RPSBLAST alignment of GI: 254780480 and MMDB domain: 1xs1_A_

>1xs1_A (A:) DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli}Length = 193
 Score = 80.0 bits (197), Expect = 4e-16
 Identities = 37/199 (18%), Positives = 61/199 (30%), Gaps = 15/199 (7%)

Query: 169 SQEELSALHELSPLVQDGLRDFSGKGVALSVDLK-GNEIGKKSIIGYRAKRHTAAIDVDS 227
              ++ A  +   L  +          A +VD++ GN+              +   D  S
Sbjct: 4   CDRDIEAWLDEGRLSINPRPPVERINGA-TVDVRLGNKFRTFRGHTAAFIDLSGPKDEVS 62

Query: 228 ENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPSLVAEMIPYDH--SIGE 285
                       L      E  F L P E  +  + E + +P  LV  +        +G 
Sbjct: 63  AALDRVMSDEIVLD---EGEA-FYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGL 118

Query: 286 FRVHYAGFFDPGFGCVLPQEVGAKAVLEVRSSVPFVLEHGQIIGRLKYESMDGEPERLYG 345
                A   DPG+   +               +P  L  G +IG L +E + G   R Y 
Sbjct: 119 MVHVTAHRIDPGWSGCI------VLEFYNSGKLPLALRPGMLIGALSFEPLSGPAVRPYN 172

Query: 346 EARGSHYQ-SQALKLSKHF 363
               + Y+  Q    S+  
Sbjct: 173 RREDAKYRNQQGAVASRID 191