEKNQIQPASIDLRLS--------SKAYRVRASFLPNIDGLVSDKIKH 65 L E G I S + ++ +++ R+ KA+ R +I + D Sbjct: 88 LLENGAICSRDTFDGDRCHYGALNDRIRRMLLSYDILKAFDARQPPAAHIQSSLRDTFLG 147 Query: 66 FKLREIDLSG--GTVLDAN 82 +ID G DA+ Sbjct: 148 CC-HDIDFLQQEGANFDAH 165 >gnl|CDD|144334 pfam00692, dUTPase, dUTPase. dUTPase hydrolyses dUTP to dUMP and pyrophosphate. Length = 129 Score = 28.0 bits (63), Expect = 4.8 Identities = 7/39 (17%), Positives = 12/39 (30%) Query: 77 TVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVF 115 L +VP + L G +SS+ + Sbjct: 24 FTLPPGGTVLVPTDIRIPLPPGTFGLILGRSSLAAKGLI 62 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0734 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,567,061 Number of extensions: 249218 Number of successful extensions: 472 Number of sequences better than 10.0: 1 Number of HSP's gapped: 468 Number of HSP's successfully gapped: 10 Length of query: 367 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 272 Effective length of database: 4,210,882 Effective search space: 1145359904 Effective search space used: 1145359904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 58 (26.1 bits)