RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780484|ref|YP_003064897.1| GTPase EngB [Candidatus Liberibacter asiaticus str. psy62] (212 letters) >gnl|CDD|179035 PRK00454, engB, GTP-binding protein YsxC; Reviewed. Length = 196 Score = 255 bits (653), Expect = 8e-69 Identities = 89/200 (44%), Positives = 118/200 (59%), Gaps = 12/200 (6%) Query: 12 WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71 F+ P++ LP PEIAF+GRSNVGKSSLIN L NRKNLARTS PGRTQ +NFF Sbjct: 7 AEFVTSAPKLEQLPPDDGPEIAFAGRSNVGKSSLINALTNRKNLARTSKTPGRTQLINFF 66 Query: 72 VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131 D + LVD+PGYGYA+ K+ + W LI YL R L+ V LLID R Sbjct: 67 EVNDK---------LRLVDLPGYGYAKVSKEEKEKWQKLIEEYLRTRENLKGVVLLIDSR 117 Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191 H +K++D + +L + + IVLTK DKL ++ L+K + + EVI Sbjct: 118 HPLKELDLQMIEWLKEYGIPVLIVLTKADKLKKGERKKQLKKVR---KALKFGDDEVILF 174 Query: 192 SSVKRKGIEVLRKAILETIN 211 SS+K++GI+ LR AI + + Sbjct: 175 SSLKKQGIDELRAAIAKWLA 194 >gnl|CDD|163346 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes. Length = 179 Score = 233 bits (598), Expect = 2e-62 Identities = 83/188 (44%), Positives = 113/188 (60%), Gaps = 12/188 (6%) Query: 14 FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72 F++ ++ LP PEIAF+GRSNVGKSSLIN L NRK LARTS PGRTQ +NFF V Sbjct: 3 FVKSAVKLKQLPPDDGPEIAFAGRSNVGKSSLINALTNRKKLARTSKTPGRTQLINFFEV 62 Query: 73 PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132 F LVD+PGYGYA+ K+ + W LI YL +R L+ V LL+D RH Sbjct: 63 NDGFR----------LVDLPGYGYAKVSKEEKEKWQKLIEEYLEKRENLKGVVLLMDIRH 112 Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192 +K++D ++ +L ++ + IVLTK DKL + + L+K K ++ P V S Sbjct: 113 PLKELDLEMLEWLRERGIPVLIVLTKADKLKKSELNKQLKKIKKALKKDA-DDPSVQLFS 171 Query: 193 SVKRKGIE 200 S+K+ GI+ Sbjct: 172 SLKKTGID 179 >gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional. Length = 201 Score = 64.9 bits (159), Expect = 1e-11 Identities = 58/198 (29%), Positives = 93/198 (46%), Gaps = 31/198 (15%) Query: 30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89 PEI F GRSNVGKS+L+ L +K R PG T+ N + D+ + L Sbjct: 10 PEIVFVGRSNVGKSTLVRELTGKK--VRVGKRPGVTRKPNHY---DWGDFI-------LT 57 Query: 90 DMPGYGYARAPKKNV-DSWGGLIVRYLSE--RSTLRCVYLLIDC--------RHGVKQ-- 136 D+PG+G+ K V + IVRY+ + L V L++D R + Sbjct: 58 DLPGFGFMSGVPKEVQEKIKDEIVRYIEDNADRILAAV-LVVDGKSFIEIIERWEGRGEI 116 Query: 137 -IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH--PEVIPTSS 193 ID ++F FL + + + + K+DK+ E L++ + YP ++I S Sbjct: 117 PIDVEMFDFLRELGIPPIVAVNKMDKIKNR--DEVLDEIAERLGLYPPWRQWQDIIAPIS 174 Query: 194 VKRKGIEVLRKAILETIN 211 K+ GIE L++AI + ++ Sbjct: 175 AKKGGIEELKEAIRKRLH 192 >gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed. Length = 292 Score = 62.0 bits (152), Expect = 1e-10 Identities = 48/183 (26%), Positives = 83/183 (45%), Gaps = 28/183 (15%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQH-LNFFVPKDFSNLKNNLPAMALVD 90 +A GR NVGKS+L+N LV +K ++ S P T+H + V +D + + VD Sbjct: 8 VAIVGRPNVGKSTLLNALVGQK-ISIVSPKPQTTRHRIRGIVTEDDAQI-------IFVD 59 Query: 91 MPGYGYARAPKKNVDSWGGLIVRYLSE--RSTLR---CVYLLIDCRHGVKQIDQDVFSFL 145 PG PK+ ++ R +++ S+L+ V ++D + D+ + L Sbjct: 60 TPGI---HKPKRALN-------RAMNKAAWSSLKDVDLVLFVVDADEKIGPGDEFILEKL 109 Query: 146 DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKA 205 K +VL KID + +E L + L A E++P S++K ++ L Sbjct: 110 KKVKTPVILVLNKIDLVKD--KEELLPLLEELSELMDFA--EIVPISALKGDNVDELLDV 165 Query: 206 ILE 208 I + Sbjct: 166 IAK 168 >gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability. Length = 429 Score = 47.1 bits (113), Expect = 4e-06 Identities = 48/201 (23%), Positives = 81/201 (40%), Gaps = 30/201 (14%) Query: 19 PEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDF-- 76 E + GP +IA GR NVGKS+L+N L+ + S+ G T +D Sbjct: 162 EEEEEEEEDGPIKIAIIGRPNVGKSTLVNALLG-EERVIVSDIAGTT--------RDSID 212 Query: 77 SNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRC------VYLLIDC 130 + N L+D G R K + V S TL+ V L++D Sbjct: 213 IPFERNGKKYLLIDTAG---IRRKGKVTEG-----VEKYSVLRTLKAIERADVVLLVLDA 264 Query: 131 RHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN--YPTAHPEV 188 G+ + D + + + + IV+ K D + ++T E+ K +R + Sbjct: 265 TEGITEQDLRIAGLILEAGKALVIVVNKWDLVKD---EKTREEFKKELRRKLPFLDFAPI 321 Query: 189 IPTSSVKRKGIEVLRKAILET 209 + S++ +G++ L AI E Sbjct: 322 VFISALTGQGVDKLLDAIDEV 342 Score = 39.0 bits (92), Expect = 0.001 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65 +A GR NVGKS+L N L K A S+ PG T Sbjct: 2 VAIVGRPNVGKSTLFNRLT-GKRDAIVSDTPGVT 34 >gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE. TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer. Length = 442 Score = 43.2 bits (102), Expect = 4e-05 Identities = 45/183 (24%), Positives = 71/183 (38%), Gaps = 25/183 (13%) Query: 29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMAL 88 ++A G NVGKSSL+N L+ +++ A S+ G T+ V DF L L + L Sbjct: 203 GFKLAIVGSPNVGKSSLLNALL-KQDRAIVSDIKGTTRD---VVEGDF-ELNGIL--IKL 255 Query: 89 VDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKK 148 +D G R V+ G I + V ++D + + D + L+K Sbjct: 256 LDTAGI---REHADFVERLG--IEKSFKAIKQADLVIYVLDASQPLTK-DDFLIIDLNKS 309 Query: 149 AVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILE 208 + +VL KID L + N S K+ I+ L + + Sbjct: 310 KKPFILVLNKID-LKI---NSLEFFVSSKVLNSSNL--------SAKQLKIKALVDLLTQ 357 Query: 209 TIN 211 IN Sbjct: 358 KIN 360 >gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed. Length = 712 Score = 42.9 bits (101), Expect = 6e-05 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Query: 19 PEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRK-----NLARTSNAP 62 G L +G +A GR NVGKSSL+N L + + +LA T+ P Sbjct: 440 KTSGFLTPSGLRRVALVGRPNVGKSSLLNQLTHEERAVVNDLAGTTRDP 488 Score = 34.4 bits (79), Expect = 0.023 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 22/134 (16%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPG----RTQHLNFFVPKDFSNLKNNLPAMA 87 +A GR NVGKS+L+N ++ R+ A + PG R + + DF Sbjct: 278 VAIVGRPNVGKSTLVNRILGRRE-AVVEDTPGVTRDRVSYDAEWAGTDFK---------- 326 Query: 88 LVDMPGYGYARAPKKNVDSWGGLIVRYLS-ERSTLRCVYLLIDCRHGVKQIDQDVFSFLD 146 LVD G+ A + +DS I S V ++D + G+ D+ + L Sbjct: 327 LVDTGGW---EADVEGIDS---AIASQAQIAVSLADAVVFVVDGQVGLTSTDERIVRMLR 380 Query: 147 KKAVSYQIVLTKID 160 + + + KID Sbjct: 381 RAGKPVVLAVNKID 394 >gnl|CDD|163345 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members. Length = 276 Score = 42.5 bits (101), Expect = 8e-05 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 10/55 (18%) Query: 39 NVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPG 93 NVGKS+LIN L +K A+ N PG T+ + L + L L+D PG Sbjct: 128 NVGKSTLINRLAGKKV-AKVGNRPGVTKGQQWI------KLSDGL---ELLDTPG 172 >gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed. Length = 287 Score = 42.1 bits (100), Expect = 1e-04 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 10/55 (18%) Query: 39 NVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPG 93 NVGKS+LIN L +K +A+T N PG T+ + L L L+D PG Sbjct: 131 NVGKSTLINRLAGKK-IAKTGNRPGVTKAQQWI------KLGKGL---ELLDTPG 175 >gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed. Length = 435 Score = 38.9 bits (92), Expect = 0.001 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Query: 19 PEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLAR--TSNAPGRT 65 E + P +IA GR NVGKSSLIN L+ + R S+ G T Sbjct: 163 EEEEEDEEDEPIKIAIIGRPNVGKSSLINALLGEE---RVIVSDIAGTT 208 Score = 35.8 bits (84), Expect = 0.008 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65 P +A GR NVGKS+L N L K A ++ PG T Sbjct: 2 PVVAIVGRPNVGKSTLFNRLT-GKRDAIVADTPGVT 36 Score = 34.3 bits (80), Expect = 0.023 Identities = 20/87 (22%), Positives = 42/87 (48%), Gaps = 6/87 (6%) Query: 124 VYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN--Y 181 V L+ID G+ + D + + + IV+ K D + ++T+E+ K +R Sbjct: 259 VLLVIDATEGITEQDLRIAGLALEAGRALVIVVNKWDLVD----EKTMEEFKKELRRRLP 314 Query: 182 PTAHPEVIPTSSVKRKGIEVLRKAILE 208 + ++ S++ +G++ L +AI E Sbjct: 315 FLDYAPIVFISALTGQGVDKLLEAIDE 341 >gnl|CDD|183417 PRK12299, obgE, GTPase CgtA; Reviewed. Length = 335 Score = 37.4 bits (88), Expect = 0.003 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Query: 154 IVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211 +VL KID L +E + P V S+V +G++ L +A+ E + Sbjct: 276 LVLNKIDLLDEEEEREKRAALELAALGGP-----VFLISAVTGEGLDELLRALWELLE 328 >gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed. Length = 472 Score = 37.3 bits (87), Expect = 0.003 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 18 VPEIGLLPKAGPPEIAFSGRSNVGKSSLINIL 49 VP +G GP +A G+ NVGKSSL+N L Sbjct: 201 VPRVGSAS-GGPRRVALVGKPNVGKSSLLNKL 231 Score = 33.8 bits (78), Expect = 0.030 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 27 AGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65 P +A GR NVGKS+L+N ++ R+ A + PG T Sbjct: 36 GPLPVVAVVGRPNVGKSTLVNRILGRRE-AVVEDVPGVT 73 >gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). Length = 351 Score = 37.1 bits (87), Expect = 0.004 Identities = 18/77 (23%), Positives = 32/77 (41%), Gaps = 13/77 (16%) Query: 136 QIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193 QI+ V L + + +V KID L + E +PE + S+ Sbjct: 286 QIEAVEKVLEELGAEDIPQLLVYNKIDLLDEPRIERLEEG-----------YPEAVFVSA 334 Query: 194 VKRKGIEVLRKAILETI 210 +G+++L +AI E + Sbjct: 335 KTGEGLDLLLEAIAERL 351 Score = 26.3 bits (59), Expect = 6.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 26 KAGPPEIAFSGRSNVGKSSLINILVN 51 +A P +A G +N GKS+L N L Sbjct: 186 RADVPTVALVGYTNAGKSTLFNALTG 211 >gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model. Length = 161 Score = 36.2 bits (84), Expect = 0.007 Identities = 38/182 (20%), Positives = 62/182 (34%), Gaps = 31/182 (17%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91 I G NVGKS+L+N L N T PG T++ L+D Sbjct: 4 IVIVGDPNVGKSTLLNRL--LGNKFITEYKPGTTRNYV----TTVIEEDGKTYKFNLLDT 57 Query: 92 PGYGYARAPKKNVDSWGGLIVRYLSERSTLR--CVY----LLIDCRHGVKQIDQDVFSFL 145 G RA +R L R+ V+ L++D +++ +++ Sbjct: 58 AGQEDYRA------------IRRLYYRAVESSLRVFDIVILVLDVEEILEKQTKEIIHHA 105 Query: 146 DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKA 205 + +V KID +T + N +IP S+ K I+ K Sbjct: 106 ESNVP-IILVGNKIDLRDAKL--KTHVAFLFAKLNGEP----IIPLSAETGKNIDSAFKI 158 Query: 206 IL 207 + Sbjct: 159 VE 160 >gnl|CDD|161735 TIGR00157, TIGR00157, ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option). Length = 245 Score = 35.8 bits (83), Expect = 0.009 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 34 FSGRSNVGKSSLINILVNRKNLA--RTSNAPGRTQH 67 F+G+S VGKSSLIN L S+ G +H Sbjct: 125 FAGQSGVGKSSLINALDPSVKQQVNDISSKLGLGKH 160 >gnl|CDD|183407 PRK12289, PRK12289, GTPase