>TIGR00503 prfC peptide chain release factor 3; InterPro: IPR004548 Peptide chain release factor 3 increases the formation of ribosomal termination complexes and stimulates activity of RF-1 and RF-2. It binds to guanine nucleotides and has a strong preference for UGA stop codons. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis sp. (strain PCC 6803), and in Staphylococcus aureus.; GO: 0005525 GTP binding, 0016149 translation release factor activity codon specific, 0006415 translational termination, 0005737 cytoplasm.

Probab=98.48 E-value=1.3e-06 Score=57.07 Aligned_cols=121 Identities=13% Similarity=0.214 Sum_probs=80.6 Q ss_pred CCCEEEEECCCCCCHHHHHHHHH--CCC------CEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCH Q ss_conf 68689997489988989999973--897------379873888414------5212026655567850896499997600 Q gi|254780484|r 28 GPPEIAFSGRSNVGKSSLINILV--NRK------NLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPG 93 (212) Q Consensus 28 ~~p~VaivG~~NvGKSSLiNaL~--g~~------~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG 93 (212) T Consensus 10 ~RR~FAIISHPDAGKTT~TEK~LLyG~AIQ~AG~VK~r~S~~~A~SDWM~ME~QRGISIT~~VlQF~Y~~~l~NLLDTPG 89 (530) T TIGR00503 10 KRRTFAIISHPDAGKTTLTEKVLLYGGAIQTAGAVKGRGSQRHAKSDWMEMEKQRGISITTSVLQFPYRDCLVNLLDTPG 89 (530) T ss_pred HCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEEECCCCCEEECCCCCC T ss_conf 02554366168887424678888742566522441220012212213788750588144412774145774562036858 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC Q ss_conf 10111224478988889987777664200000112235788754545543210257532212222111 Q gi|254780484|r 94 YGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDK 161 (212) Q Consensus 94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~ 161 (212) T Consensus 90 H~DFSED-------------TYRTL~A~D~~~M~IDaAKG~E~~T~KL~EV~RLR~~PI~TF~NKLDR 144 (530) T TIGR00503 90 HEDFSED-------------TYRTLTAVDNCLMVIDAAKGVETRTRKLMEVTRLRDLPILTFINKLDR 144 (530) T ss_pred CCCCCCH-------------HHHHHHHHHHHEEEHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCC T ss_conf 8876404-------------679999851230011112561234244542010004744335232065

HHsearch alignment for GI: 254780484 and conserved domain: TIGR00503