>cd01886 EF-G Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group conta

Probab=99.49 E-value=1.4e-12 Score=91.38 Aligned_cols=118 Identities=13% Similarity=0.154 Sum_probs=83.9 Q ss_pred EEEECCCCCCHHHHHHHHHCC----CCEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH Q ss_conf 999748998898999997389----7379873888414------521202665556785089649999760010111224 Q gi|254780484|r 32 IAFSGRSNVGKSSLINILVNR----KNLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK 101 (212) Q Consensus 32 VaivG~~NvGKSSLiNaL~g~----~~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~ 101 (212) T Consensus 2 iai~gH~gaGKTtL~EalL~~ag~i~r~G~v~~g~tv~D~~~eE~~R~isi~~~~~~~~w~~~~inliDTPG~~DF~~-- 79 (270) T cd01886 2 IGIIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAATTCFWKDHRINIIDTPGHVDFTI-- 79 (270) T ss_pred EEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHHHHH-- T ss_conf 899968999988999999986687355815538975566848898768707336689998998999986969678899-- Q ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC Q ss_conf 4789888899877776642000001122357887545455432102575322122221111 Q gi|254780484|r 102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL 162 (212) Q Consensus 102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~ 162 (212) T Consensus 80 -----------e~~~aL~~~D~AviVv~a~~GVe~~T~~~w~~~~~~~lP~i~fINKmDre 129 (270) T cd01886 80 -----------EVERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYNVPRIAFVNKMDRT 129 (270) T ss_pred -----------HHHHHHHHHCEEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCC T ss_conf -----------99999877555999984676442636999988998499989999887877

HHsearch alignment for GI: 254780484 and conserved domain: cd01886