RsgA; Reviewed. Length = 352 Score = 35.4 bits (82), Expect = 0.011 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 19/69 (27%) Query: 34 FSGRSNVGKSSLINILVNRKNLARTSNAPGR-------TQHLNFFVPKDFSNLKNNLPAM 86 +G S VGKSSLIN L+ L R G+ T+H+ F LP Sbjct: 177 VAGPSGVGKSSLINRLIPDVEL-RVGKVSGKLGRGRHTTRHVELF----------ELPNG 225 Query: 87 ALV-DMPGY 94 L+ D PG+ Sbjct: 226 GLLADTPGF 234 >gnl|CDD|162989 TIGR02729, Obg_CgtA, Obg family GTPase CgtA. This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal. Length = 329 Score = 35.1 bits (82), Expect = 0.013 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 6/58 (10%) Query: 154 IVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211 +VL KID L E K L + V P S++ +G++ L A+ E + Sbjct: 278 VVLNKIDLLDEEELAE---LLKELKKALGK---PVFPISALTGEGLDELLYALAELLE 329 >gnl|CDD|179996 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed. Length = 449 Score = 34.7 bits (81), Expect = 0.019 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65 + +GR NVGKSSL+N L+ A ++ G T Sbjct: 218 VVIAGRPNVGKSSLLNALLGE-ERAIVTDIAGTT 250 Score = 34.7 bits (81), Expect = 0.019 Identities = 21/87 (24%), Positives = 34/87 (39%), Gaps = 17/87 (19%) Query: 123 CVYLLIDCRHGVKQIDQDVFS-FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181 V L++D + + D ++ DK + +VL K D +E Sbjct: 297 LVLLVLDASEPLTEEDDEILEELKDKPVI---VVLNKADLTGEIDLEEE----------- 342 Query: 182 PTAHPEVIPTSSVKRKGIEVLRKAILE 208 VI S+ +GI+ LR+AI E Sbjct: 343 --NGKPVIRISAKTGEGIDELREAIKE 367 >gnl|CDD|178861 PRK00098, PRK00098, GTPase RsgA; Reviewed. Length = 298 Score = 34.0 bits (79), Expect = 0.028 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Query: 34 FSGRSNVGKSSLINILVNRKNLART---SNAPGRTQH 67 +G+S VGKS+L+N L L +T S A GR +H Sbjct: 169 LAGQSGVGKSTLLNALAPDLEL-KTGEISEALGRGKH 204 >gnl|CDD|163393 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma. eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. Length = 406 Score = 33.9 bits (78), Expect = 0.030 Identities = 18/57 (31%), Positives = 29/57 (50%) Query: 154 IVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI 210 IV KID +S A E E+ K ++ + +IP S++ I+ L +AI + I Sbjct: 139 IVQNKIDLVSKEKALENYEEIKEFVKGTVAENAPIIPVSALHNANIDALLEAIEKFI 195 >gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era. Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein. Length = 270 Score = 33.9 bits (78), Expect = 0.035 Identities = 33/176 (18%), Positives = 60/176 (34%), Gaps = 20/176 (11%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91 +A GR NVGKS+L+N L +K TS T++ + + +D Sbjct: 3 VAILGRPNVGKSTLLNQLHGQKISI-TSPKAQTTRN------RISGIHTTGASQIIFIDT 55 Query: 92 PGYGYARAPKKNVDSWGGLIVRYLSER-STLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150 PG+ K S L+++ + + ++D + V + L Sbjct: 56 PGF---HEKKH---SLNRLMMKEARSAIGGVDLILFVVDSDQWNG-DGEFVLTKLQNLKR 108 Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206 + K+D + KY I +++P S++ L I Sbjct: 109 PVVLTRNKLDNKFK--DKLLPLIDKYAIL---EDFKDIVPISALTGDNTSFLAAFI 159 >gnl|CDD|132636 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli. Length = 360 Score = 33.7 bits (78), Expect = 0.039 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Query: 34 FSGRSNVGKSSLINILVN----RKNLARTSNAPGRT 65 G +NVGKSSLIN L+ K++ TS PG T Sbjct: 159 VVGVTNVGKSSLINKLLKQNNGDKDVITTSPFPGTT 194 >gnl|CDD|183415 PRK12297, obgE, GTPase CgtA; Reviewed. Length = 424 Score = 33.2 bits (77), Expect = 0.053 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 12/66 (18%) Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204 L++ + +V K+D A+E LE+ K P+V P S++ +G++ L Sbjct: 273 LERPQI---VVANKMDLPE---AEENLEEFK---EKLG---PKVFPISALTGQGLDELLY 320 Query: 205 AILETI 210 A+ E + Sbjct: 321 AVAELL 326 Score = 25.8 bits (58), Expect = 8.7 Identities = 8/15 (53%), Positives = 13/15 (86%) Query: 39 NVGKSSLINILVNRK 53 NVGKS+L++++ N K Sbjct: 168 NVGKSTLLSVVSNAK 182 >gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3-prime or 5-prime non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation. This model describes the elongation factor SelB, a close homolog rf EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This model does not find an equivalent protein for eukaryotes. Length = 581 Score = 32.9 bits (75), Expect = 0.058 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 2/84 (2%) Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQI-VLTKIDKLSPTTAQETLEKTKYLIRNYPTA 184 L++D GV + + LD + + I V+TK D+++ + T K ++ +Y Sbjct: 79 LVVDADEGVMTQTGEHLAVLDLLGIPHTIVVITKADRVNEEEIKRTEMFMKQILNSYIFL 138 Query: 185 HP-EVIPTSSVKRKGIEVLRKAIL 207 ++ TS+ +GI L+K + Sbjct: 139 KNAKIFKTSAKTGQGIGELKKELK 162 >gnl|CDD|184332 PRK13796, PRK13796, GTPase YqeH; Provisional. Length = 365 Score = 32.1 bits (74), Expect = 0.11 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 4/34 (11%) Query: 36 GRSNVGKSSLINILVNR----KNLARTSNAPGRT 65 G +NVGKS+LIN ++ K++ TS PG T Sbjct: 167 GVTNVGKSTLINRIIKEITGEKDVITTSRFPGTT 200 >gnl|CDD|183406 PRK12288, PRK12288, GTPase RsgA; Reviewed. Length = 347 Score = 32.1 bits (74), Expect = 0.12 Identities = 12/16 (75%), Positives = 13/16 (81%) Query: 34 FSGRSNVGKSSLINIL 49 F G+S VGKSSLIN L Sbjct: 210 FVGQSGVGKSSLINAL 225 Score = 26.0 bits (58), Expect = 7.3 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%) Query: 154 IVLTKIDKLSPTTAQETLEKTKYLIRN--YPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211 IVL KID L + + + RN Y V+ SS +G+E L A+ I+ Sbjct: 155 IVLNKIDLLDDEGRAF-VNEQLDIYRNIGYR-----VLMVSSHTGEGLEELEAALTGRIS 208 >gnl|CDD|172963 PRK14490, PRK14490, putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional. Length = 369 Score = 31.6 bits (72), Expect = 0.16 Identities = 14/24 (58%), Positives = 16/24 (66%) Query: 29 PPEIAFSGRSNVGKSSLINILVNR 52 P EIAF G S GK++LI LV R Sbjct: 5 PFEIAFCGYSGSGKTTLITALVRR 28 >gnl|CDD|161878 TIGR00437, feoB, ferrous iron transporter FeoB. FeoB (773 amino acids in E. coli), a cytoplasmic membrane protein required for iron(II) update, is encoded in an operon with FeoA (75 amino acids), which is also required, and is regulated by Fur. There appear to be two copies in Archaeoglobus fulgidus and Clostridium acetobutylicum. Length = 591 Score = 31.2 bits (71), Expect = 0.19 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 8/58 (13%) Query: 36 GRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPG 93 G NVGKS+L N L N PG T V K L + +VD+PG Sbjct: 1 GNPNVGKSTLFNALTGAN--QTVGNWPGVT------VEKKEGKLGFQGEDIEIVDLPG 50 Score = 27.8 bits (62), Expect = 2.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 188 VIPTSSVKRKGIEVLRKAILETINY 212 V+PTS+ + +GIE L+ AI + I Sbjct: 132 VVPTSATEGRGIERLKDAIRKAIGL 156 >gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional. Length = 614 Score = 31.2 bits (71), Expect = 0.23 Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 154 IVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAIL 207 + LTK D++ E + K ++R Y A ++ T++ + +GI+ LR+ +L Sbjct: 109 VALTKADRVDEARIAEVRRQVKAVLREYGFAEAKLFVTAATEGRGIDALREHLL 162 >gnl|CDD|183416 PRK12298, obgE, GTPase CgtA; Reviewed. Length = 390 Score = 31.0 bits (71), Expect = 