RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780481|ref|YP_003064894.1| 50S ribosomal protein L34
[Candidatus Liberibacter asiaticus str. psy62]
         (44 letters)



>gnl|CDD|179004 PRK00399, rpmH, 50S ribosomal protein L34; Reviewed.
          Length = 44

 Score = 45.5 bits (109), Expect = 3e-06
 Identities = 29/44 (65%), Positives = 35/44 (79%)

Query: 1  MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44
          MKRTY PS   RKR  GF ARM+T++G ++L RRR+KGRKRLSA
Sbjct: 1  MKRTYQPSKRKRKRTHGFRARMATKNGRKVLARRRAKGRKRLSA 44


>gnl|CDD|130102 TIGR01030, rpmH_bact, ribosomal protein L34, bacterial type.
          This model describes the bacterial protein L34 and its
          equivalents in organelles.
          Length = 44

 Score = 32.9 bits (75), Expect = 0.020
 Identities = 26/44 (59%), Positives = 35/44 (79%)

Query: 1  MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44
          MKRTY PSN+ RKR  GF ARM+T++G ++L RRR+KGR +L+ 
Sbjct: 1  MKRTYQPSNLKRKRTHGFRARMATKNGRKVLRRRRAKGRHKLTV 44


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.329    0.136    0.388 

Gapped
Lambda     K      H
   0.267   0.0633    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 716,626
Number of extensions: 26882
Number of successful extensions: 96
Number of sequences better than 10.0: 1
Number of HSP's gapped: 96
Number of HSP's successfully gapped: 6
Length of query: 44
Length of database: 5,994,473
Length adjustment: 17
Effective length of query: 27
Effective length of database: 5,627,137
Effective search space: 151932699
Effective search space used: 151932699
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.2 bits)