RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780481|ref|YP_003064894.1| 50S ribosomal protein L34 [Candidatus Liberibacter asiaticus str. psy62] (44 letters) >gnl|CDD|179004 PRK00399, rpmH, 50S ribosomal protein L34; Reviewed. Length = 44 Score = 45.5 bits (109), Expect = 3e-06 Identities = 29/44 (65%), Positives = 35/44 (79%) Query: 1 MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44 MKRTY PS RKR GF ARM+T++G ++L RRR+KGRKRLSA Sbjct: 1 MKRTYQPSKRKRKRTHGFRARMATKNGRKVLARRRAKGRKRLSA 44 >gnl|CDD|130102 TIGR01030, rpmH_bact, ribosomal protein L34, bacterial type. This model describes the bacterial protein L34 and its equivalents in organelles. Length = 44 Score = 32.9 bits (75), Expect = 0.020 Identities = 26/44 (59%), Positives = 35/44 (79%) Query: 1 MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44 MKRTY PSN+ RKR GF ARM+T++G ++L RRR+KGR +L+ Sbjct: 1 MKRTYQPSNLKRKRTHGFRARMATKNGRKVLRRRRAKGRHKLTV 44 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.329 0.136 0.388 Gapped Lambda K H 0.267 0.0633 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 716,626 Number of extensions: 26882 Number of successful extensions: 96 Number of sequences better than 10.0: 1 Number of HSP's gapped: 96 Number of HSP's successfully gapped: 6 Length of query: 44 Length of database: 5,994,473 Length adjustment: 17 Effective length of query: 27 Effective length of database: 5,627,137 Effective search space: 151932699 Effective search space used: 151932699 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.2 bits)