PSIBLAST alignment of GI: 254780481 and protein with PDB id: 2j01

gi|116668229|pdb|2J01|7 Chain 7, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 49
>gi|116668290|pdb|2J03|7 Chain 7, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4). This File Contains The 50s Subunit From Molecule Ii. Length = 49
 Score = 51.4 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 28/43 (65%)

Query: 1  MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLS 43
          MKRT+ P+   R +  GF ARM T  G ++L RRR KGR RL+
Sbjct: 1  MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLT 43