0.23 Identities = 14/58 (24%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Query: 154 IVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211 +V KID L +E E+ K ++ P V S+ G++ L ++ I Sbjct: 280 LVFNKIDLLDE---EEAEERAKAIVEALGWEGP-VYLISAASGLGVKELCWDLMTFIE 333 >gnl|CDD|179703 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated. Length = 411 Score = 30.6 bits (70), Expect = 0.35 Identities = 19/57 (33%), Positives = 30/57 (52%) Query: 154 IVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI 210 IV KID +S A E E+ K ++ + +IP S++ + I+ L +AI E I Sbjct: 144 IVQNKIDLVSKERALENYEQIKEFVKGTVAENAPIIPVSALHKVNIDALIEAIEEEI 200 >gnl|CDD|179346 PRK01889, PRK01889, GTPase RsgA; Reviewed. Length = 356 Score = 28.4 bits (64), Expect = 1.5 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 17/69 (24%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLA----RTSNAPGR--TQHLNFFVPKDFSNLKNNLPA 85 +A G S VGKS+L+N L+ + R ++ GR T H LP+ Sbjct: 198 VALLGSSGVGKSTLVNALLGEEVQKTGAVREDDSKGRHTTTHRELHP----------LPS 247 Query: 86 MA-LVDMPG 93 L+D PG Sbjct: 248 GGLLIDTPG 256 >gnl|CDD|184387 PRK13908, PRK13908, putative recombination protein RecO; Provisional. Length = 204 Score = 28.0 bits (63), Expect = 2.0 Identities = 10/35 (28%), Positives = 16/35 (45%) Query: 168 QETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202 E +E L R + AHP I + S + + I+ Sbjct: 145 DEKIENEIALARAFLPAHPSCIKSKSFELEKIKEF 179 >gnl|CDD|183014 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed. Length = 588 Score = 27.9 bits (63), Expect = 2.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 32 IAFSGRSNVGKSSLINIL 49 IA G S GK+SL+N L Sbjct: 379 IALVGPSGAGKTSLLNAL 396 >gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional. Length = 352 Score = 27.5 bits (62), Expect = 2.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Query: 36 GRSNVGKSSLINIL 49 GRS GK+SLIN + Sbjct: 31 GRSGAGKTSLINAI 44 >gnl|CDD|178968 PRK00300, gmk, guanylate kinase; Provisional. Length = 205 Score = 27.4 bits (62), Expect = 3.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 32 IAFSGRSNVGKSSLINILVNRKN 54 I SG S GKS+L+ L+ R Sbjct: 8 IVLSGPSGAGKSTLVKALLERDP 30 >gnl|CDD|130550 TIGR01486, HAD-SF-IIB-MPGP, mannosyl-3-phosphoglycerate phosphatase family. This small group of proteins is a member of the IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. Several members of this family from thermophiles (and from Dehalococcoides ethenogenes) are now known to act as mannosyl-3-phosphoglycerate (MPG) phosphatase. In these cases, the enzyme acts after MPG synthase to make the compatible solute mannosylglycerate. We propose that other mesophilic members of this family do not act as mannosyl-3-phosphoglycerate phosphatase. A member of this family is found in Escherichia coli, which appears to lack MPG synthase. Mannosylglycerate is imported in E. coli by phosphoenolpyruvate-dependent transporter (PubMed:14645248), but it appears the phosphorylation is not on the glycerate moiety, that the phosphorylated import is degraded by an alpha-mannosidase from an adjacent gene, and that E. coli would have no pathway to obtain MPG. Length = 256 Score = 27.0 bits (60), Expect = 3.5 Identities = 16/60 (26%), Positives = 24/60 (40%), Gaps = 14/60 (23%) Query: 154 IVLTKIDK-------LSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206 + T +D A+E LE+ + L P VIP +S +E LRK + Sbjct: 1 WIFTDLDGTLLDPHGYDWGPAKEVLERLQEL--GIP-----VIPCTSKTAAEVEYLRKEL 53 >gnl|CDD|178922 PRK00192, PRK00192, mannosyl-3-phosphoglycerate