BLAST/PSIBLAST alignment of GI: 254780481 and GI: 259416138 at iteration 1
>gi|259416138|ref|ZP_05740058.1| ribosomal protein L34 [Silicibacter sp. TrichCH4B] Length = 49
>gi|259347577|gb|EEW59354.1| ribosomal protein L34 [Silicibacter sp. TrichCH4B] Length = 49
 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%)

Query: 1  MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44
          MKRTY PSN+VRKRR GF ARM+T++G +ILN RR++GRK LSA
Sbjct: 6  MKRTYQPSNLVRKRRHGFRARMATKAGRKILNTRRARGRKSLSA 49