HHsearch alignment for GI: 254780481 and conserved domain: KOG4612

>KOG4612 consensus.
Probab=99.72  E-value=1.5e-18  Score=105.72  Aligned_cols=42  Identities=50%  Similarity=0.829  Sum_probs=40.3

Q ss_pred             CCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             876787841012332355415977799999999700265229
Q gi|254780481|r    3 RTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA   44 (44)
Q Consensus         3 rTyQPs~~kRkr~HGF~~Rm~T~~GRkvL~rRr~KGR~~Lsa   44 (44)
T Consensus        64 NeYQPSn~KRKrkhGfl~R~~s~~G~~vl~rR~lKGR~~LSH  105 (105)
T KOG4612          64 NEYQPSNLKRKRKHGFLARAKSKQGSKVLKRRKLKGRWFLSH  105 (105)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             755850555431101566514610369999998646201259