phosphatase; Reviewed. Length = 273 Score = 27.2 bits (61), Expect = 3.7 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 14/60 (23%) Query: 154 IVLTKIDK-------LSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206 +V T +D S A+ L+ K VIP +S +EVLRK + Sbjct: 6 LVFTDLDGTLLDHHTYSYEPAKPALKALK-------EKGIPVIPCTSKTAAEVEVLRKEL 58 >gnl|CDD|177661 PLN00023, PLN00023, GTP-binding protein; Provisional. Length = 334 Score = 27.1 bits (60), Expect = 3.7 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Query: 16 RGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT---QHLNFFV 72 R E P G + G S VGKSSL++++V ++AR G T +H+ + Sbjct: 8 RENKEQNGGPPCGQVRVLVVGDSGVGKSSLVHLIVKGSSIARPPQTIGCTVGVKHITYGS 67 Query: 73 PKDFSN 78 P SN Sbjct: 68 PGSSSN 73 >gnl|CDD|151224 pfam10744, Med1, Mediator of RNA polymerase II transcription subunit 1. Mediator complexes are basic necessities for linking transcriptional regulators to RNA polymerase II. This domain, Med1, is conserved from plants to fungi to humans and forms part of the Med9 submodule of the Srb/Med complex. it is one of three subunits essential for viability of the whole organism via its role in environmentally-directed cell-fate decisions. Med1 is part of the tail region of the Mediator complex. Length = 375 Score = 27.0 bits (60), Expect = 3.8 Identities = 12/68 (17%), Positives = 19/68 (27%), Gaps = 4/68 (5%) Query: 8 TKSAWIFLRG----VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPG 63 +F VP + K P + ++NL + PG Sbjct: 257 VDLPALFSLKLNDPVPNRRFVAKLEPITDLPILGLLLQSEKQTEGDRIKRNLVSLTQFPG 316 Query: 64 RTQHLNFF 71 + QH F Sbjct: 317 KEQHCYTF 324 >gnl|CDD|162033 TIGR00770, Dcu, anaerobic c4-dicarboxylate membrane transporter family protein. These proteins are members of th C4-Dicarboxylate Uptake (Dcu) Family (TC 2.A.13). Most proteins in this family have 12 GES predicted transmembrane regions; however one member has 10 experimentally determined transmembrane regions with both the N- and C-termini localized to the periplasm. The two Escherichia coli proteins, DcuA and DcuB, transport aspartate, malate, fumarate and succinate, and function as antiporters with any two of these substrates. Since DcuA is encoded in an operon with the gene for aspartase, and DcuB is encoded in an operon with the gene for fumarase, their physiological functions may be to catalyze aspartate:fumarate and fumarate:malate exchange during the anaerobic utilization of aspartate and fumarate, respectively. Length = 430 Score = 26.6 bits (59), Expect = 4.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Query: 10 SAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINIL 49 S WIFL GV + L A F G+ +G I + Sbjct: 223 SVWIFLGGVVAVVLYAAAISKRPGFVGKPILGMDHAIVMF 262 >gnl|CDD|185364 PRK15467, PRK15467, ethanolamine utilization protein EutP; Provisional. Length = 158 Score = 26.5 bits (58), Expect = 5.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNA 61 IAF G GK++L N L LAR + A Sbjct: 4 IAFVGAVGAGKTTLFNALQGNYTLARKTQA 33 >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. Length = 571 Score = 26.6 bits (59), Expect = 5.5 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query: 21 IGLLPKAGPPEIAFSGRSNVGKSSLINIL 49 I L+ + G +A GRS GKS+L+N++ Sbjct: 351 ISLVIEPGE-TVALVGRSGSGKSTLVNLI 378 >gnl|CDD|130799 TIGR01738, bioH, putative pimeloyl-BioC--CoA transferase BioH. This CoA-binding enzyme is required for the production of pimeloyl-coenzyme A, the substrate of the BioF protein early in the biosynthesis of biotin. Its exact function is unknown, but