BLAST/PSIBLAST alignment of GI: 254780481 and GI: 83950042 at iteration 1
>gi|83950042|ref|ZP_00958775.1| ribosomal protein L34 [Roseovarius nubinhibens ISM] Length = 44
>gi|84499792|ref|ZP_00998080.1| ribosomal protein L34 [Oceanicola batsensis HTCC2597] Length = 44
>gi|99080154|ref|YP_612308.1| 50S ribosomal protein L34 [Ruegeria sp. TM1040] Length = 44
>gi|149914930|ref|ZP_01903459.1| ribosomal protein L34 [Roseobacter sp. AzwK-3b] Length = 44
>gi|163740291|ref|ZP_02147685.1| 50S ribosomal protein L34 [Phaeobacter gallaeciensis 2.10] Length = 44
>gi|254511167|ref|ZP_05123234.1| ribosomal protein L34 [Rhodobacteraceae bacterium KLH11] Length = 44
>gi|260432498|ref|ZP_05786469.1| ribosomal protein L34 [Silicibacter lacuscaerulensis ITI-1157] Length = 44
>gi|122398414|sp|Q1GJX0|RL34_SILST RecName: Full=50S ribosomal protein L34 Length = 44
>gi|83837941|gb|EAP77237.1| ribosomal protein L34 [Roseovarius nubinhibens ISM] Length = 44
>gi|84392936|gb|EAQ05147.1| ribosomal protein L34 [Oceanicola batsensis HTCC2597] Length = 44
>gi|99036434|gb|ABF63046.1| LSU ribosomal protein L34P [Ruegeria sp. TM1040] Length = 44
>gi|149811118|gb|EDM70955.1| ribosomal protein L34 [Roseobacter sp. AzwK-3b] Length = 44
>gi|161386149|gb|EDQ10524.1| 50S ribosomal protein L34 [Phaeobacter gallaeciensis 2.10] Length = 44
>gi|221534878|gb|EEE37866.1| ribosomal protein L34 [Rhodobacteraceae bacterium KLH11] Length = 44
>gi|260416326|gb|EEX09585.1| ribosomal protein L34 [Silicibacter lacuscaerulensis ITI-1157] Length = 44
 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%)

Query: 1  MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44
          MKRTY PSN+VRKRR GF ARM+T++G +ILN RR++GRK LSA
Sbjct: 1  MKRTYQPSNLVRKRRHGFRARMATKAGRKILNARRARGRKSLSA 44