BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780482|ref|YP_003064895.1| ribonuclease P [Candidatus Liberibacter asiaticus str. psy62] (123 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780482|ref|YP_003064895.1| ribonuclease P [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 248 bits (634), Expect = 2e-68, Method: Compositional matrix adjust. Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRM 60 MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRM Sbjct: 1 MSNICILKKRRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERNRM 60 Query: 61 RRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFS 120 RRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFS Sbjct: 61 RRRLKEAVRLCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKRSYYSGKNFS 120 Query: 121 RKS 123 RKS Sbjct: 121 RKS 123 >gi|254780619|ref|YP_003065032.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Score = 24.6 bits (52), Expect = 0.53, Method: Composition-based stats. Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 83 VLIAKRDALFIPFKEL 98 V++ R ALF+PFK+L Sbjct: 300 VIVGVRSALFLPFKKL 315 >gi|254780811|ref|YP_003065224.1| hypothetical protein CLIBASIA_03510 [Candidatus Liberibacter asiaticus str. psy62] Length = 178 Score = 21.9 bits (45), Expect = 4.0, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 89 DALFIPFKELCNHFVERVRRNKRSYYSGKNF 119 LF+ F + FV R R+K+ ++S K F Sbjct: 125 SVLFLSFYHVYLSFVMRKFRDKKLFHSPKYF 155 >gi|254781202|ref|YP_003065615.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62] Length = 864 Score = 21.6 bits (44), Expect = 5.3, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 19/43 (44%) Query: 39 LLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGHD 81 +L RVG Q + R L V L AEGV+ HG + Sbjct: 415 MLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRN 457 >gi|254781226|ref|YP_003065639.1| hypothetical protein CLIBASIA_05665 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 21.6 bits (44), Expect = 5.4, Method: Compositional matrix adjust. Identities = 12/49 (24%), Positives = 25/49 (51%) Query: 10 RRQFALVKKGELRKGPFFSLEVLNNNNSNLLPRVGFTVTKKQGCAVERN 58 +R++ L + ++R+ S L + +S + P +TK + A+ER Sbjct: 64 KRRYYLKNRDKMREKARQSYRKLYSKDSWIAPEEPMGMTKAEIEALERE 112 >gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 598 Score = 21.2 bits (43), Expect = 5.7, Method: Composition-based stats. Identities = 7/14 (50%), Positives = 12/14 (85%) Query: 26 FFSLEVLNNNNSNL 39 FFS+ +L+N+N N+ Sbjct: 14 FFSMGILHNHNMNM 27 >gi|254780498|ref|YP_003064911.1| putative glycerol-3-phosphate acyltransferase PlsX [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Score = 21.2 bits (43), Expect = 6.4, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 20/45 (44%) Query: 36 NSNLLPRVGFTVTKKQGCAVERNRMRRRLKEAVRLCAEGVLKHGH 80 N LL R+G + KK V+ R V L +G++ GH Sbjct: 268 NRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGH 312 >gi|254780603|ref|YP_003065016.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 282 Score = 20.8 bits (42), Expect = 7.8, Method: Compositional matrix adjust. Identities = 9/24 (37%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Query: 100 NHFVERVRRNKRSYYSGKNFSRKS 123 +H+ ++RRN R Y ++F++KS Sbjct: 18 SHYA-KLRRNHRDYKKMQSFNQKS 40 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.139 0.412 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,251 Number of Sequences: 1233 Number of extensions: 2844 Number of successful extensions: 13 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 9 length of query: 123 length of database: 328,796 effective HSP length: 64 effective length of query: 59 effective length of database: 249,884 effective search space: 14743156 effective search space used: 14743156 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 33 (17.3 bits)