>TIGR00485 EF-Tu translation elongation factor Tu; InterPro: IPR004541 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta). This entry represents EF1A (or EF-Tu) proteins found primarily in bacteria, mitochondria and chloroplasts. Eukaryotic and archaeal EF1A (IPR004539 from INTERPRO) are excluded from this entry. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors . More information about these proteins can be found at Protein of the Month: Elongation Factors .; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005622 intracellular.

Probab=97.83 E-value=0.00021 Score=44.40 Aligned_cols=165 Identities=18% Similarity=0.247 Sum_probs=108.0 Q ss_pred EEEEECCCCCCHHHHHHHHHCC---CCEE------EECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH Q ss_conf 8999748998898999997389---7379------873888414521202665556785089649999760010111224 Q gi|254780484|r 31 EIAFSGRSNVGKSSLINILVNR---KNLA------RTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK 101 (212) Q Consensus 31 ~VaivG~~NvGKSSLiNaL~g~---~~~a------~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~ 101 (212) T Consensus 14 n~GtiGhvdhGkttl~aa~~~~l~~~~~~~~~~y~~id~aPe-e~~rGiti~~~~vey~~~~rhyahvdCPGhadyvk-- 90 (394) T TIGR00485 14 NIGTIGHVDHGKTTLTAAITTVLAKEGKAAAKKYDEIDKAPE-EKARGITINTAHVEYETEKRHYAHVDCPGHADYVK-- 90 (394) T ss_pred EEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHCCEEEEEEEEEECCCCCCEEEECCCCHHHHHH-- T ss_conf 330121001550578999999987510035676776523721-13345156533554214675157631886267888-- Q ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC-CCCCCCCCCCCHHHHHHHHH-HHHHHHH Q ss_conf 478988889987777664200000112235788754545543210257532-21222211110246899999-9999975 Q gi|254780484|r 102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSY-QIVLTKIDKLSPTTAQETLE-KTKYLIR 179 (212) Q Consensus 102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~v~nK~D~~~~~~~~~~~~-~~~~~~~ 179 (212) T Consensus 91 -----------nmitGaaqmdGailvv~~~d~~mPqt~ehill~~~vGvP~~vvflnk~d~~~~~el~~lv~~e~~~ll~ 159 (394) T TIGR00485 91 -----------NMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPKIVVFLNKVDMVDDEELLELVELEVRELLS 159 (394) T ss_pred -----------HHHHHHHHCCCEEEEEECCCCCCCCCHHHEEEECCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHH T ss_conf -----------764101111760799952788887411210010026876578764023322427899999999999987 Q ss_pred HCCCC--CCCEEEEECCCCC-CHHHHHHHHHHH Q ss_conf 31368--9868999888889-989999999987 Q gi|254780484|r 180 NYPTA--HPEVIPTSSVKRK-GIEVLRKAILET 209 (212) Q Consensus 180 ~~~~~--~~~i~~vSA~~g~-Gi~eL~~~I~~~ 209 (212) T Consensus 160 ~~~f~G~~~Pi~~Gsal~al~~~~~~~~~~~~l 192 (394) T TIGR00485 160 EYDFPGDDVPIVRGSALKALEGDAEWEEKILEL 192 (394) T ss_pred HCCCCCCCCCEEECHHHHHHHHHHHHHHHHHHH T ss_conf 407898652256114565420036799999999

HHsearch alignment for GI: 254780484 and conserved domain: TIGR00485