HHsearch alignment of GI: 254780481 and MMDB domain: 2ftc_Q_

>2ftc_Q (Q:) L34MT, MRP-L34, 39S ribosomal protein L34, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus}
Probab=99.76  E-value=1.7e-19  Score=109.82  Aligned_cols=38  Identities=50%  Similarity=0.868  Sum_probs=37.4

Q ss_pred             CCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             67878410123323554159777999999997002652
Q gi|254780481|r    5 YNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRL   42 (44)
Q Consensus         5 yQPs~~kRkr~HGF~~Rm~T~~GRkvL~rRr~KGR~~L   42 (44)
                      ||||+++|||+|||++||+|++|++||++|++||||+|
T Consensus         1 yqPs~~kRkr~hGflaR~~t~~GrkVl~RR~~KGR~~L   38 (38)
T 2ftc_Q            1 YQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSL   38 (38)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCC
T ss_conf             99741235443507888357200999999997474369