is proposed in ref 2. This enzyme belongs to the alpha/beta hydrolase fold family (pfam model pfam00561). Members of this family are restricted to the Proteobacteria. Length = 245 Score = 26.3 bits (58), Expect = 6.6 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Query: 76 FSNLKNNLPA---MALVDMPGYGYAR 98 F L L A + LVD+PG+G +R Sbjct: 20 FRCLDEELSAHFTLHLVDLPGHGRSR 45 >gnl|CDD|183183 PRK11537, PRK11537, putative GTP-binding protein YjiA; Provisional. Length = 318 Score = 25.8 bits (57), Expect = 7.5 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Query: 115 LSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSY--QIVLTKID 160 L +R L V L+D H +Q++Q F+ + + V Y +I+LTK D Sbjct: 117 LCQRYLLDGVIALVDAVHADEQMNQ--FT-IAQSQVGYADRILLTKTD 161 >gnl|CDD|179925 PRK05077, frsA, fermentation/respiration switch protein; Reviewed. Length = 414 Score = 26.0 bits (58), Expect = 7.8 Identities = 7/29 (24%), Positives = 13/29 (44%), Gaps = 8/29 (27%) Query: 69 NFFVPKDFSNLKNNLPAMALVDMPGYGYA 97 ++ P+ AM +DMP G++ Sbjct: 216 DYLAPRGI--------AMLTIDMPSVGFS 236 >gnl|CDD|128368 smart00053, DYNc, Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and plasma membrane following an exocytic event. Length = 240 Score = 26.0 bits (57), Expect = 7.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 30 PEIAFSGRSNVGKSSLINILVNRKNLARTS 59 P+IA G + GKSS++ V R L R S Sbjct: 27 PQIAVVGGQSAGKSSVLENFVGRDFLPRGS 56 >gnl|CDD|185557 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional. Length = 460 Score = 25.7 bits (57), Expect = 8.0 Identities = 12/49 (24%), Positives = 25/49 (51%) Query: 154 IVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202 I+ KID + AQ+ E+ + ++ + +IP S+ + I+V+ Sbjct: 176 ILQNKIDLVKEAQAQDQYEEIRNFVKGTIADNAPIIPISAQLKYNIDVV 224 >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein. This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related. Length = 585 Score = 26.0 bits (57), Expect = 8.3 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 16 RGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINIL 49 +GV ++ KAG +A G + GK++LIN+L Sbjct: 349 QGVFDVSFEAKAGQ-TVAIVGPTGAGKTTLINLL 381 >gnl|CDD|162130 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein. Length = 617 Score = 25.8 bits (57), Expect = 8.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 32 IAFSGRSNVGKSSLINILVNR 52 +A G S GK++L+N L R Sbjct: 54 LAVMGSSGAGKTTLMNALAFR 74 >gnl|CDD|185530 PTZ00258, PTZ00258, GTP-binding protein; Provisional. Length = 390 Score = 25.7 bits (57), Expect = 9.8 Identities = 11/27 (40%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Query: 36 GRSNVGKSSLINILVNRKNLARTSNAP 62 G NVGKS+ N L K N P Sbjct: 28 GLPNVGKSTTFNALC--KQQVPAENFP 52 >gnl|CDD|178630 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional. Length = 697 Score = 25.6 bits (56), Expect = 10.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 88 LVDMPGYGYARAPKKNVDSWGGLIVRY 114 ++ + R P+KN+ SW LI Y Sbjct: 375 RMEDARNVFDRMPRKNLISWNALIAGY 401 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0704 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,455,933 Number of extensions: 212116 Number of successful extensions: 524 Number of sequences better than 10.0: 1 Number of HSP's gapped: 512 Number of HSP's successfully gapped: 76 Length of query: 212 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 123 Effective length of database: 4,071,361 Effective search space: 500777403 Effective search space used: 500777403 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.0 bits)