RPSBLAST alignment of GI: 254780481 and MMDB domain: 3bbo_4_

>3bbo_4 (4:) Ribosomal protein L34; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 152
 Score = 35.8 bits (82), Expect = 0.002
 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 1   MKRTYNP-SNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLS 43
           +  T    S     R  GF  RMST SG  +L RRR+KGRK L 
Sbjct: 96  LCLTKRSRSRKSLARTHGFRLRMSTTSGRALLKRRRAKGRKILC 139